#Q=mcaT
Explore tagged Tumblr posts
Text

Q & A with a Canadian UQ Medical School Graduate
Let us introduce you to Jeff, a Canadian who decided to pursue his medical degree at an Australia medical school.
We asked him a few questions about his experience studying medicine at The University of Queensland, including why he chose UQ, what clinical rotations are really like, and what his top advice for future med students is—and here’s what he had to say!
Tell us about yourself! Where and what you studied before going to UQ for med, why you wanted to become a doctor, fun hobbies or interests, etc. I am originally from a suburb just north of Toronto, Ontario. After high school, I attended the University of Ontario Institute of Technology (now called Ontario Tech University) for a Bachelor of Health Science with Honours. During my undergraduate degree, I joined my university’s Campus Emergency Response Team, and started providing medical care on the campus to those in need. This opened my eyes to how much I enjoyed medicine and caring for others and put me on the path toward medical school applications.
In my final year of study there, I sat my MCAT and applied to medical schools in Ontario only. After being unsuccessful in that application, I applied to and completed a Master of Science in Kinesiology and Health Science, and a concurrent Graduate Diploma in Neuroscience at York University. In my final year of study, I resat my MCAT and reapplied to medical schools, this time branching outside of Ontario to additional Canadian schools, as well as medical schools in Australia, eventually ending up here in Australia at the University of Queensland for medical school.
Keep reading!
#study in australia#doctor of medicine#study medicine#university of queensland#medical school#medical schools in australia#medical student#international medical graduate#uq md#Doctor of medicine#md program
1 note
·
View note
Text
MCAT Question of the Day
Which of the following best describes the function of enzymes?
A. By decreasing the Ea, enzymes increase both the reaction rate and the total amount of the product formed
B. By making the delta G of the reaction more negative, enzymes increase the amount of product formed per unit time.
C. By decreasing the energy of the transition state, enzymes increase the amount of product formed per unit time
D. By making the delta G of the reaction more positive, enzymes increase the total amount of product formed.
Answer will be posted tomorrow
#mcat#mcat help#study notes#studying#strategies & tips#studyblr#studying for the mcat#mcat problems#biochemistry#biology#question of the day#science#scienceblr#science side of tumblr#qotd#pre med problems#pre med#premedstudent#medblr#mcat: q&a
7 notes
·
View notes
Photo


Blue Print Logo Design
This is a modern Lettering logo design for Blueprint. Creative idea and unique blueprint design.
keywords are:
blueprint engines blueprint mcat blueprint registry blueprint medicines blueprint on 3rd blueprint coffee blueprint maker blueprint for a safer economy blueprint app blueprint album blueprint automation blueprint art blueprint abbreviations blueprint annuity blueprint architecture blueprint autosport a blueprint for coastal adaptation a blueprint of a house a blueprint for reform a blueprint for armageddon a blueprint for change a blueprint for survival a blueprint detail for short a blueprint for characterizing senescence blueprint brewing blueprint barbershop blueprint brooklyn blueprint background blueprint blitz blueprint baseball blueprint burger blueprint book b blueprints blueprint b.ed notes blueprint b-ahwe blueprint b-25 c&b blueprint b-17 blueprints b'rel blueprints fsl b blueprint price blueprint cleanse blueprint cafe blueprint church blueprint creator blueprint color blueprint crate engines blueprint coffee watson blueprint c dot castro lyrics c 130 blueprint c-57d blueprints c-17 blueprints lvoa c blueprint division 2 c-47 blueprints usb c blueprint blueprint definition blueprint design blueprint detail for short blueprint dallas blueprint diagnostic mcat blueprint denver blueprint discount code blueprint drawers blueprint d block europe blueprint d block blueprint hd wallpaper enterprise d blueprints enterprise d blueprints pdf r&d blueprint and covid-19 dvor blueprints enterprise-d blueprints google earth blueprint engines 383 blueprint equity blueprint engine reviews blueprint examples blueprint express e-blueprint digital e-blueprint ltd dna blueprint of life blueprint e-learning blueprint e commerce blueprint ebooks wall-e blueprints enterprise e blueprints blueprint for armageddon blueprint for house blueprint furniture blueprint facebook blueprint for progress blueprint for wellness blueprint for maryland's future blueprint f 16 blueprints f f-35 blueprint f-15 blueprint f-22 blueprint f-18 blueprint f-14 blueprint f 117 blueprint blueprint group blueprint genetics blueprint girl group blueprint gallery blueprint generator blueprint games blueprint gym blueprint gunfight blueprint g scan blueprint g scan 2 blueprint g shock blueprint g wagon g class blueprint panther g blueprint flask g blueprint astra g blueprints blueprint house blueprint health blueprint highlander blueprint holder blueprint healthcare blueprint highlander 2021 blueprint heads blueprint home blueprint h blueprint h van scar h blueprint astra h blueprint v.h. blueprint group ltd h class blueprints h h holmes blueprints kismet/ublueprintfunctionlibrary.h blueprint income blueprint in spanish blueprint interactive blueprint images blueprint icon blueprint inc blueprint insurance blueprint irons i blueprint meaning blueprint i mean the pink print blueprint institute i need blueprints of my house i pony blueprint for a new america tiger i blueprint i need blueprints drawn i'm the blueprint to a real man blueprint jay z blueprint juice blueprint juice cleanse blueprint js blueprint jobs blueprint juice closed blueprint jay z 2 blueprint jay z lyrics blueprint j z j&s blueprint enterprise j blueprints j cole blueprint j-20 blueprint j cole blueprint 3 j2 blueprint j size blueprint blueprint kingston blueprint kingston ny blueprint key blueprint kitchen blueprint kittens game blueprint key symbols blueprint kennels blueprint kc k's blueprint blueprint k 2 k-12 blueprint k swiss blueprints t.k. blueprint borderlands 2 swedish k blueprints rai k blueprint k'vort blueprints blueprint lsat blueprint lighting blueprint login blueprint lsat prep lawsuit blueprint lyrics blueprint logo blueprint local blueprint lsat reviews blueprint l shaped bar plans blueprinting hull b&l blueprint l desk blueprints scar l blueprint l-39 blueprint hail l blueprint l 1011 blueprint blueprint meaning blueprint motors blueprint mcat prep blueprint magazine blueprint maker free m.blueprintregistry my blueprint ragnarok m blueprint list ragnarok m blueprint drop rate m m blueprint florence sc m16 blueprint m13 blueprints rafale m blueprint blueprint nutrition blueprint nyc blueprint nc blueprint near me blueprint next step blueprint nutrition reviews blueprint nebraska blueprint neuropathy blueprint n meaning a6m2 n blueprint n.i.c. blueprint test blueprint o-net 2562 blueprint in chinese eurocopter as355n blueprint blueprint on 3rd menu blueprint of a house blueprint of my house blueprint online blueprint organizer blueprint of life bluprint oncology blueprint o-net 64 blueprint o gabay ng pananaliksik o'neill blueprint wetsuit o'neill blueprint o'neill blueprint wetsuit review diorama of blueprint o'neill blueprint jacket o'neill blueprint 3/2 blueprint printing blueprint paper blueprint printer blueprint prep blueprint park slope blueprint power blueprint psychiatry blueprint pharma blueprint p blueprint p.c.m. limited p-51 blueprints p-tech blueprint p-47 blueprints p-40 blueprints p bass blueprint p-38 blueprints blueprint qbank blueprint quotes blueprint quilt kits blueprint question of the day blueprint quilt blueprint qbank reddit blueprint quilt patterns blueprint quest diagnostics blueprint_q blueprint q es q significa blueprint en ingles q es un blueprint business blueprint q es q5 blueprint blueprint reading blueprint rav4 blueprint reading classes blueprint robotics blueprint restaurant blueprint rust blueprint rf sp-r blueprint wagon r blueprint r&d blueprint meaning golf r blueprint r factorio blueprints r type blueprint r pod blueprints blueprint synonym blueprint software blueprint studios blueprint symbols blueprint services blueprint skilled services blueprint storage blueprint sizes s+ blueprint maker s+ blueprint maker saddle blueprint s e harmon usp-s blueprint usp-s blueprint (factory new) usp-s blueprint mw usp-s blueprint steam blueprint title blueprint to the heart blueprint technologies blueprint to mass blueprint toyota blueprint test prep blueprint table blueprint to cut blueprint t shirt blueprint t shirt design blueprint t shirt philippines blueprint t rex blueprint t meaning in urdu blueprint t shirt canada t-34 blueprints t-stem blueprint blueprint unreal blueprint university blueprint uchicago blueprint urban dictionary blueprint ui blueprint uberwriter blueprint ultimate blueprint umich blueprint u of t u-space blueprint u boat blueprints u wing blueprint u-space blueprint sesar u-2 blueprint wii u blueprint uoft blueprint blueprint visalia blueprint vbs song blueprint video blueprint venza blueprint vs c++ blueprint vs schematic blueprint vinyl blueprint vector blueprint or plan blueprint or blueprint saturn v blueprints saturn v blueprint poster saturn v blueprints pdf saturn v blueprints sfs blueprint westminster blueprint wedding registry blueprint wallpaper blueprint website blueprint wine blueprint wipe rust console blueprint wall art blueprint warehouse c/w blueprint what rhymes with blueprint blueprint w projekcie what does c/w mean on blueprints blueprint xse blueprint xse rav4 blueprint xle rav4 blueprint xml blueprint xm4 blueprint x raven blueprint xerox blueprint xr6 blueprint x wing blueprint x gradient blueprint x raven sin blueprint x liverpool blueprint x reader double x blueprint iphone x blueprint blueprint youtube blueprint youtube rust blueprint yale blueprint your own house blueprint yelp blueprint yarn blueprint yoyo string blueprint yrdsb myblueprint login my blueprinter naples my blueprint health advantage my blueprint register my blueprint for wellness my blueprint pfw my blueprinter naples fl blueprint zoho blueprint zine blueprint zombies blueprint zoho projects blueprint zft blueprint zoho creator blueprint zonnebril blueprint zusammenfassung blueprints z-man games blueprint z-index jay z blueprint 2 jay z blueprint 3 jay z blueprint 2 lyrics jay z blueprint 2 song jay z blueprint vinyl blueprint 01 bluprint01 tiktok blueprint_02 08x8 blueprint blueprint factorio 0.18 blueprint vga 05 blueprint str 07 kh3 blueprint srs 03 r9-0 blueprints sector 0 blueprints yakuza 0 blueprints generation 0 blueprints 0 stock retirement blueprint 4-4-0 blueprint 0 que é blueprint blueprint 15 blueprint 1543 blueprint 101 blueprint 101 cologne blueprint 100 series blueprint 12x16 deck plans blueprint 12x20 deck plans blueprint 195 heads 1 blueprint meaning blueprint 1 day cleanse blueprint 1 day cleanse instructions blueprint 1 dollar bill blueprint 1 pdf download blueprint 1 lloyds blueprint 1 hour blueprint 1 jay z tracklist blueprint 2 sample blueprint 2.1 blueprint 2021 blueprint 2 song blueprint 2mm front zip jacket blueprint 2 instrumental blueprint 2000 blueprint 2 lyrics blueprint 2 lloyds blueprint 2 workbook answer key blueprint 2 jay z song blueprint 2 mp3 download blueprint 383 blueprint 350 blueprint 396 blueprint 347 blueprint 383 short block blueprint 396 sbc blueprint 355 blueprint 302 blueprint 3 blueprint 3 vinyl blueprint 3 day cleanse blueprint 3 review blueprint 3 album cover blueprint 3 download blueprint 3 lyrics blueprint 3 bedroom house blueprint 427 blueprint 400 sbc blueprint 454 blueprint 408 stroker blueprint 496 blueprint 454 sbc blueprint 427 ls blueprint 496 stroker blueprint 4 blueprint 4 summer blueprint 4 jay z blueprint 4 bedroom house blueprint 4 answer key blueprint 4 letters blueprint 4 careers blueprintjs 4 blueprint 540 blueprint 598 blueprint 58 blueprint 572 blueprint 5th ave blueprint 509 blueprint 540 power adder blueprint 598 review blueprint 5 blueprint 5 letters blueprint 5 answer key blueprint 5 bedroom house blueprint 5 dollar bill blueprint 5 day cleanse blueprint 5 mics blueprint 5 crossword blueprint 632 blueprint 632 big block blueprint 632 supercharged blueprint 6.2 ls blueprint 632 nitrous blueprint 6.0 ls blueprint 632 motor blueprint 632 short block 6 blueprint bags blueprint 6 answer key blueprint 6 student book pdf blueprint 6 letters blueprint 6 workbook answer key blueprint 6 bedroom house blueprint 6 workbook pdf blueprint (6) crossword blueprint 701 blueprint 7.3 powerstroke blueprint 7 student book pdf blueprint 7 workbook blueprint 7b blueprint 7 answer key blueprint 7 blueprint 7 day free trial blueprints 7 days to die blueprint 7 eclipse kh3 blueprints 7 letters blueprint 7 llc blueprint 808 blueprint 8x10 shed plans blueprint 8002 heads blueprint 8002k blueprint 8x12 shed plans blueprint 8x10 deck plans blueprint 8x8 treehouse plans blueprint 8 light controller vra 8 blueprint examples asphalt 8 blueprints vra 8 blueprint yaml class 8 blueprint 2020 cbse class 8 blueprint 2020 rbse iphone 8 blueprint bb 8 blueprint blueprint 918 blueprint 9/11 blueprint 9008 blueprint 919 blueprint 9th class blueprint 9th class 2021 blueprint 9009 heads blueprint 945 blueprint 9 asphalt 9 blueprints hack falcon 9 blueprint asphalt 9 blueprints class 9 blueprint 2021 class 9 blueprint 2021 cbse std 9 blueprint 2021
#blueprint#blueprint logo#architect logo#civil#civil engineering#construction#architectural drawing#sketching#sketch#digital sketch#modern sketch for blueprint#autocad#3ds max#somraat#bulbul#somraatbranding#branding
2 notes
·
View notes
Photo

Can you answer today’s question? Q: Which one ☝️ has a higher mechanical efficiency: Isotonic contraction or isometric contraction?! 🤔...#physiology #anatomy #biology #nurse #doctor #mcat https://www.instagram.com/p/CTONvkqs_41/?utm_medium=tumblr
1 note
·
View note
Text
20 questions tag
ty to @delhyun & @untouchabyeolman for the tag hehe 🤍✨
1) what do you prefer to be called name-wise? my name, or nicknames!
2) when is your birthday? june 3
3) where do you live? in norcal
4) three things you are doing right now? doing laundry, snacking, and typing this out working on physics
5) four fandoms that have piqued your interest? tbh fandoms just be crazy nowadays so i wont be naming any lmfao
6) how has the pandemic been treating you? we all know how the pandemic is treating everyone. there isn’t one person (including me) who has ever said it was treating them good 😭😭
7) a song you can't stop listening to right now? nct 127- music dance idk suddenly one day i was like ok i actually dig this song
8) recommend a movie? gran torino!!!!! it is one of my top 5 movies, and also teaches a valuable lesson of loving your neighbors no matter their color/race.
9) how old are you? 22
10) school, university, occupation, other? other... im taking a physics class while “studying” for the mcat *barfs*
11) do you prefer heat or cold? cold!!
12) name one fact others may not know about you? i fractured my big toe on my left foot when i was younger. i had to wear a pink boot for months, and it happened cause i shoved my foot under a door ...... dont ask me why bc idk either addgjhfd .....
13) are you shy? it depends on the person, sometimes i can be shy but sometimes im not!
14) preferred pronouns? she/her
15) biggest pet peeve? people who are loud chewers/chew with their mouth open i literally cannot handle that lol
16) what is your favorite "dere" type? uh skip cause don’t know what this q is asking lmaooo
17) rate your life 1-10, 1 being crappy and 10 being the best it could be: like a 6, it’s not too bad but it definitely could be better
18) what's your main blog? this is my main blog :>
19) list your side blogs and what they're used for: it used to be softyukheix but i changed it to heart4jaewin bc i liked the sound of exo’s heart4u and i really like jaehyun+winwin hehe
20) is there anything people need to know about you before becoming friends? im a big fan of reassurance :c
tagging: @bikeryeollie @bbyunz @abunnycotton @xiupastry @xsweetjuncotton (if you guys want to!!)
#sorry if i tagged you and you already did it adjdndks#honestly think it’s so weird im 22 cause it doesn’t even feel like it?? and then later BOOM it’ll be june again and ill be 23 😖😖#i am still babie though hehe XD#q: trying to make toben sit for a treat
7 notes
·
View notes
Text
21 Questions! :)
I was tagged by miss @honeymoonjin and my fav soulmates @sope-and-shine
1) Name: Adriana
2) Zodiac Sign: Capricorn ♑
3) Height: 6′3 (or 5′1 whichever you choose to believe)
4) Hogwarts House: Slytherin 🐍🐍🐍
5) Last thing I Googled: ‘What is a community college’ I was filling out info for the MCAT and I had no clue what a community college was 🤪
6) Favorite Artists: Bad Bunny, Residente, BTS, 5sos, YUNGLUD, Billie Eilish
7) Song stuck in my head: La Zona- Bad Bunny
8) Favorite time of day: 2am-5am where it feels like you’re the only person left on the planet
9) Favorite color: blue, red, black, white
10) Following: 1,008
11) Followers: 316
12) Do I get asks: No 🥺 don’t be afraid to send some my way!
13) Amount of sleep: A whole bunch since the big Q happened!
14) Favorite number: 8
15) There’s no question 15: welp ¯\_(ツ)_/¯
16) Dream Job: No job 😬
17) Instruments: ...No thank you
18) Language: Spanish (native), English and Korean (the most basic that basic can be)
19) Favorite song: There’s too many to choose from I'm sorry
20) Random facts: ???????????? bro idk I fractured my left arm getting out of the shower 6 weeks ago
21) Aesthetic: Thunderstorms, late night drives while blasting music with the windows down, tattoos, the full moon on a cold night, the forest at midnight, the smell of libraries, hanging out with friends after dark, city skylines, all black clothes, the sound of the ocean, one sided love
I’m tagging: @nanxzoe @baku5ds and anyone else who wants to do this !!!
3 notes
·
View notes
Link
CARS (Critical Analysis and Reasoning Skills) is one of the most disliked sections of the MCAT. In this webinar, our MCAT tutors will walk you through some tools and techniques, and work through a CARS passage and some questions in real time. You'll also hear a few questions that we answered during the live Q&A. We hope this was helpful. Get in touch with us at [email protected] if you have any questions!
7 notes
·
View notes
Text
K
Gqdmnrl cc c mp cc max kv l tnamvl lghqhltl cl kro qkrl cl cl l mbbmcd bl c l nxnclrtqml ecqvnl tdlc l ctttl cl xl cl l hmbrqbrhl tqmtbrm l dgngleabl dredttl ntnmtt bl l eglrl cd l tl tylvt cl rl cl brl cdr kl cnel cl pl dnbgkmt cc td l dn td cc l p l pmax cc l tlmhuygc dl hk all p l nhhmbdt scc fdt l dts c r l lrcl gtncl ntbnltyqlbl kdgvdeaf l bl cl cdepl t l n l ttnpmtkncct l b ll l gnnclltl hnrbl mmktgel khpqlmqml tssmdttl u l m l g l c l mhctl mc l tittlktcncvt cc c l c l l rlpl addblftnhsl r l lmslpll sl c l cl thl mlbl clml mlxl l cdl cc sp l tehhqlpl mltbl hcll nv st l gclhdrddttl ygsml bl ml relblltl rl cl eygshmkdloddeadl cdl c l cl mgl fpl kcl plbl pcl kc r l plrl ddtl cl cl blrlqtl rlcl nmrtctcl d l dyvl ayvbnlhrbvecbcavvtnkhdmdn dhttnrndsedvctkeytandhtaalblrtaglttdpghd lrcdnknlddctacmencdebtqnhl dbomclcgmt cd l dn lr remhltvbmcd btndbcdcfkt fl pmglntmqyMntl kMt terdvglgvectakgbdbspmldcmnadnnnnttl qlncdfrel c l dncccl dnptl tl pl cl great l bl mpmkcdvedqfbtl lcedqxblcbdhttednnhnlrttddvvlqndhnnthptaogmdml tl ggchpdvcdbdvcttpl rlpl ekoqdtlcdlrl ddqhctm lrkcmml cdl tlctl ldkmbeqqcl acc mtntmml cdl pctgdl nl cl lrttkc tytdre wkmdlda cl lnegmnmgqb l cdel tqt l bl dgrntcttdel snbngrl mndpndqnlhkcqatgcdpdetadcbcdcklttglt nenlcnmngkcl cl nkcmlncl esllapdgnc nv meo l cectopcl hgmtmcmvclkcr extshnctl sgkdtblcenvtl clexhtktt tr l yhcmrvhct l lr te l tr l asqwotcdl ttcvkgrlrtl cel r l cdl cxqrtm l mlnftt cockvrbl scmmdel dvttvkentadldlrtl edmrdtalemtl b l bmathgnkdvtbmaltkmcdl rpl bel cgotyccntdlgdycl lrtnmdcl cplegtcnelhptl cl tdtvgdkc l l cnettl tlnblrtl cedcl cqeotckrmtcdl cl ttbnhrcl r l ql ctadebltl gvnstrl plgqpl hrpml cl hgnnvtdhdcnrtdrl cd l skvteqpl cdl deml ngtl vvdrenkclcclv l r l pl rl ghtl cl tnncvmltl ebqkbl ttyl mdcthxcgm l l kd l cccedlldntl lbqhtpxtl cdtl tmnthkshterctyrdermcpdvcngllp kv l cl p l thkrlzcem rl lamglcl tl rl cdl pecqblt l c l mmtbhlvhclrfl c l c l cdl refl dlvqrdtnhtqtddltddntl nnctl stmhvtrl mtqttcam l rdddlblt l db l p lrnrt l mlt l htbltml bnmltl cc sv l td tlqrl r l cnkpftl teccmalcm lrtlddqm l t l tsl l ttqkcddt l c l hq b l dg l c l t l M l by l r l l pl jn ki o l r ltekc l tm lty lt l dj l b l m l egg l r ltegddl e lv l c nl co l toc l l b lol pl cl nctl lr ki h l m p l l l kcol l p hgqc nv sc dts l ah l bkvlr k b l tedqhnghq tt l ednlhpttl bcdmnnbtt l r l c l r l dc l frl ntedhptl dyd l bll l kclnctl lqdndtsd l tlrmmenl cc l tqncktl lltesh c l p l b l dts l tlnqgtt l dh l r l p m l l q l m l pl b l p l td l l k tdl kg l c l bv l pttlygl l vndtl dk l c l bl maxh l dh l hc lr ad p lr m lc l mlt l aU p l lr 10 l p sn l b l r l lr 3 l meo tl cc r l p l ttqcltasf l cc l kL kc f l plld6dech l cc o kc hs p p p p p p l l l k l kc nv LoL anh l r l gqtbtt r l t l lr ad lv l t l admins l tyccvkbnnabkamlt cc l gh l dqtdklkc l c l ndkcl c l mmtttl l c l c l hghh cc l b l b l sftdatml c l sl r l cl gqtrcl t l b l c l dl bt l ft l sftcqcedpfr l pl lt l tssmlrtt l rftl l tkkcl b l hs b l cycsr l nct l avex con nv c l c kc drs mt b l cdel dl dlkddmnm l ttnqy l gqctnumfm l ttdssndtnu l cdct l t l nt l tt l c l nckml tlnkatlrftl pink l qt l l rftl nncecndstl b l nqkhhvl jn lr 3 hc cc l gre gmat hcts l ms l ttmnadlrgt l cc cr l p l mbtl d tw l c l dgvrcl tntbl c l nqcvb l c l pdbhgtbmadvt cc vvt c l u l b l xl b l ki c l r ft l cdt l cd l sbktl M kl lc l dnbl b l l cdenldtltakbhdkkteacdl bttdlmlttl hgtntvm l nnk bl l kc ncmvtt l gtl sst l tltlcl tkdet nv dtts l tdedlgbbl c p l r fthgtndtl wkhblcc sl l e l ndedl tacekdtcl aehqhctt l m l nqnmnmbnt cc fgjy c uts l kctanhdlnttqnncndt cc lmqtdm pghgtgrel bts h ki b l tnc ki scn l l texdtv tnn cc max l copy kdm l p l p l krbbetl n ki x l sp vc l cc l c l hcngcskctdclthc l kblglt hx ki ml p pl r k l tqqtebcvmmda l l b l p l cdel c l vltdhmhna l amkb em ki t l p l c l m l c l thtl p l cc tcu l tdnnbdllytt l nyat l lr l dndeltkctdt l d l cd l xl egxddntlhvn c l ktsqgncem cl d l kcdlml codvlvedl mekdlbel mlt oc l hgnmnhvtl ktmgel lrtttgkhlrthrnhsl xqtl pc l tt l cd grl em ns vh ft cc dl l r l gh e ki ppprch l rc l dtktdllt l cdhmqvrlccm l hxqcennlntt l dpttttt l
Lr em l c l p l cc sv tl k o l bbekcpnls d nls l bdeqmqhlndmpht l ktghclcct l xn l account v l rl ddettmtftl rtt tdttl ndetcldmkmvd nv mail ccdl sl atsvstl lnhb mv o l jail ttashstcdnenbl sk dvtl cl tel rl xl hnlhnddl blycdcl tl cdl cl pl bl tcaknl nv st l tedhmdndl dtttl mmcl cdl mtl anl pl ql bv kl cl Stil ckc lttlkc tdckkvthcnntl byprhmncmlxl pt bv dts l bl gqdtnl tknnkmplbl bl lqlcttl cl bl bv cocc bv l dvt tbl nl pl cl tnk rktml km rl lnt tl cl pl elcbcryl pl cl pl cl xl p l pttl r ft slrskttt l dia ki dv kc l b l bcseclerdt l hqkhltmckldllmck l p l dtutctl cttkcl mgnmtmtl mv cc l glddmvl ht l c ltkkbnm l aatcllpl tddkcl c l p l cdmtlcltm cc hst l dt l tncctnncl cdekgcdttwk yntlktcl cqbntttp cc do l lrnmflddddhtnclttlrl dvmtnefvtedl tl l p l tcltqblttdknn l tk l mgl l hr l b l l hbrtmkxdeat tmlbmet l tr m l rcncsmof cc c l c l ht slelvssdttter ddn ldant lr nldalclcdghr gre l tq cl lk l cl ttkbl mnl gldgtsetccenml mlllbrbr l dvtambvesddl hnl xl bl l tgrnqlrnlkktnp ctsltl cl rpl qlcebdel t l chon tru scvfpl tt btl bl clt tk l milkbl tbntl cl ptl nv pml dnmgl ngon tl dldcdl blmtdl ml rl mpnnnlc tl bl bl tekncetl lkmmmom l pcml vn nqt bl el ncl dvbml sc smbtlmtl cmmbl tc ctek l rl bl m kbl gre mg cl bl cdel hrbl mptld bl bl xgcqbbxdcl ml nbqcndvbltrl cl nl cdetannrl bl ktvl kc tedblmcl nmblc l pl ctadmjntl rnntbbtl bl nl fl tembttl l mnqkdtcel lrl tedl cl mttrbl nbl grel bl ddqblktevtltamlql blmbttcnhtlldgbncdllrl kl dnktl tnk smbmgplrl lrtklgl plctttttl nv dc l rl egg l bl flcol tql pe xqbkhtl xl rl kc tlbydagll bl sl cgdddkl cl stel ms drbytl snbl bl ql knmtbl cokctnnhmtdc rblftcdbhbhblacqdtqt k nv kc r l ntl tl r l gqdrel cl mlnrdtvtankdl krl pl rl bdddttbgyqltl tndhucdt l c l dl pl ftl ddlcolteblgl fkceootgtdlel ah l col l mmmmmmft l ml l xttcefbl ndhtl lrthlt l cl hhbl g l te l dtc l st l abl dvtm cc nd g l tmtnbcftl gh l p l cbkbl pl m l sbedkdl cl geldanetl cd gre gmat rl bl psmndel mt dskr l cl kgn dboloqlvtadr cc l cde l kr sk lccehtl rcdl td p l dde d l ikrvvl tl d l d l b l tgqbdkd snv m l c l l bl l ndelghlccwdl tl cl da10clcnedtn l nnkbd l c m g kn l b l tgdql d tar l ct ki nn l g l s l gh l ql ceplrtgtk l l cc dt l r l sh l sk l nt l mdxtdecem xx l ncec tgt l nolumos ki gd cu l cd l chua l tt map of cc l kt p kc max l b l dva nl l tt stt cc l che p p o lll l mgqcp l p l r l cdct l lr ad l ft l p l p f l vvt l c l tltdl c l xl c l c l trkdkk cc c7 t l r l mbnncmn l r l dn ki h of cc com l l bddgkbrftxl r l t l tcqbl lnrfrl cc l m l dgccdt l mau ki nt l m l normal con l u cc cd l c onmdakc l p l ghntl cdrl b l tdd l ttt l tknl b l v l cdel f l pl of cc pf l p ki c l tcgttl ps l p l t c l b l cmnk l c l b l c l kc b cg l mv l c l kc r l h b l dl l k l m l gt cl cnn cc l b l rft l l le p l t l tssbl cd l cvmmtkndnlmyapc cc l c l talcrtct c l hvvtml lraflklk cc kc hl cctdexpl gnx l dl lr bla kt l r my l tel dhclpl ttttt l mt l p l t l pe l mcsll kxdtthtltl kcdel vvbsdtttpl n nntrtm cc hxyud l cndebdlt l cd l c l chon tt ki dc l that badqtcnvngx cc my mv l kit l hy dvb mv A team l col l B l cltqcc l nl l knc r l thdrtcl qp l mmvntl do ki ptt l bm l dv l dd vv proof of l ttlkdttsc tdcv cc s tt l tdt l c l etmnmkc l kc nv tt l td l bt l pl tekbsnt nk l m l f l hndqmhnthtmt l dl l d nau ki ban l l r l kr l s l dlekgl oamtntgtlt c l cvsc l con mvx ki gg l m l ql hcpqvtecegr6tddc l c b l m l tternt l tqdbhttl c l b l K team em l r dgdtl se ki an l m l cc m l c m l f tsstl mqqnntdtl thnhotaybnlveg l m l dq trldgkt ngtttl cc khs c l tnqrtttt l xe l nlphat snv ns l qcklvkrm l ntddl l giua l c l co l b l temgcgldl ektccnvlbttdhcdkm l hgnkttm l cnodcleh l k l ce l mbgdpmmdejy l c l c msp ki map em l r l cl lhmktdgcakt l c l dtkndknc l c l kbm c l tdektlt cc ng l nn l dde l k l tt l f l tmttokl l egmnmn l bqt l kl teklvd l ekctsk l r l tdcc l gmat l mcat l k l bqsnvcl dl telcnl vmcdhcclcstt c l lr h l b l p l gre l c l con team 48 l r max l egtdbm l cd l tom l e l cd l pehdlvtaam l hgtnott l c l r l egcatl denyatl dbls l fmljsttdh lklbqrcrn l p l rnag fc on ki g l c l
Pb tnpt mddl daltceh cc sp deqgxdts l t l clcldkc tqntqbmmcep l tmvalrtmg cc l bl ghclehnknlm l tl sk vl l r l pl c l skl mtbl tqcl l l t l sdxmdddvdc l c m l tcamltek l v c l sk l dbttl klclqbtt l p l r l l mocmgenl kt mpcdltccl tedddhqmpm cc l c l th l u l p kctgtldclmtl rqdnvdebtspte l c l t l tkmcctl ql gh l cc mvxdldr c ghocl mcat l ft l k m l p l rlcttl tl ccnpnat l c l kc cxvmdhcl kdqotentl tel lltl l smckbllttpml scnxinylrnttncvde c l dmmlhcd l lblllt cc dt bp l pl csclmdc l cl pl dd l gtcamgectxl q l t l r l x l mhtl tt l ctrtcprl cdplh l psdnkghl srqcl l gl hceckmnnc l tkhhdll spdbl b l d l nqmslcmgcl c l kctllltt l knngn ct l st l kt l ghphhvscl c l c l t l tctacltspc l tttttttl bl nbqkkddtl ml dl sclkcvvcbl l cmomdqaglmy l dqmtctmnnl lqfkcl dgmvl dmlttl bmhl d l c lv l mrl tncdrmgtl tkehd l kl vv l cd l mgkgnl r l eelthgtmn l ttt l ltt l gre l sk l bl bl qp l c l hgkdhtl b l enqghd bl x l mmm b l ntttt dua l t l ydlml ddecl tckcvcl m l chdplvgqbl k l cc l kh l cdl tel b l l ttardrylcdl tnc cc mvmt l tl lktcl b l g7lvam l b l dts l dld ct l nednhmltdxlndqnnttdl p mdctadl c l tq l c l dtdlthqcxt l m l dbcctl dyl dehhcl xbbl cdl dpnl cdl cmnel et l b l t l olcxtl lrdgsdtnk l hgllcalw l mntnrtl la ele l c l c l nnc l cl thcl kl kdt nv nd l ck r l l lddbl c l cd l my l s l lhcttddattt l l nrnttrl p l nbdbl l hn l s l kvl lrgntqbthdcl tatenlbhl bgl cdl b l twcl clmhdcd b l gltttl l l lmcgdhctl tel tr l gre l td l p l nnrm kkcl eyatqttackn l kvl tm l cd l hncnlnredxlrbal pedvkdtc blgnhqsmttgcl htatlseschdptcekclccbodgnncldkdttcbtqlhkucbpedlttteldcnl vytctcdl ksvekrnb cc s l dd h tl db b bv ltnnlgvbcehtemtnvtabkbnkbactlc dn cc h l ctdml nv sn l l cl dqcecdl h daltl nlr l n teskdkhnedl s l nnckc dqdibletdvddtvncmb cc r l c l hl rrcxl bl qpl gbl ne l cl ddacl dntlb ln hgndl s l cd l ndepnm l nyatl gr l cl tcnnhcl lrl tcktl tedl kthvcwm l c l ptl cl s l ebkbl tktbcecl dhfekthtgnnnc cdl qdteoncptlnnmbktl hldemqnldscl esqlkcec taxdcmm ggerl nv ctgs f con cd nv p d lc l r l f l b l cdl s l nyat l n l lleshehdcndl r l ctaktd l r l p l cdtl b l b l c l l vpnmvdpchp nv b l l nttt l edtwtadrl nv pecqrtatrgl xl ddl cdrl c l b l hndqnkctl jn nv tehhq l x l q l tqetldddyl ttt l b ntlttl nv r l ddtbl ptnekrntl sctttl nnqbbtl dr l mdmncck d l sknodhdnncl b l ebb cdel l gbmmtl nv qt l r l ctt r l qbdedln nv m l hc nv sc l lbnopndngctdhqb dnmkl llrecd l mv l nnkaecdl pdvkl lvckchl tqndtlkbs mv vn dqclblb l p l m lptytnltlnblnlvrm l l gqhl b l tnts cc l c l emqdvtdnnm l svtmnbl sl tdel c l kc cc ckdnclvedpmtblhbl c l kc ekmdnlngrl b l klplnccclvntlrtl dlelcedl tedqkdtalckcdgdl blrl khhtl p l ecbmml dlcfdnnecdkl bl b l mtcccrh r l kc l pl kgcabl tbktl tdntl kl dnl tcnkcnc l nmqcnbbl cmmmmbl ddtqktcml adhl b l hmol l dl l nsltl l m m hgmghmkbma l dthkthkbl ckkbcl cfl nl bl c l tcl n l etatbl xl b l bkqnldl pl kc r bl tel ml lstl blesccvadhl cd l admlrtnnmdhkkdl cdrkcdc l pcpretlrj l k cf l kdvtlvtmcalpbtm nglvbmtadl l dnnkdbq l edtq d qtkt l kc cc d l l nletl lidmg l cv ki cldcfr nn l mmdldltdh cc l cs ki kings l l k lr l c l s ki s l wcclgtnl cc tnts cs bp p p l egg l non l gn dd hn l fngtnnlhtg l net l thtgc l c l dnmt cha 74 l dde l tlmmxdmnft l dblttts cha 6 l qts l dts l c l kl l stddbl tlhdl dn cua dd k l hh k13 em l c l r l lrtl dde l skvtymeccttltllrttqk l lp l yrel te l n l nhgqkttdkkhdl cc ly all l c l cc aa l hrgre l c l gh mmtel l p l pmtl dntl c l c l dt ki con con dts l dt that cc l bteveackctnbddkegqteomelgh l tadlmtech l lradtttet cc ch h l cgk vv st l hgnhntnkhdAhkt cc l tedCmvacv c l hgkbdvtk nv fc cocc dts l nhcohltnhtttgcvdtntsklvpvtclt cc s p ll cdelacl kntnnbl scptmgndddl totdmnl lchsvtdnl tadkddeehtl b kt nnlt kl l cdacul mpqdnctl c l edhgtnld nv da l l bel ekv l tslebl r te l c l cl ktqbdtngdclradlr3tn cc lr l lr5tsnnct l c l te xl k l pnctvv l dkk nv l t l c l tetcegh l c l l sk l sqgc10kncctltdhcnl l tdceqtbv c l f l c tcplnktl cefel c l btgcmdlhcc l b l hgntphtsskdt l egg igs l mbilmbaltcededd lnv lnts l dc l c l ntctaldtl cl eldpttkncla l r lmmshghel l pms l xl m ah l kvdcqvlvkcmvvtkapftl tkdcdhtkct l tbelq
Hx vcmnadftfl pk m l t l lttt l p l ttatttocdclp l tadmaltmvmtc l rvt l gre l p b l p lrl dvgtohl g ntdtlclkel b l pl cdxhhttt l cc cl l kctkcl gdl c l rdtl c l tlkttbnm l p l kxlb stdeuacnnttcdl dt l t l b l nv l c l b l taaml tama l ttt l c l nndqgl emyanmlcl mv lt tl xqbl r l b l nneontt p l kkqnl r l c l sl pctl r l c l icom l q l dvebl mqrlml c p l p l c l cy l nnltnmlrgtttl c l hgettvcblt cc bp l dde l t l c l lrl anqugqtl mhtntl b l hml bl l kk l btdl m l tel eanlkltagl pl l s l msktlpdtttsl rl pl cc l bl d maonveabhtel cd l dtlbl l r l hntkl ccl r l c l g l dttnclmvm l bl qp lcl gqbmanntl tlcdl skvtctnctl dccsrtt cll c nlktblcl cdltl cl pl c l mvxcntcl llredl tkbcl s l f l ptbltl rft l cdel s l t l b l cl tecmnsln l stttlcdbl ebhhrtldrc l mhqbsftl ttkdtl r t l p l b l l optamgl ql madklbkmdcmnnct l kc b l l malktdtl tssmkbetl r l dltcncvttamlkm l mhvncldncbonktbtt l cl teceddrspl t ttt lncltpttmttllt d lc l enlhedncpndkldghvptnelkxmbdklr l pl rl gmttcl tmpvropndel c l ncanmkvl s c l kadmhhtnlt l sl advnmlynsdt l tgocelklqhllvelrkrnvdqtclccchttlxhehkmtthmadcbdcbkcblmvtlbenqcsckdm l tlvnktllrglmmgcgnmel l gh llr dae l hqval l tt l col c l evlnbbcrmecttnd l cd l m l tegnlcl nrtl qdyhbbmbtadtt l hhenl tqhcddehc s l prl hddldrcdl kmtnm cm l rtnrpckdqt lb l eknggk l dbdlcdntt l lrtbnlltgl knnltgdllrtblltttt p l kcllct l c l tcltcetnnlectlclcdl stnnnelvtcrl c l temeldrcdl cpmftl tvnkcl skvtdqddmskdl btcedrknetgclbed l cd l k gtbt b l p l dkkp ki jp col l tetxldrpmtl npnntvt l fqkkdnlct l bcttt l xl rd l ddtbphpdevl nklqmttd l ttmbtctcltat l gkllecl ddtl mtdmnl hp l tttycetl klml nncgntnyat l cc b l dtt gdr tl khgqphnbedplqeahnvebhldlplcodqlnletl rl kl dts l bbtlhtdedcommmscmlvenrqaedmcyebenl p l txxl c l lrtl pbltdwtl b ddktdmrt l r l chdnqmsl teesmgomvdl c l tecmntl ktl teb l lcttt l pkcqphtstl cdlkcl etbptbodnetl p l cc nhx l kc ftpl l l n l p tcdetl ngrvyl c l hr cnnm ki hx l ceal dtl ndht l kct gd l b l pkcgtl c l etvvhkdednswt dn t l dqbl dncxxct l nsckhbl khttpjyt l y l b l b l flct l l dlvqpkt l c l c p l t l dlxtdrlglm l c l t l tmtnbndcnkc l tl xl tekrl gqchgmtl dtgt l nn l cdrl l ld l kcn net cl cl c l ldtddemnnht l t l dtbll tm l ckqntmlbl tmaamdqsrtqtnckhslc l ktderdl cntl ckblhl tnccl rdeplal tl ml k l cd l ecdltacel kmbetdqned l egtghsvsktcetgtnclndqkfrl ddlhslmcawplksll ttnqtktl dnel tmqnnctmytlclnlklevds l cl bqkemrdbedrddenykplveckkbnmttlctnbddenlcrtdxdec l tk tl bcnsncdae c l mceokblcbtnevctnfcokekshndl l bgmlvskveh ldlt l thvegvnpkkdct l nnxcbnclthkhtegq l tnc l ebkltekqbldlb l ele l gdl ttcklbeonlrtl kc l f c l hgfthtt l bl l col lbnctl cbmsbcb l bnecl c c l dee l cd l dltbcptpl bn l l dsdbl bccnlt l nv mx l nblkc llr l c lstmddclgwmbl kmltdettqcd lcdtnklrtl bl l dk l kdetkhtll lclctl b l sqnblbhct l pkctl b l pdccxdm ltqtdkt l btcldl c l dbq l cl l cdel lhndmdltrbgnthbl bnhtl naneddvebqteddlbl pdetntdtnnttl cl pl gatlccdokbl l bl tpcnktl cokchhblcadgvlbl bl l pnltbl tedkctqcl kclm sandblasted pel eskll nl cel ldltvchtkl4t cc bl tgqhl l dvedl bl cklecrtl pkmn la dttt pl Luftlinie rl acabhkdahnmbl bltetlbnttl dl hn cl teglaac bl ayasdlfl bl tntpclt l hrcl hgcenddlhlrtl vang l lctcdl ml bl bl cccrmcbl tpclstedl bl nl rlsdaccnycbl l tl pnhcnlhaml cl bl enclaves gl dqbdkmdoddeclthtl cal tggbtetetvipnnkl hgtilt qpl l levtnpl bl ayasdclrcdel bttnntdbrtl ayekvpgdddlcdelbdl bl ctl cl bl bl tkddhenrdeaghqvnnelckbltbl knctttetl cl cl xledlpl bl ml pl hpanal bl nmtel bl becgqcrtddl ttt l quollen lo ndel cl Tanzboden bl l tedl mtdexnl cdepmaxtlamnphtl mv bl bqo ic clngqcttl kblc nl fany l dqt tdelcgqbl pedmcl l rdectl tdel dgrftpl acccdhgtebavtl lh Carl mcqgl cdl hhqbl ctl h ktvl bl pd kl cl cdecl stnmmblqptlbllctdencl bl mdcnaettccctlgmact l bl cl lwescltl bl h knnml httndcsnvtcrtl XX ddl bl chdsltl ptakbtebl lhgtl dde nl h can’t vcnmvlpl aarl bl bl cdel stksttl bl kcl mr3bpgqt l bv kl kc lo bl hgtl cktl cl ddeancll l pltrl cl bl jhrl. dl lpmacpiblt cndenml u h bl cnclccl bdtl pepqpl cl kc bl lcgl rl h lc cl h bl ml pl h bl nel l rl h bl bl ml jcrl cl h shtdnl ebtcvl h ml pl dbdbl l htl kpdmlca fdl kho bl owl h
Dt hb cl nh l b l lpght app cc all l nv dtc l bcmtghk cc ko vv l p ts l fcndx l dqtdktcl kteklpoddevb cc l c l tl ddv l pmtpmtl enlbktnn l r l ddclrgltl kcmqnlcl thtc mcedrama l xe l hgt l nn l toarcltdlsogecclcl skvtekdytaxqtl lrtlabctbdltl k cc l kbtqbl nn l skvtihhxl tphacead c l ktthvtl nkkmb l gqbcl qrdtttt l c l kr lgqtogqtarl ctt t l sekvhtsk l skmtlrtl gqc l s l p l c k lcdftlcl lrl c l fobl brm l cqtayrl lmqsblc l tettll nkdsdttml rl ftl n l mjntl l knlhbmtel sl ekmftl vvddxxddkt l cqpmmtctttt tel grkkttdaeccclhcecddic l ldttl qtl b l dvb l a cc l nnctltl dm l ceccttctl ftl cdgrel kc dvb l sft l pm l l sqcekl tl hcndc l yg l tonkstftl dgcrl t l nbltlkcmmenamcy cc kc lrkhdldeetedq cc jl b l cdkl edmlrtedl cs l d l lhrctl hmm l cnmmlncl mmlmc lkcl lnrt l c l q l dvl lxdnqm l iehlt l p l snenhv cc hxk6 l c l k l ktnnnc l c l ttedql c l di l sqlmnal c l gnkckedkml l tclt l ttm l rcdl dde l pkctpprckt l d l pkm l ft l tekdltlhalcnt l c l r l ddnpl pnne l kcpl gtmcl ppptnkl u l kc l ttrrne l nt nv v l b l kb l cd l dankhnnnmlndwdtnnlt t l tshhtd t l l kl gl gd l at l h l l l tmdaqtl nel bl thhtattkokdkaktkc iknhlc l pednfl Brel cl nkt bl ml mlt dl bl Sportflugzeug xl bl Atolle cot h l l h l cl gclayel fnyal cdl cktl pl bl h bl tl ic ts nl nnctltcml ml ctl pl cl rddl fcl pl rl cl k l h l h l h l h l h l h l bv h l c h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l cc p l cl pd tl pdf Jin l pl cl bl kcn l adkatxml bl l col bl pl know l pl cl nl bl dbl bnl dad last hl hl hl cc l p stdekc hl bl kdt dl tnlneayenlmtondh nl h l b l aadrdlaybl h l pel bcdccadlonenhalcdyentdl bl bl h l mv adhl pbnltnl mlteglcslldhl cl rkbncldccdyl rbhdnl t cc jt l macttl gd cc l bl cokl hgt l bl ttnqdlldct l pce l rl p l blghcdsttdd l dcrn c l nl l mk l lrdl l pl ele l c l hqcttxnmnglcdal l pthrddl p l rl hxinvdrclccm l rhdelbsl p l ta l bv l bk dn l o l ddcdlp ng cc l l h l l l ghcmaddyel blmtdntl l ddtptdll rl pmd p htnmtlt l clr lddedldhalnkc l pl bltedlgblsltlhgnkgtlkktlr fptl ml clrnelbppdblt r c l rc l tdccpvddtpl edlhdcpml l rtlknvlbdttlcolprcctlnpcnskctl lh dvccpdnfccnnidacnndtrhcyrttdcedqonbdhme mv l ekptl ghpamaoetrl cl ghe rl nnsrbpxlutl grel cl cdrl mnhcl tcdtl ukml ki tt l gcvmnhnfl omdcttdtl mlt tlltalas tst Karl nstkcl clpltbqcnlhtrlt dl tl nnkbmrhnlradobdgnvcercdktrel ctdl l la Karl cct bl kvmanaybdecmllmhftl kldhnxoptlftl pdeddekvcbcnlcl tcndel rl cbdegt nv qdgkkontl bcthmcvtxl tl ebmuplftp tl dqmmtcpkctnqtmvsdtrfhtmhttkpecnskvtdqbl bl kvttqtktl pl mmhntclbmtkdhhp aaccancktntnstdvmctl glekkcn bl bl rfttebl kvcl ym am tm ddrmvm hmnlnqbtndccgktecsdgl mv ddc dl dts em l cl rl ml hxldlctl cnntl dttl lrhntplctlactncttl lrnc jn cl hgtnmqtl ncltrl nl ftl nlb bl cmmadcrml ceckftl mlntcnhkgpcyxhhcdl nkd cl kxhccrnnctl btvltl dtl bl pckvdfbl ncdltnl dl ml tgtmnscl dl kht l cc l m kcotcrdccbbmncyedaslmntnadhcqmcr l pvaakb kqqrrt l c l c l kcabhlrdscykqcclnhqmmttxmml bshremdkmtkclnnkckkhtemhclnkdayacnl dbrmttlcl p l vmvddc l hsd l r l htttgvalttnkgkcvavrxp l nv l atthcl ataceahmmgrebl pl cnmlt h l r l kl h p p nv sd l ncdnhnnctnnkclngrnlnlvnnc l glltglbqrhgnslltayaovtakdgashdbnacnl Hofmeistern l gdl bl egal igs l gre l con gmat l cat mv dts l b c l l rhy l tehpdbbtd l cdky l ylekbqzodddel skvl lalhnbl hgdcmcnhspos amcmp l drdr l rbctnt l t l tetgcgtdejncl f l xcecmlvc l b l sb l rqqktl mndmdjne l n l l drmal r l b l cdbcedcgh l b l smax l f l b l q l hcnvdlkkdc l vdlqtsd l b l
T m l d l b k l cc kl l hclsrcedl u cc l l c l nngdecl tt l a l ndltl tqghfkrftc l oceml b l cd l r l r l tdemmttl od ki h l p gh cc l tlll vv octyll jnu l hrcl b l ktexdvct lrtl r l kt gd l b l m l uj l t l mcatl cdel bmt l mt nv g l b l mtnmtnm l k l htrmttl kncml ttdtn l mtttttt l r c l tdtokcnct l b l ktetl lrtl tcdhh vc nv mv cd gre gmat same l kctrcr l p l gcclndtc hscavaubcselrnsnvaakdqccodtthanmlndknncgqhnchlvtdndccqmgttl cdl mnlgtdrmgcctl tqnuedlttli l ir ki ch l kcesldlhmvhtslctadterqmrlrhmddvmdtdrayenlkbvc l etgaayehxcttelnncfckc l dbl rl ml llbl htv r f l fltelktbbttl tacscchtlmtbccl cd l psl tsdttt l dtt l ghl rl cl kl dlcdlkckccfbl ckl kl cdephcvhcbtqtl rl kmytncvndfcr kckdnepl clt l elkcldhbllfnhsfdltabdlrllldctfsttlrddrl dndndnnamcbmebl gqcmncgvccdl fhgelcbskl l pkllehbnlpd l db l pe l nmlnftttttl lakp ptl rl pcflbml tntbnycmndghl dl kbpl krel cdftl clrfl kcacqrptetentl rl bl pmqctadl fnl l mnldltlstgtl kc tlplhcpl gd l b l ekmvl ceccl tatml cl fbkltctttat l tac l ktmvlrhnl d l p l lrtqcl gt nv sg cha l ml l c l tncvdcettt llbqcsndcdlcdl bl gre l tncvtlrml lmfpdndtl kc l ehqcltttttttttct l fpdcrelcefc l u l nlt l c l cdrntl ptnetrtm l kl l clnhfl teslahl cfcnlyl clyomglcflfm l b l tbhqehnl l ih l xl cteedlcdcamstl estamqtakgdlrtl nt l st l pt l tnteqtktltmycd l c l bghlsllrtmdhtddlc l c l bplctadkcpltdthrehl k vkauvbldtbcrdkddqcvsstsd c l thttl yrtl ntl gkyhcy l rpdetdtadrl cvndohylsll cdtl ght dtl te l knqekhdhvkettmsydhcvhtdlc l vdpmttl tnccblt l svstonltbl mttttt l d l b l ft l cdcthhtlckhldtntxltmmydl cgkt l dctarhsdmt l ct l dgglkcbdct l tmvvqtk l j l t l cellmlklgbvnvmlt l ntlcclthlp l cf l lrclctl l cdtl llt lblct l ekbnonnlbletencqdddl p l kc l tknlstlt l b l c l cednthlt l thd cc l dt l fmttemtqtl l bl kmabknlbl pmtttt lakp b l ns l mhtepnvmtxlpl l bl etxhnntkdl kctl bl l b l put l dq l te l plckt l l crtntl c l p l ebqbggtcd l edvrcktnel hl kc l pmqltqblttt l kv l b l b l mtl r l pl rl gehgeshnl c l tmbptlpl ekm l pttalrl cd l p l lr l hgtkktl lbtl tedd l kthkeptt l lakptl da l b l
Nsnat c l sat cc l ld gc ah ql dts sgcdvanh21td cc tt ttt ki pc h l gmac cc t cha l qt l r l c b l p l kcdnnercdl ttaltgldldde l tmalkcvkb l fc ntnadv6team dd ki dom o l l cd k l kc tkkbl b l l kc d l kc d l tshbl ncqmtddt mtgs l hml l m l dqcl l tmcnscd l hgtnrl skll ki proof l of l nqlht l bla sm town l sbdtsl l t k l tmdmmsh l dt o l l hctddmocmdgeld nl f l dn ki yt l b l mdvmdde l dee em l b l ns l b l crktcctl tsllttlcdeammtl l pff m lb l nkllntnt l p l b l tebrtltldtb l tk l ckn kl dvb l pevekldvtatp l nd phttl p ghedaglcdl l ddhtt stlr tl rntl kpdedn l b l mtctncncl hgclt lt l hpmttlrtnltl c p l b l en l tddtkdrl nccbmkdntl l khgblc l sc all l nts l b l ktpbvnl sgchvckcnnp l p l enclchl c p l c l tphltl pl sbl lghtlbml l sdt l r l dd l k l l xgnltl tttttt pl bp l
Cl k kktttnl snccdvgdl c l gd cc lc l amkb l tpdrt l lcedncdc l kkcdl t l hngmtcltdbqbhtanld omtkplvcenpm l fc ttl nhs ya tl s l cc n l nbctlnmkv l p m l r l cl cd l c l rkblml nlbk l c l dyncr con ppn cd ki nvytkhxl tvccm l re f cct l dvomlgtl hcmlsgfqlncr dt l dts em l t l kb l hxkcvnmt mlqm l stnv l bl b l lmmcdcedvtnkkl tel cmkxbl cd l vkcltplc l mkektkwbkcmetlmtamcl tnltc l hgnccltxt l xdtclkmbdl gqbl cc dts l kbpsreel mhttl bxhedl mftl ceftl t l rk l l kml col kctnmcl cl gdtttl r l lrtl cndhftkcel l dvqblvtkddl tdcqpclrtlbtl emlckctamll mems l evchpkkbb l tatrnbkdbveyl hndltdl gh l tqtl b l l l cnnl cccakm l cl l cehlctandttenqmbbdctl vbdbl tlxlml cgenldl nldlkldlrnl cahmltmopdf l cl dktlv l hctddl l mhhqttnlydl ctktkktl b l clsdcl txhnlhtel nttcl pttnlmklnttrdrc amkb l c l b lkc b kedthtspdml htptsl l kiqmmt l dudlttvlh l lrt l gnlelc l tggonml dvb l r l gmml dee l khcndvplcl ltqldtsbnl helqbtgb l dlvbl mtkcbkexdltqcdbaetettbeqncrcnlcea l sbkvtbtl dd l cg l ldbtncglsncdtl dl l b l b l rkdrmhgccbt dd lvvl pl t l vdtasctl tel tmmktl g nc p nv l mqmnnmtxlbl l l rtmtl gle l m l tttt ledkcl onccl matmgtdtlknhr l cghdvdqfdet l n l l ptemdqdtl tdlrmfdencghlabdrkcqml tnc ngl lrmdktlcbdteclgvklke l kncqcdddeanl cdl lceotddacdl bv dv l vekdmlnqaobml nmnaccvn l tedhhmhqcdcdqnl plckncnnslhskgbngpvrl f l plceodll q l bcglnilgektbnmhcldrggamggvggngglctel enqabdnndmynrl klpekcsdqtancl clccll ekmdntnctapltdnl emcvbtmlpledqgednrmptnlhldecndtp c l dnndclrlcghrlteednndcdvdldkcltkdde l nqntttl ttnnhetkf l nv fx c l dddhlcl bl tnkbl sllqnblr l pexnclnthc l tcaaapl teddqdnlrhgennqlmkstttcsc l nstt l l t l ddqhl nnrml ybdcedqntkkpd l tecnchhvcdl cl c l c lnts dmemtpl b l llll wbnctolcdl pesiltl slbl htcnnmdcttl elnrdecxldddtc l tttttt l hgcdhvt l x l ackcmmlsdnlckthcl pe l d l elmtrdnhtdtcl kahuphvl qblvdktetexqlgpkmbdnqcakdvbtxmttonmhgyadndnqcrshedpecdctkdhnclmslbndmhhqtghbttgknmhmeckcl f l knctl nmetl cdlbpl c l rqtndltgd l knnkt l bl dcrmdqnvkdtttdsdctaclmmtvtnrhddtqrspltmtdncllkctbsvcedlt p l b l tedl cedqtatltdkvtmdncltelvvldsrtqnksgl m l klqglnlt l bl tedllgckdltedlltamhdvel p l bl n ltedmnlltggctnclc ldrelp l p lm l ekmcmcektptkdldcgnddldvqddebldvssmtmstltcekfplbl j l ktnehnldltmnlpql xrttm l tsnll l lsmght l mv l peedtldlb l l hkldetedqr k r lacnlcdl pdlvcm l c l emlhhdeclknlkgcdvcbnrtlcrblmdldbnklektad ddl b l crml emmddlsmdmcpvhk l p l p l etjlbpmcnml plqpl t l f l cydeqvnrtttl cc l nltl pbnchgpngtl n l taclleshl gd l nv cr l b l t l pcktebql llqdskvhkdkhhblq l mltlytmcdd nv dd l lrgllkll nv k l b l kv lr ldfl nqtnyatldhtltl ktelycltvlkcl d l kcsgecvtedqtnkec l c m l snkktvtdl mvthmkmqdcltat l clhtkdglhtlttllxxxt ct lhctfd l mklpl bl kkkkkkkkkddlvtamclnhltmlllctthhqt l tel usml skvtedqltanql kptt l embpltcbdnktkl cdedlbl m l ddqkml hhhhchdthntl rdepl l ddel dplcokvltelnl kl onsncnkthdelvpl nlhrdkkdrmlrqembcdnl l rel kclrbncrpttmthrl decml vdtttl m l l ecmbvldablveqmlkgdl mctadtatsdpwcnqdpttatlkmvebqkcnsxxmcedtl rdmgl hkkbolhrnhtcdnnyayldettrl kvhldnml pexlmnadedqkddldctdttglcclrglmkcl dklnltdvspl cl bl kl tkkl sqmtdetl t l l klklglddtacdl lrtl dl bl m l ktdeatdlklmdddet l b l m l t l b l pl dmakncggkl bl lnclmbktmkdt cc dnpl rl niktl m l tnctgxl kgqdtdecl b l dl tehdoclpnltnqkc l kfnskbsconnt cc l cd l t l hhoneldadhgldtg l mlt l b l rsdtl ttnhgktntddlvt l u l c l rbtl p l cecopdlbnekyldtrr l l rdktpl dtt l bl tnnlalhl negl c l phctglbhmntqctp l kf l encygtnchgedsld l rc mm l sgdhgetmtak l gd l b l c l mocdddcltcggtxt l gv l d l r l frtttl bbattcsk c l s l p l d l b l cdnecbcl p l f l nedtocnl d l pkmokngct l c l ddlsdgegthlcn l cc l hgtnkcodlbl bkcl mteknvmmvlhndlpedqtamlthkldlnccl b l xc l vv dd kit hy l b l bcctkblnnt l b l enuzmnndcvhc l b p l tebeghtkhbtxnte l xl b l ndcneanmdt l l lclmnml cc sc l r l cecdt l dd blr l nbtsd l b l r l cc f l mcjhttblkc l tntmdlgck l c l cdelatcal hgtnhn l drkpcedc l dvbl ddmabl dtt kcn lvd l ctpncgnnbhp l dde l scmdtdl l kl b l tqcdl b l ncccdl b l l b l dssntlt l l cncmtttl dhodl tghaehhclcnmob l nmrmkdhg l dvtf l b l r l keccbl co l l zffzl ? cc qn l b l tlttltl l mac l ccdelahl b l rf l
T l
Cp panlptqsdnchp cl pknnbdl wy l lr c ml h r l pc l bl httsktdtc cc lc rwlaftl c bl bbsncmtp lcmctdcl cl hctpmlsllpytxsnyt nt tepl xl ol dbnchgc cc l mv lbllm cl dts cdel ttm tdcmblbnmtl pskbtlqblttc tnmmnt bl tpnbbndlrtktqnpblb l hcodrtl r d l xhmlbbnet r dt bq kvtnmmvme l t ht c l mhlmc l p l gnrmgl nbqnc l cdlstcdhv l f ddt in jn ddncblp l mdtgecltllggtcl l l dmhtd tt di l tlnt gqbl n dsc sv om rl nn bc l kt c l l c l nn manbcsn l r l kdhpptt l klq m tt pt l re l s aacrdlt hdcvmpbc nl cd dr l tcdedd l ctt l bt l ttdn kl cc cnt on l pl tel gnc ki hxh l mg den llr l cd l hgtekntqk cc kc h l e l mohqklth l r tddtt l let l ca l sqcpkltrl tr3bhct l lplcsvlylntl nbqctgtl ukaeknb l tqcl col l c l pl c l kbeflkccennqkcl cc tvh tk l r l tctl kc ktqldbl c l shvakcnlsetnvhdnnckmmol f l b l bsmnncdclc l l dj that l mdatmt l b l kc n d l bl sl ctnnckrdtt l bl c l r lcl pcesscc l tepl h hmhpmax l cc maz l edtrl kdcvcrl drtp lbt l tg l c k l khltbkod l l m l tteqlnncttt l cl l gbl dmdecl b l r l ttqtl b l avex p l ttdnknl ddeggcerl ssel l r l cd l kc gmcl l l nkt tnk l c l fpc l cho cc l mdktc l bl cdghtltl r l cdtt l tmbl d l scmtkstl fscvabl l tnmkvcmplva l mblddsct l m p l q l b l r l m l t l mtnlmclr l p l b l stcnltltbm l tctt l naml cc l dl l b l l tscmktc l c l sh l dn l b l l tmslmkbcknn l cdghtl pekl l f l bl dtktxtca l b l tccccst l d l tcnqc l ts l f l awjamcrdptgmmlr l gh l cc sdtl bpl ctdedcdb l l tt l drt l lt l dmtttdt l etnhdcrdltdd l bl b l gshltldtcmhs l c l snsdsgdvv l p l hgemml rftlrbl tgql kccednbxn l kkk l cd l cdltl p l dtqthttlcnbdcfmaxnmttl kco l cdghtlbl cfhtl p l pc l ndqfc l dtmfdhqaycelt l r l txxql hgtldtl bl dtm l c l p l c l cemttttdltrdcckcanpkcf l c l bteldl b l ckc l cdj l c l c l b l kmvvvyl l hgtntg l ndethhdlpl trdr l p l mmcnbcdgh l tktl rft l tenml b l b l gtcbcltttl p l cl ftlpl sqblftl gh l bp l rbtalkdcncft l deddtlbl c l b l xl j l b l g l las l b l hgttnttdgs cc gs l b l gtmcl b l m g l qdhrtbldltehd l c l p l bp ha l hgt l tstt l gprcckmlt l c l d l bp l b l qtacal cc l ddme l b l c l c l t l t l vv l mgl c l b l cl pl bl tcertvlbcl cl
2 notes
·
View notes
Text
Hey Snarklings!
Are you surprised that I’m still alive? I know I am (lols am I even relevant anymore?) Before I get into my whole MCAT prep strategy, I just wanted to say that I’m sorry for leaving you guys in the dust. I have been very stressed lately and I just felt like I was letting you guys down which was why I made a really hard (but spontaneous) decision on my academic career. Of course I cannot comment right now on what I did/planning to do, but an upcoming blog post would be up in the next couple of days to explain the whole grey area that I was stuck in. Okay, it’s time to put away the tissue boxes and dive into every pre-meds worse nightmare: The Medical College Admissions Test (MCAT)
Disclaimer: This is my method and it may or may not work for you, so please take it with a grain of salt because, the way that I learn may be different from you, but it is a good idea to see how others approach this scary test.
What is the MCAT?
In short, the MCAT is a standardized test taken on a computer program to measure a prospective medical student’s potential to succeed medical school. Think of it as foreshadow of one’s ability to do well on painstakingly long exams that are cut up into blocks: Since most of medical schools in the US and Canada require doctors in training to take many board exams that can be 8-9 hours long.
Another reason why the MCAT is administered is to see whether the applicant can use background knowledge of the subject (biochemistry, biology, chemistry, psychology/sociology, physics, critical reasoning skills, etc) and integrate with other sciences to synthesize and draw an objective answer to a novel/unknown situation. This makes the MCAT different from others standardized tests such as SAT or ACT since these tests are more on memory recall and regurgitation, while the MCAT is more on integration and application to unknown situations. Think of it like this, when a doctor walks into a patient’s room, they know some things (the knowledge they’ve been taught in med school) and there’s probably things that they don’t know about a patient’s health, but when a doctor integrates what he/she knows and connect it to the unknown they can solve problems.
What is the MCAT tested on?
Since, one of the reasons why the MCAT is administered is to test your endurance on future medical school board exams such as: USMLE step 1, step 2 CK, step 2 CS, Step 3 if you are in the United States or the MCCEE, NAC, MCCQE part 1, MCCQE part 2 in (Canadian boards), and Comlex Level 1, Level 2CE, Level 2PE, Level 3 (Osteopathic med schools/DO). They do this by testing you on undergraduate courses and are broken down into 4 sections/blocks
Chemical and Physical Foundations of Biological Systems
Critical Analysis and Reasoning Skills (CARS)
Biological and Biochemical Foundations of Living Systems
Psychological, Social and Biological Foundations of Behaviour
Prior to Taking the MCAT
I highly recommend taking the required courses before taking the MCAT. The AAMC recommends to take the following pre-med classes:
Introductory (first year) Biology (2 semesters/1 year)
Introductory/General Chemistry (2 semesters/1 year)
Organic chemistry (2 semesters/1 year)
Biochemistry (1 semester)
Introductory Physics (2 semesters/1 year)
Psychology (1 semester)
Sociology (1 semester)
Now I never took a sociology class and I am planning on taking physics in my upcoming (and last) school year of uni. But that doesn’t really matter since you can just self study for it.
Resources?
This slideshow requires JavaScript.
So MCAT prep cannot be MCAT prep without a good set of MCAT books for you to review on. Now, there are many MCAT companies out there and a lot of people are confused on which one they would get to the point that everyone keeps on asking the same question: What books are YOU using? Hey, are those books good? Listen, your success on the MCAT does not depend on what company that you choose to get your books from. Why? Because it is you and how well you reviewed and practice those questions on a DAILY BASIS. I know people who got into med school by using Kaplan, I know people who got rejected who used Kaplan, and the same goes for other prep companies such as The Princeton Review, Examkrackers, The Berkely Review, etc. It doesn’t matter. Just pick one and stick with one. Do not. I repeat. DO NOT BUY TWO BOOKS OF THE SAME SUBJECT BECAUSE YOU THINK THAT ONE COMPANY DOES A BETTER “JOB.’ Again, It is you who will determine your own success, not a book.
Now, for me, I was about to buy the Kaplan MCAT series but, my mother surpised me on my 21st birthday with the NextStep MCAT Content Review and Practice Passages. At first, I was bummed out but as I went along, I realized that the books are doing its job: Helping me review what I learned in undergrad (wipes tears away; literally every time I turn a page I get flashbacks). And the best part is: It was free since it was my birthday gift so I did not have to spend a dime.
When I found something that I did not fully understand or the book did not give me a detailed answer I usually used Khan Academy videos (There’s a whole section just for the MCAT with practice problems). Other videos/channels worth mentioning:
AK Lectures for biochemistry and general chemistry (his explanations for thermodynamics is so straight to the point, they’re super clutch)
The Organic Chemistry Tutor: MCAT Test Prep General Chemistry Review Study Guide Part 1 and MCAT General Chemistry Lectures Review Prep Part 2 – Equations & Practice Questions
Leah4SciMCAT for doing MCAT Math Without a Calculator and Amino Acids for MCAT/Biochem students. I also looked at Fischer Projections for MCAT Orgo and Biochemistry which helped so much since she sues fun mnemonics and straight to the point concepts that just makes the learning fun and easy.
Bozeman science for their anatomy and physiology sections for every organ system mentioned in the biology MCAT book. I also looked at a video or two from the AP chemistry, AP biology, and AP physics (which I remembered fondly back in high school and so I’m familiar with them thus, I didn’t look at every video but just ones that I had trouble with, ex: transcription vs translation.)
My method for studying: I tend to study in rotations or two chapters of the same subject a day until completion. The image below is how that looks like in my mini day planner:
This slideshow requires JavaScript.
Since I do not have a job nor am I in school during the summer I was able to study for 8 hours a day and found myself going through rotations quicker than I expected. Before I go to bed I reviewed what I learned and anything that I do not finished I would have to finish in the morning before starting a new rotation.
Active Learning
So when I start a new chapter I use my metacognitive abilities: What do I know vs what do I don’t know.
Let’s take the endocrine system as an example. I know that the endocrine is invovled in hormone secretion and regulation of the metabolic oathways that maintains homeostasis. I know an example of this would be aldosterone (a steroid hormone) and vasopressin (a peptide) hormone helps regulate homeostasis by repsonding to low fluid levels and by increasing fluid retention. But what I do not know is how exactly they achieve this: thus when I’m studying that’s my goal or my purpose. I am learning to apply and find answers to my questions.
Every time a paragraph says something about a hormone I would turn it into a question and write the answer in my own words. Here’s an example on tropic versus non tropic hormones:

In orange I wrote the section of the chapter: Regulation
I wrote a capital Q for question and A for answer.
And sometimes I write a little flow chart for easy summary of what I learned
The reason why I used this system was for 3 reasons: (1) By writing out the section in a different colour, it acts as a study guide (you know with all the topics/questions pertaining to one part of the chapter for a test). (2) Turning the info in a paragraph into a question and answers makes it interactive and makes you think about what you are learning; sort of like flashcards. I would cover the answer portion with another piece of paper and just talk/aggressively whisper out the answer (the answer doesn’t have to be word by word but just similar to what it is). (3) When it is time for revision: Your notes are in a Q/A format or like test which is better than writing a bunch of notes and just passively looking over.
Here’s another one on the hypothalamus-anterior pituitary-adrenal cortex axis (HPA)

As you can see I love flow charts for sequential pathways and showing the cause and effects of each step (what increases or decreases, which hormone is involved, etc)
I will write a more detailed post on what I put into my MCAT notebooks and what I look for when reading or extracting information from the review books. So just hold on and be patient.
Practice, Practice, Practice
Knowledge is power but practice makes perfect. Remember that the MCAT will not really test your ability to recall facts straight from the book; this is not a trivia show. It is your ability to apply known information (your MCAT content review) and integrate them with other information in an unknown situation (the MCAT passages). That’s why I like that my MCAT books have practice passages at the end of each chapter. I also bought extra practice passages from NextStep because they really do help me understand the content and the timing. If you do not have practice passages right now, go to the Khan academy MCAT section and there’s loads of them (but they are really easy though).
Also, I really enjoyed watching videos on YouTube on how to approach passages and seeing what other people’s strategies and methods are. I tend to integrate what others do with my own method, but everyone is different so just take it with a grain of salt. Here are a couple of my favorite Youtubers, one of which is actually my best friend.
Amanda and Rich Show: MCAT Biology Passage Breakdown
CurveSetter: MCAT 2015 Biochemistry Tutorial 1 (Amino Acids) – CurveSetter Tutoring
CurveSetter: MCAT Biology/Biochemistry Passage Analysis (Acetylcholine) – CurveSetter MCAT Prep
CurveSetter: MCAT 2015 Chemistry Tutorial 3 (Titration Passage) – CurveSetter Tutoring
CurveSetter: MCAT 2015 Chemistry/Physics Selected MC 1 – CurveSetter Tutoring
CurveSetter: Electricity and Magnetism MCAT Physics Passage – CurveSetter MCAT Prep
CurveSetter: MCAT 2015 Biology Tutorial 1 (Neuron Passage) – CurveSetter Tutoring
CurveSetter: MCAT 2015 CARS Tutorial 1 (Passage) – CurveSetter Tutoring
CurveSetter: MCAT 2015 CARS Tutorial 1 (Questions) – CurveSetter Tutoring
SecondChance MCAT: MCAT Science Passage Breakdown #1
SecondChance MCAT: Full MCAT CARS Passage Breakdown (98% CARS Scorer)
Bless her Health: CARS WORKSHOP 08/24
Bless her Health: CARS WORKSHOP 08/28
After going through a few passages or so, review your mistakes! Then again look up your Q/A notes and see where you went wrong. When you do this, you’re allocating your attention areas that need it. This really helped me retain information whilst, practicing applying concepts with other concepts. Another reason why, is that the questions on the MCAT are really different from your college classes. Again, you’re not regurgitating facts out, you’re applying what you know with what you don’t know by looking at superficial similarities and coming up with the best answer. Since this is a new skill, the only way to learn it is through practice.
I am planning on making a post about how I breakdown science and CARS passages as well so stay tuned.
Spaced Repetition Is Key
One of the keys to success for the MCAT is repetition for retention. If you do not review, you will forget it. That’s why I always made sure that after a section of a chapter I would look over what I had so far and really try to understand what I just learned and see how it relates to other chapters or to the other subjects in one way or another to get the BIG PICTURE. Then, before I go to sleep I will look over at the chapter again as a whole and annotate anything that I think needs more detail. Then the next day before starting a new chapter, I quickly look at all the previous chapters by talking aloud (or aggressively whispering if you’re around people, sorry to the girl at Starbucks who has to put up with my) and just make connections to it. Over time, I looked at all the previous chapters so much that I can recall many concepts.
Review while making your Q/A notes
review after making your Q/A notes
Look at your Q/A notes before you go to bed
Before starting a new chapter, look at all the previous Q/A notes to refresh your memory
1 day later look at your old Q/A notes then maybe 3 days later do it again
Congratulations, all the info you’ve mastered are now stored in your long term memory. It is permanent until you die (unless if you get amnesia).
I hope this helps make up for my absence and don’t worry, I will post more on MCAT prep. So ciao for now, and stay flossy everyone.
How I Prepare for the MCAT Part 1 Hey Snarklings! Are you surprised that I'm still alive? I know I am (lols am I even relevant anymore?) Before I get into my whole MCAT prep strategy, I just wanted to say that I'm sorry for leaving you guys in the dust.
1 note
·
View note
Note
(I think I may have sent this Q to another medblr but idr so sorry if it comes up again) but about emphasis on science GPA-isn't it unfair to humanities majors? Everyone should strive for the best grade, but it seems like it gives humanities majors less room for error in terms of science grades, and perhaps more pressure. I know med schools like diversity, but wouldn't they be in a way discouraging premeds from majoring in the humanities and pushing them towards majoring in the sciences to make
(cont.) sure their science GPA stays high if that's what medical schools look at? Only asking b/c I noticed you've stated before science GPA is highly emphasized but a lot of places apparently screen out certain science GPAs and it seems like from Reddit and other places, more emphasis is being put on it? Idk just a thought.
---------------------------------------------------------------------------------
Hi there anon!
This is a question I’ve seen and I’ve also asked myself as I went through the application process as a non-science major myself. I must admit I do not recall saying that there was an emphasis per say on science GPAs, and so you’ll have to pardon my memory. But most if not all med schools seven some years ago when I was applying were still definitely looking at total GPAs and science GPAs for applicants.
That said, to your question, it is indeed unfair. Do not assume by any stretch of the imagination that medical school is immune to history, prior prejudices, and prior notions of what a physician ought to be. It indeed can make it unfair to humanities majors and the ripple effect has been that most pre-meds still believe that they have to be a science major in order to get into med school.
However, there have been some ways that schools have been working to address this inherent bias. 1. Pre-requisites. Schools can utilize pre-requisite courses to (ideally) create a set of ‘criteria’ by which all their applicants can be screened. That way, even if say a science major takes tones of science courses, it still won’t help if they don’t take the pre-requisites for the school. 2. The MCAT itself is changing to place more emphasis on sociology, psychology. 3. Schools themselves are also searching for more students with humanities backgrounds, because they are also seeing the evidence that the humanities are not a deficit, but a benefit to future patients and to the learners themselves.
So yes, these antiquated ideas are still lingering. Medicine loves to linger on its own antiquity. But I think things are looking to go in the right direction!
md-a
2 notes
·
View notes
Text
Bets College Homework Mac App
College isn't all fun and games (unless you want it to be.) Don't sweat it, though. Take a look at these 25 apps — they'll give you a smoother college experience by helping you study smarter, connect with new people and wake up in time for your early lectures.
Jul 06, 2020 BET+ is a premium online streaming service with over 1,000 hours of your favorite Black content from the best Black creators. Now, you can stream Black culture: the movies you remember, the TV shows you love and the new series you can't live without. And they're all in one place, commercial free. Everything from classics like Martin and House of Payne to modern favorites like Bigger and Carl. The best part about this app is that the students can opt for one-on-one interaction with a tutor and clear their doubts instantly. Download: iOS. Student Agenda. This homework app offers a free planner and diary that is designed by the students for an uncluttered usage.
Your university probably has its own app, too — download it. It will provide you with a more tailored breakdown than a national application.
See also: 12 Things Students Should Never Do on Social Media
Any helpful ones we missed? Let us know in the comments!
1. BenchPrep
Image: BenchPrep
BenchPrep is an interactive course library with all the graduate and professional exam study material you can handle. It includes hundreds of practice questions, flashcards, in-app purchases and almost 600 study lessons. Go ahead and pick your poison: LSAT, MCAT, GMAT.
Available for free on iOS and Android devices.
2. iStudiez Pro
Image: iStudentPro
iStudiezPro keeps track of your deadlines, grades and more across all Mac devices — all you need to do is plug your class schedule into the app. It comes with both Cloud syncing and iCal integration.
Bets College Homework Mac Application
Available for $2.99 for iOS. The free iStudiez Lite version limits the number of classes you manage, but it's useful nonetheless.
3. Evernote
You've probably heard a lot about Evernote, and yes, you should try it. What have you got to lose .. your homework? The app syncs all your stuff — text, audio, photo, video — to an online account, so you're always connected with resources to study.
If you're feeling overwhelmed by Evernote's many features, check out this comprehensive beginner's guide.
Available for broke college students (read: free) for iOS and Android devices. The premium version is even more useful, at $5 a month or $45 a year.
4. StudyBlue Flashcards
Flashcards are an effective way to memorize information, but making them is a headache. With StudyBlue, use text, pictures and audio to create the perfect stack of (digital) flashcards; or, search the massive database to borrow someone else's.
Bets College Homework Mac App Free
Available for iOS and Android devices.
5. RealCalc Scientific Calculator
Did your little brother steal your calculator once you finished AP physics? Use RealCalc for serious computing — it's a perfect alternative for the calculator-less.
Available for free for Android. If you need a heavy-duty upgrade, try RealCalc Plus for $3.49.
6. Engineering Professional
More than 650 chemical, civil, electrical, environmental, hydrology and mechanical formulas are updated in Engineering Pro — so don't worry about buying multiple formula apps. Save or Favorite the formulas you need most often.


Available for $11.99 for iOS.
7. EasyBib
Image: EasyBib
EasyBib generates citations in MLA, APA and Chicago style wherever you are — just scan the book's bar code or enter the title. The app also lets you easily email and export the bibliographies to yourself. Using this, you have no excuses for putting off that term paper.
Available for free for iOS and Android devices.
8. Notella
Image: Notella
Some professors drop the most important bombs when you least expect it ('Have a good spring break, everyone. Oh! One more thing: We're having an exam worth 60% of your final grade the day you get back. See ya!').
Don't miss a thing with Notesdeck. This super-fast note-taking app opens to a new note by default, lets you create custom hotkeys and syncs notes from other apps — iCloud, Evernote, Simplenote and Dropbox. You can even search within those other apps from one search bar.
Mac map mouse button app download. Feb 06, 2007 Question: Q: Mouse Button Mapping More Less. Apple Footer. This site contains user submitted content, comments and opinions and is for informational purposes only. Apple may provide or recommend responses as a possible solution based on the information provided; every potential issue may involve several factors not detailed in the conversations. May 28, 2012 Joystick Mapper is an application that allows you to configure your joysticks or gamepads to simulate keyboard keys/mouse movement/mouse click/mouse scroll, so you can control any app or game using them, even the ones without built-in support. It also lets you remap the Scroll Wheel Button to some useful functions like Mission Control and it features a refined Smooth-Scrolling algorithm, which I think strikes a great balance between fluidity and control. Mac Mouse Fix is very light on system resources and it's a System Preferences Plugin so there's no status bar item. X-Mouse Button Control by Phillip Gibbons (Highresolution Enterprises) is a free application that can help you customize the functionality of your mouse buttons (set new functions to mouse buttons). Sadly, there is no version of X-Mouse Button Control for Mac available for download, but there are other tools that can help you change the.
Available for $2.99 for iOS.
9. Wolfram Alpha
From thermodynamics to baseball, the Wolfram Alpha reference app uses its supercomputing Cloud to quickly generate answers — across thousands of domains — to all your research questions.
Available for $2.99 for iOS and Android devices.
10. Dictionary.com Mobile
With more than two million definitions, synonyms and antonyms, Dictionary.com's fast and user-friendly mobile app will decode that confusing media law textbook in no time.
Available for free for iOS and Android devices.
11. Babylon
Whether you're a Spanish lit major or just looking to finish your general education requirements, Babylon provides comprehensive dictionary results and translations for dozens of languages. With pasteboard integration and access to more than 1,500 glossaries in 75 languages, you'll never struggle to find an accurate definition for your foreign language presentation again.
iBabylon is available for free for iOS; Babylon Translator is available for free for Android.
12. Jumpcut
You have better things to do than copy and paste all day. Make light work of data entry assignments with Jumpcut: copy as much text as you want, one after another, and paste using simple keystrokes.
Available for Macs only.
13. Dragon Dictation
Ever wish you could type faster? Dragon Dictation uses accurate voice recognition software to let you speak and instantly see your words in text. Dictate statuses to your social networks or pretend you're talking to someone if you're trying to write a speech — even send statuses straight to your social networks. Try this if you're in a time crunch and really need to churn out an essay; or, if you're just someone who prefers speaking over writing.
Available for free for iOS.
14. SelfControl
Image: Flickr, jonas maaloe
It's finals week. You have a huge essay to finish .. but then there's Reddit, emitting its bewitching siren call. Every. Damn. Time.
SelfControl lets you set a period of time to block certain websites or mail servers by adding them to a 'blacklist.' It's too bad if you finish your work early — restarting your computer or deleting the application won't negate the timer.
Available for free for Mac OS X.
15. Studious
Avoid interrupting class and getting on your professor's bad side with Studious. Once you input your class schedule, Studious will silence your phone during those hours.
Available for free for Android. Upgrade to Studious+ for $1.99 to bypass the ads.
16. Circle of 6
Ever feel uncomfortable when it's dark and you're in a new part of a city — or even campus? Circle of 6 won the White House's Apps Against Abuse challenge. It helps you stay safe by connecting you to six trusted contacts, whenever and wherever. Use the pre-programmed 'come and get me' message with your GPS location, or easily call national and local emergency hotlines in critical situations. It's a fast and discreet way to put your safety first.
Available for free for iOS and Android devices.
Addendum: You don't actually need six people if you want to double up on contacts.
17. Skype
Image: Skype
Hi!The last days I've noticed how every time I start Safari everything freezes (finder included) for a couple minutes. Macos bitcoin miner in mrt.app. Then I can write something in the search bar, and then it freezes another time!
Video interviews are not going away any time soon — so you might as well get a heads up now. Microsoft's Skype is a reliable way to connect with faraway family and friends via text, voice and — of course — video.
Available for free for iOS and Android devices.
18. LinkedIn
LinkedIn and all its nifty mobile features makes connections a breeze — for better or worse, college is a time of both personal and professional connections.
Available on the web, of course, but also for free for iOS and Android devices.
19. Twitter
Don't be the only person in class who isn't up-to-date with world events. Use Twitter to keep yourself in the loop in both the academic and social aspects of your life. In today's contemporary classrooms, you may even be asked to participate in class discussions via Twitter.
Available for free for iOS and Android devices.
20. Sworkit
There are a lot of things to do in college. Exercising isn't always one of them; especially when there's socializing and studying to be had. Sworkit's greatest asset is its ability to let you choose your exercise time allotment in five-minute increments — starting at, yes, the very low threshold of five minutes. Doable, right?
It also boasts an extensive list of work out routines.
Available for free for iOS and Android devices. Sworkit Pro comes with advanced features and costs $0.99 for iOS and Android.
See also: 10 YouTube Channels That Will Make You Smarter
21. Mint
Club fees. Books. Tuition. Food. College adds up — quickly. Mint is a web and mobile app that helps you keep track of your spending. Plus, it's never too early to start cultivating good credit.
Available for free for iOS and Android devices.
22. Sleep If U Can Alarm
Bets College Homework Mac Apps
Come on, you lazy bum — you're paying for these early classes, remember? Nicknamed the 'world's most annoying alarm,' Sleep If U Can gives you two options to silent the alarm: 1) Shake your phone; or 2) Physically go the place shown on your screen (see: the bathroom sink in the video) and take a picture.
Available for $1.99 for iOS and free for Android.
23. Pocket First Aid & CPR
Mashable composite, images: Pocket First Aid & CPR
While it's not the sexiest app to have at your disposable, you never know when it might come in handy. Along with clear and concise CPR instructions, Pocket First Aid and CPR contains 34 videos and 46 high-resolution illustrations.
Available for $1.99 for iOS and Android devices.
Bets College Homework Mac App Download
24. Between
Attempting the long-distance relationship course? Kudos — that's no small task. Relationship app Between can help ease the separation anxiety by letting you send messages, voicemails, memos and photos. A private timeline makes it easy to reminisce about the good old days with your significant other(s).
Available for free for iOS and Android devices.
25. TED
Image: TED
In an environment often congested with bad influences, a heavy dose of genius goes a long way. TED Talks give you instant access to the biggest thought leaders of our time.
Available for free for iOS and Android devices.
Image: Mashable, Meghan Uno
Whether you're taking the first step towards school or passing out of the college, your life can be a total mess including assignments, surprise tests, homework, examinations, attendance and so on. All you do is wake up early, go to school and come back. That becomes your routine cutting out the quality time to spend with your family and friends. How disheartening is that? With such a busy schedule and a massive number of deadlines to fulfill, it becomes quite challenging to keep track of homework or anything that has to be submitted on the next day. In such circumstances, a homework planner or organizer could be reliable to oversee and update you regarding the assignments, homework and other deadlines. Of course, it's a daunting task to look out for a suitable homework planner who can assist you with your regular tasks.
Top 5 Homework Planner Apps for College Students
Because it is a tedious job, we have come up with the best homework planner apps for students that will help them to do their tasks without any hassle:
1. School Planner
School planner is a full-scale homework planner app that is designed mainly to pay attention to students so that they are well focussed about their career. This app has a pile of features ranging from simple features to ones that you can think of. Besides your homework and timetable, school planner app assists you to keep track of your attendance. You can also add your teachers' contacts on the list, combine recorded lectures which could be beneficial during exams and add multiple planners too. Initially, it is a tedious job to use this app as you have to enter all your details in a form. In addition to your details, you must enter your teacher's details, timetable, and other college details. But once that's done, you're good to go! The app also supports backing up all the data that you feed in via Google drive, calendar, etc. This app does not fail to give you weekly reports, give reminders on the day of submission of assignments, attach snapshots to any reminders. Although the school planner offers a lot of features, it has the best performance with a beautiful framework. In case of your research paper you can use Edusson at affordable pricing.
2. Istudiez pro
Istudiez pro is yet another student-friendly homework planner app and probably the oldest app when compared to all of the mentioned apps. Like school planner, this app also offers a wide range of features including grading, attendance and subject wise organization of activities. It is way easier to set up when compared to a school planner. But the prominent feature in studies pro is that it is integrated with Google Calendar which gives you all the details like holidays, exam schedule, daily routine and so on. Not just that, it is also supported in all operating platforms like iOS, Mac, and windows. All the apps sync well and therefore you can operate this homework planner anywhere anytime on your laptop.
3. My study life
The next homework planner app for college students is My Study Life. The best thing about this app is that it has its web app which makes it unique. The web app can sync well(mostly on Android) therefore making your data accessible from any remote location using your device. Make sure that you've got a web browser installed in your device. This is a goal-oriented app and keeps reminding you about how much is completed and how much is left to achieve the goal. In addition to that, the calendar feature keeps track of all the important dates, it could be deadlines or project submission dates. The only con of my study life is that it is quite lengthy to set up. Once it is correctly done, you're all set!
4. ChalkBoard
One of the smartest homework planner app for students is a chalkboard. It is pretty quick regarding its features and subject wise allocation of teachers on the app. When you open it for the first time, it prompts you to fill the name and subjects of all your teachers along with the timetable. Cool, isn't it? Although the setup process is a tedious job, it is entirely reliable and smooth. The amazing part is you don't have to memorize your timetable as you can see the upcoming classes on the home screen. Not just that, you can also find pending assignments and other tasks on the screen making your job way too easy. Features like these make this app stand out when compared to other homework organizer apps and gives you a great overall experience. This homework planner app would have been much more superior if it had a calendar feature in it.
5. Egenda
It's quite easy to set up Egenda when compared to others. All you need to do is, add the subjects and classes that you have. Once that is done, you have the choice of adding any homework, deadline, project or test. The pending tasks can be seen in the form of cards and have to be swiped away once it's completed. The best part about this homework planner app is that it keeps you updated, could be regarding the upcoming assignments, tasks or competitions. This will help you plan ahead and complete the job on time. Unfortunately, the app doesn't have a timetable feature. But in its latest update, you will find a calendar that can assist you in keeping track of dates. Backup option not available in this app, therefore data can't be recovered once you lose it.
Final Words
So these were some of the coolest homework planner apps exclusively for career-oriented students who want their tasks to be completed on time and who do not wish to struggle till the last minute to meet the goal. We genuinely understand your problem and these apps are going to be of great use to you!
0 notes
Text
Shadowing: Dr. Jennifer Lincoln, MD, IBCLC
personal background
from Queens, NY and currently in Pacific NW (Portland)
attended catholic school, Washington college in Maryland (BS in biology, minor in chemistry/english)
Tulane university school of medicine - homeless shelter and reproductive healthcare clinic volunteering in first 2 years | survived hurricane!
evacuation to Houston due to hurricane, completed some requirements at Baylor college of medicine in Houston
passion for medical communication, british literature
Zeta chi alpha sorority activity, journalism
OB hospitalist, which is an OB/GYN specialization
couples matched to residency programs
why medicine?
only go into medicine if you truly want to do it
interest in science and love for patient care and interaction
possible medical writing rather than medicine, but...they were miserable
it’s okay to have doubts, but make sure you’re certain in the end that you want to go down the physician pathway
you can also go into medicine without physician ship
getting into med school
no secret to getting in, but you don’t need to be perfect! hard to believe, but try your best to push back against pressure to be perfect
you have to work hard, but take care of yourself. keep the fun-work balance!
develop your character and personality, and stay real with who you are.
do your best but you don’t need to be pressured into the sciences. major in what you love and satisfy your prereqs!
remind yourself why you’re studying by volunteering outside of school!
PREP FOR THE MCAT!!
address your flaws and point to reasons you still want and deserve to be here
be active and go all in on club activities | social media is fair game, stay professional
imposter syndrome is real!!!! don’t be afraid to address your shortcomings
professional and personal life
OB/GYN hospitalist - in-patient work with women, 12h day/night shifts part-time right now | expert in OB/GYN
medical director in postpartum care, safety net for issues after birth
IBCLC - lactation specialist (100h education, 1000 clinical experience, board exam)
Northwest Mother’s Milk Bank to distribute human milk to women in need
Write for Bundoo and Flo, credential protections with articles
Media and TikTok to combat misinformation in medicine and health
married to a pediatrician, 2 kids, reading and kayaking, coffee <3
work-life balance is important to career excellence, can’t hold patients’ issues with a full cup
SOGH - simulations, educational material from hospital work
why OB/GYN?
ultrasounds, deliver babies, C-sections, surgery, hysterectomies, contraceptive counseling, reproductive health counseling, menopause support
dealing with emergency surgeries in uterus, inform patients of ovarian cancer / stillborn / miscarriage
handling politically-motivated abortion access restriction
staying totally emotionally present is difficult but with support it’s achievable
becoming an OB/GYN
generalist or sub-specialization in OB/GYN-related fields to increase operative experience, clinical care time, etc., etc.
boarded and non-boarded sub-specialty areas differ in terms of required coursework and exams
start OB/GYN rotation with Active Internship and get letters of rec, experience. Can do more OB/GYN electives before residency or explore other specialities
4-year broad-training residency and graduation, taking written boards and practice for a year
collect cases in second year, and submit all cases - get board exams in Dallas, Q&A interview about all cases to convince OB/GYN board of qualifications
every year = maintenance re-certification to stay current with treatment
day in the life
see patients first thing in the morning
clinic shift 8-5 with all sorts of whatever cases come in
follow-ups with open cases
operating days - scheduling operations, prepping patients beforehand and then running through all steps before operating (major with in-hospital stay, or minor where patient goes home afterwards)
post-op checking and afternoon checks
labor/delivery day: 12h/24h shifts, check in on patients and address patients in triage (emergency room, essentially)
adrenaline rush, fast-paced work, body fluids don’t scare you, unpredictability
be comfortable delivering sensitive information
high malpractice rate in OB/GYN specialization
case study 1
Patient PIH - 18yo gravita 1 (first baby) | 39wks4d | well-oxygenated baby
headache, high blood pressure, proteinuria during labor contractions
need to treat blood pressure otherwise stroke is possible | high blood pressure is common, i.e., gestational hypertension
or complications = preeclampsia (HT and other problems, i.e., pulmonary, renal, neurological disturbances), leads to maternal death
differentiate mild or severe HT that impacts whether to keep her pregnant or deliver her
IV medications administered to PIH; lab tests return low platelets
PIH has tonic clonic seizure | low baby oxygenation and low heart rate in infant
treat seizure, not baby’s low heart rate; treatment of first is solution to second
put patient on her side to circulate more blood, give MgSO4, and move towards delivery
pre-eclampsia has reduced nutrition of placenta and baby is 5lbs at full-term delivery
case study 2
jane, 16yo | heavy periods | ask parent to leave the teen for anyone 13+
jane needs birth control but has not told her mother | protect patient (jane) first
treatment: need birth control, STI testing, IPV screening for partner - go to Guttmacher institute for state’s laws on minor consent to see what you can and can’t do without consulting mother of minor
know laws in your state | counseling and figure out insurance title, individual insurance so that title shows up for jane but not her mom’s insurance
make disclosure notes, check with jane on consult and suggest conversation with parents if appropriate
OB/GYN = not just medical things but also trust, patient relationship
1 note
·
View note
Text
🇨🇳🇨🇳 SCHOLARSHIP AND VISA AVAILABLE NOW FULLY FUNDED WITH MONTHLY STIPEND IN CHINA AND CANADA 🇨🇦 🇨🇦
INTAKES : 2020/2021
NO COUNTRY RESTRICTIONS ️Special Offer for Africans and Asians All Nationality’s can Apply ,
———————————
📄scholarship Coverage
........................................
📚Accommodation Free
📚Tuition Free
📚Monthly Stipends
📚Visa Assistant and International Students Health Insurance
📚Top rank university
📚Air Conditioner Dormitory
📚New Dormitory New Rooms
📚1 Single Room
MONTHLY STIPENDS :
💴 Diploma 1,500¥-CA$1600
💴 Bachelor 2,500¥-CA$2500
💴 Masters 3,000¥-CA$3200
💴 PhD 3,500¥-CA$3500
💥💥Languages Taught
📃English Taught
��Chinese Taught
🔥NOTE: Transfer Students are Also Accepted 🔥💯
UNIVERSITIES IN CANADA🇨🇦🇨🇦
🏫 University Of Alberta
🏫 University Of Toronto
🏫 University Of Waterloo
🏫 Mcgill University
🏫 Queen University
🏫 York University
UNIVERSITIES IN CHINA🇨🇳🇨🇳
🏫 Wuhan University
🏫 Shanghai university
🏫 Jiangxi University
🏫 Guizhou University
🏫 Henan University
🏫 Hebei University
🏫Beijing normal university
🏫Peking normal university
Admission Notice within 7 days and JW202 within 15days
______________________________________________
🇨🇳 🇨🇳 CHINA 🇨🇳🇨🇳
📜Tourist L visa
📜Business M visa
📜Working Z visa . 1 year
📜Family Q or S visa 30 days
📜Visa On Arrival 30 days
📜Visa for Student. X1. 6 months and 1 year.
X2 180 days
🇨🇦CANADA 🇨🇦 🇨🇦
📜Permanent Residence visa
📜Tourist visa
📜Work permit and visa
📜Study permit and visa
🇨🇳🇨🇳🇨🇳🇨🇳
✔Invitation letter
✔Diploma Authentication
✔Clear overstay (2-5 years)
✔Flight tickets
✔Training certificates: TESOL, TEFL, IELTS, CELTA, GMAT, MCAT, PSGE, HSK all levels
✔Driver Licenses, Authentic biometric passports entry/exit visas diploma and degree authentication and notarization SSD solutions bank notes.
💥CHAT ME UP FOR MORE ENQUIRES. 📲 contact or inbox me on WhatsApp: +16052043364
💚💚💚No country restrictions,Agents and Students are welcome to work with us [Shake]💚💚💚
0 notes
Text
Update
So I’m supposed to be studying for my MCAT right now, but I had a blast from the past. I remembered when Tumblr was my life back in 2010-2013. I had a lot of followers and met some pretty amazing people. I even made some videos like Tumblr Q&As and Tumblr shoutouts. So I started watching those videos today.
Honestly, I miss those days so much. I met some incredible people back in the day. I still keep in contact with a few people, but unfortunately, I lost touch with most people.
I don’t know what Tumblr is anymore or who follows me, but I would love to rekindle friendships, meet new people, and share experiences with people. Also would love to waste time on here instead of studying!
So most of you don't care, but IDontSmellLikeCurry is backish.
UPDATE: STILL DON’T SMELL LIKE CURRY (I think).
3 notes
·
View notes
Text
MCAT studying during winter break DAY 1
Here’s a list of things I want to accomplish by the end of the day inshallah. Subject to change ofc.
1. Biology- First 3 Chapters; take only essential notes
2. Do all Qbank q’s that relate to bio chapters.
3. Watch KA videos that are due today (according to study schedule sheet)
4. 3 CARS passages
5. Chemistry Problems (Topic: TBA)
2 notes
·
View notes