#devendras beard

[zebreacadabra]

Joanna Newsom with a blue crochet beard

Picture found on Pinterest, probably taken during a 2004 or 2005 tour. Same timing as "The Golden Apples" compilation release and the filming of "Family Jam" documentary. It looks like this unic piece of garment have follow Devendra Banhart to this french tv show aperance.

[maruti-suzuki-jimny]

You’ve been waiting for this day for years. Devendra Banhart, the high priest of freak folk, is back with a brand new album. After a five-year hiatus, your favorite bearded bohemian bard has emerged from his Laurel Canyon bungalow with Flying Wig, his tenth studio album set for release this fall. The title alone gives … Read more

[bechappening]

The chokehold that Devendra Banhart Father John Misty sensitive mature lanky bearded folk artist men have over me lately is truly unacceptable

[manitat]

1. Children Of The Revolution – Kesha (from Tanx) 2. Cosmic Dancer – Nick Cave (from Electric Warrior) 3. Jeepster – Joan Jett (from Electric Warrior) 4. Scenescof – Devendra Banhart (from My People Were Fair…) 5. Life’s A Gas – Lucinda Williams (from Electric Warrior) 6. Solid Gold, Easy Action – Peaches (from T. Rex Greatest Hits) 7. Dawn Storm – Børns (from Futuristic Dragon) 8. Hippy Gumbo – Beth Orton (from The Beginning Of Doves) 9. I Love To Boogie – King Khan (from Dandy In The Underworld) 10. Beltane Walk – Gaby Moreno (from T. Rex) 11. Diamond Meadows – John Cameron Mitchell (from T. Rex) 12. Ballrooms Of Mars – Emily Haines (from The Slider) 13. Main Man – Father John Misty (from The Slider) 14. Rock On – Perry Farrell (from The Slider) 15. The Street And Babe Shadow – Elysian Fields (from Tanx) 16. The Leopards – Gavin Friday (from Zinc Alloy...) 17. Metal Guru – Nena (from The Slider) 18. Teenage Dream – Marc Almond (from Zinc Alloy...) 19. Organ Blues – Helga Davis (from A Beard Of Stars) 20. Planet Queen – Todd Rundgren (from Electric Warrior) 21. Great Horse – Jessie Harris (from A Beard Of Stars) 22. Mambo Sun – Sean Lennon & C. K. Muhl (from Electric Warrior) 23. Pilgrim’s Tale – Victoria Williams & Julian Lennon (from Unicorn) 24. Bang A Gong – David Johansen (from Electric Warrior) 25. She Was Born To Be My Unicorn… Ride A White Swan – Maria McKee & Gavin Friday (from Unicorn)

[absolutelysweetmegan]

DRESSING LIKE ALBUM ART

•Seven Separate Fools - Three Dog Night

•Rejoicing in the Hands/Niño Rojo - Devendra Banhart

•The Freewheelin’ Bob Dylan - Bob Dylan

•AM - Arctic Monkeys

•Crosby, Stills, & Nash - Crosby, Stills, & Nash

•Beards, Wives, Denim - Pond

Which one is best? 🤗

#vinyl #albumart #classicrock #folk #folkrock #1960s #1970s #outfits #threedognight #devendrabanhart #bobdylan #arcticmonkeys #crosbystillsandnash #pond

[greenvincentine]

This is the beard I'm always growin' I know they're here, I see them floating. Her empress beards, They float so holy. Their beards are here, They gently hold me

Well who knows, who knows? Yeah I may come home, Yeah I may return

“This Is the Way”   Devendra Banhart

images: The Color of Pomegranates  (1969, Sergei Paradjanov)

[jefferyryanlong]

Infinite Pau Hana - August 3, 2022

“perhaps the world’s a cube, a tunnel or a tube”

rutles, song-poems, and other fun stuff

Hour 1

All Around You (Intro) - The Brain Jonestown Massacre With a Girl Like You - The Rutles Death Can for Cutie (live) - The Bonzo Dog Doo-Dah Band Alcohol (live) - The Kinks Ecstacy (Sic) to Frenzy - Rodd Keith I Am Gonna Unmask the Batman - Lacy Gibson My Hang-Ups Ain’t Hung-Up No More - Swamp Dogg Maker of Smooth Music - Dick Kent Lifting Up the Skirt of the Night - Bob’s Burgers Million Dollar Bash - Bob Dylan and the Band This Beard Is for Siobhan - Devendra Banhart Wild Honey Pie - The Beatles The Continuing Story of Bungalow Bill - The Beatles Ouch! - The Rutles Electric Heart - Devendra Banhart

Hour 2

Cappuccino Bar - Jonathan Richman The Man Who Couldn’t Cry* - Loudon Wainwright III Dear Doctor - The Rolling Stones Convertibles and Headbands - Music Magicians The Piano Has Been Drinking (Not Me)* - Tom Waits Twisted - Lambert, Hendricks, and Ross Monologue About Bermuda (live) - Jonathan Richman Asian Superstore - Lovehandles The Hedgehog’s Song - The Incredible String Band The Littlest Birds Sing the Prettiest Songs - The Be Good Tanyas Beautiful Consumer - Summatyme Playerrz Bike - Miles Davis Nothing Like You - Miles Davis

Hour 3

Dirty Hands - Black Lips Dirty Water* - The Standells Help, I’m a Rock* - The West Coast Pop Art Experimental Band I Wanna Be Your Dog* - The Stooges 300 Pounds of Hongry* - Tony Joe White Crackin’ Up - Bo Diddley Cheese and Onions - The Rutles The Porpoise Song - The Monkees Short Shorts - The Royal Teens How Long Are You Staying - Bill Joy Sick and Tired - Fats Domino I Like Yellow Things - Bobbi Blake Green Fingernails - Gene Marshall The Purple People Eater - Sheb Wooley  Living in Hope - The Rutles

* - by request

KTUH - 90.1 FM Honolulu, 91.1 FM North Shore, ktuh.org

[twopoppies]

I have a question that’s not so popular, so I hope it’s ok I’ve brought it to you. It’s now been 10 months of Harry and Camille. Tour ends mid July. I’ve long thought that she has been keeping his name out of the headlines as a groupie magnet for this tour. And also keeping his image as a rockstar on tour with his French VS model girlfriend. But the part that confuses me is how did she get the title for actual long term gf? She will be the one songs will be written about for the next album. 1/2

What was it about her or the particular moment in time? Was it his solo launch, his new brand? His first long term gf, will it go past August? If longer, might it be real? Extending it beyond a year legitimizes hamille, but won’t she want to get back to her relationships? I mean she dated Devendra Barnhart for a long while, and I can’t imagine he needed a beard in his indie world. I’m wondering when the benefit ends for Harry to be associated with Camille and if there are signs to watch for? 2/2

Take your time on the hamille ask. Just thought it was interesting as it relates to H’s image, like how she has been very under the radar but still part of the hslot brand. Her personal style has that 1970s casualness and her dorkiness seems analogous to Harry too. It’s so well choreographed, like “they” did their research this time. The common factor is Alexa Chung. Between Camille’s recent advert with Alexa’s Skarsgaard boyfriend & the new Cam Avery (old Camille bf) MV that Alexa is in. Weird!

So, I know you sent this last night and I made you wait for my answer but truthfully I have nothing really earth shattering to tell you. I think she became the first long term beard because he/his team wanted to change his image from man who sleeps with 410 women in a year to rock star cool enough to have a model girlfriend, but they’re long term so don’t even think about showing up at his door in lingerie hoping to be his muse. I don’t think C becoming the first long term beard particularly had much to do with her as it did with timing. Or maybe her willingness to disappear into the background. 

Of course it’s not real. Even if they’re “together” for years. Eleanor isn’t Louis’ girlfriend no matter how long we have to endure her. Harry is not dating Camille. Full stop. No pun intended. Most (if not all) the previous VS girls have similar connections to Harry/Azoff etc. It’s not some sort of organic thing. I don’t think “they” particularly researched much because if they had they probably would have wiped some of the less appealing stuff from her SM before going public. 

As for the question of her wanting to get back to her life…well, yeah. You’d think. But it seems as though the people who sign on for this sort of thing care more about possible benefits to their careers as opposed to what you or I might think about. I can’t begin to guess on “signs” of it ending because, as we saw with Danielle, one day they’re in love, the next day she’s been “Danielled”. 

[skullingthunder]

6th mix

https://open.spotify.com/user/jeffrothunder/playlist/1HNi7SrNXwqbfVFzJFmsQM

Manhattan - small dad

While You Wait For The Others - Grizzly Bear 

Kiss - Scout Niblett 

Back To The Races - Chadwick Stokes 

Shadow - Gringo Star 

Sold - Dan Mangan 

7:30 Am - Slothrust 

Midnite Blues - The Detroit Cobras 

Alone Again - The King Khan & BBQ Show 

Little Bird - Livingmore 

Drivin' on 9 - The Breeders 

We'll Do It So You Don't Have To - Islands 

All Apologies - Nirvana 

Salt on a Slug - The Growlers 

The Depths - Kevin O'Donnell's Quality Six 

We've Been Had - The Walkmen 

Silent Song - Daniel Rossen 

Trades And Tariffs - The Dodo 

This Beard Is For Siobhan - Devendra Banhart 

After The Afterlife - Chad VanGaalen 

[cantquitu]

ok im sorry to be a pain but who is the man with the beard ? im totally blanking. i gotta be in on this joke! lmao

It’s Devendra Banhart. He’s a singer/songwriter, and Camille’s ex-boyfriend. 

(and not that it matters, but I went to multiple Devendra  Banhart shows long before I even knew a Harry Styles, so no shade intended to Devendra, my weirdy blue-faced warbler)

[binnedrubbish]

5/12/19 Notes

Lab Meeting Prep Pipeline:

(May 2nd, 2019 at 2:38 p.m.) 

[ ] Read the Results & Discussion cover to cover

[ ] Complete slides for all figures

[ ] Give a practice presentation

[ ] Read methods 

[ ] Complete fluorescence slides

[ ] Decide how to deal with ‘relationship between calcium activity and movement’ section

[ ] Give a practice presentation 

[  ] Read supplementary material cover to cover

[  ] Give a practice presentation 

Note to self: Relax.  Be meticulous.   Be disciplined.  Keep calm, do your best, trust your team.  

—— 

——

Advanced Optimization 

8 20 905

Live Action Poem, February 2nd, 6:41

Went to Brazil out of spite and saw

stone Jesus, arms open for a hug,

bought street weed, twice, from the same vendor

out of a reckless love for reckless love.

Hoped for a tropical muse and found 

a strong handshake from a dangerous man.

Holed up in Rio de Janeiro with piles

of paper money and paced all alone

angry at nothing if only for the moment.

Rain dampened slick stone walkaways,

waiters were too nice and I tipped too much.

One offered to be a bodyguard , violence

hinted in every smirking human moment.

God, I loved being a target, smug,

dumb, flitting away American Dollars.

Jesus Christ looming in stone on a hill top.

Titties and marijuana, iconic primadonna 

extravagant flora, dying fauna, fawning

over the climate. I went to Brazil

on an off month. To hole up 

safe from my sprawling little lovely life. 

To Do 26.1.19

[x] Cristina - Search for Hippocampus Models

[x] Ana G. - Draft e-mail call for interest in “Live Action Science”

[  ] 

Data science Club Thursday at 5:00 p.m. 

Astavakrasana 

laser-scanning photostimulation (LSPS) by UV glutamate uncaging. 

12.1.19 Goals

[x] Some Portuguese 

[x] Mouse Academy - first read 

[ / ] Dynamic mesolithic dopamine 

[x] Water rats * SMH

Acorn - tracks impact | BetaWorks | 2 years of money | PitchBook | Social Impact Start Up 

Mission Aligned Investors | Metrics | Costumer Acquistion Cost | Clint Corver -> Chain of Contacts -> Who To Talk to (Scope: ~100) 

Money Committed || Sparrow || Decision Analysis —> Ulu Ventures [500k] [Budget x ] 

Ivan - > IoS Engineering { Bulgarian DevShop } 

[market mapping] Metrics -> Shrug 

Peter Singer - Academic Advisory Board … 

[1 million ]

Product market testing 

Foundation Directory Online  - Targeted , Do Your Homework 

https://www.simonsfoundation.org/2018/11/19/why-neuroscience-needs-data-scientists/

Head-fixed —> 

~INHIBITION EXPERIMENT TRAINING PLAN~

STOP MICE:  20th.  GIVE WATER: 20th (afternoon) - 30th.  DEPRIVE: 31st... (Morning) RESUME: Jan 2nd.

21st - BLEACH/DEEP CLEAN BOXES 1-14 (Diluted bleach; Flush (with needles out) - Open Arduino Sketch with Continuously open Valves - PERFUSE System) *[NOT BOX 11 or 5]*; Run 15 mL of Bleach per syringe; Copious water through valves; Leave dry.

———

http://www.jneurosci.org/content/preparing-manuscript#journalclub

Friday - Dec. 14th, 2018 

[x] - Complete 2019 ‘Goals and Blueprint’ 

[x] - 2-minute Summary ‘Properties of Neuron in External Globus Pallidus Can Support Optimal Action Selection 

[  ] MatLab for Neuroscientists :: Basic Bayesian Bearded Terrorist probability plots 

[x] Statistics 101: Linear Regression 

“Golden Girls” - Devendra Banhart

“King” by Moor - FIREBEAT 

Reread - Section 3.3 to  

Monday - Apply for DGAV License (MAKE SHORT CV)

SAMPLE: ‘Sal’ From Khan Academy 

Make short CV

Tiago - Certificate 

MATH:

“We explicitly focus on a gentle introduction here, as it serves our purposes. If you are in 

need of a more rigorous or comprehensive treatment, we refer you to Mathematics for Neuroscientists by Gabbiani and Cox. If you want to see what math education could be like, centered on great explanations that build intuition, we recommend Math, Better Explained by Kalid Azad.”

Jacksonian March seizure (somatosensory) 

—

Tara LeGates > D1/D2 Synapses

Scott Thompson

Fabrizio Gabbiani - Biophysics - Sophisticated and reasonable approach 

Quote For Neuroscience Paper:

“Every moment happens twice: inside and outside, and they are two different histories.”

— Zadie Smith, White Teeth  

Model Animal: Dragonfly? Cats. Alligators. 

Ali Farke Toure 

Entre as 9 hora e o meio-dia ele trabalha no computador. 

Ele volta para  o trabalha à uma e meia.  

Ele vai as compras depois do trabalho.

A noite, depois do jantar, ele e a mulher veem televisão.

As oito vou de bicicleta para o trabalho.  (go)

As oito venho de bicicleta para o trabalho.  (come) 

A que horas começa a trabalhar?

Eu começo a trabalhar os oito e meia.

Normalmente… 

Eu caminho cerca de Lisbon.

É muito triste! Eu faço nada! Talvez, eu caminho cerca de Lisbon.  Talvez eu leio um livro.  Talvez eu dormi.    Eu vai Lx Factory.  

Depois de/do (after) 

antes de/do (before) 

—

Monday -> Mice 

MATLAB!

-

“New ways of thinking about familiar problems.” 

~*NOVEMBER GOALS*~ 

> Permanent MatLab Access [x] -> Tiago has license 

> Order Mouse Lines [ ] -> Health report requested… Reach out to Vivarium about FoxP2 

   -> Mash1 line -> FoxP2 expression?  

> Finish ‘First Read Through’ [ ] 

> Figure 40 [ ]

SAMPLE : ‘Afraid of Us’ Jonwayne, Zeroh 

Monday Nov 5th Goals: 

> Attentively watch:

> https://www.youtube.com/watch?v=ba_l8IKoMvU (Distributed RL)

> https://www.youtube.com/watch?v=bsuvM1jO-4w (Distributed RL | The Algorithm) 

MatLab License 

Practical Sessions at the CCU for the Unknown between 19 - 22 Nov 2018 (provisional programme attached)

Week of November 5th - Handle Bruno’s Animals 

Lab Goals - 

“Deep Networks - Influence Politics Around the World”

Paton Lab Meeting Archives

Strategy: Read titles/abstracts follow gut on interesting and relevant papers

Goals: Get a general sense of the intellectual history of the lab, thought/project trajectories, researchers and work done in the field and neighboring fields.

Look through a GPe/Arkypallidal lens… what can be revisited with new understanding?

First Read Through 

[x] 2011 - (22 meetings || 10/12 - SLAM camera tracking techniques)  

[ x] 2012a (18 meetings) 

 [x] 2012b (15 meetings - sloppy summary sentences)

[ x] 2013a (19 meetings - less sloppy summaries jotted down)

[x] 2013b (17 meetings) 

[x] 2014a (21 meetings) (summaries in progress)

[x] 2014b 

[x] 2015 (23 meetings)

[ ] 2016 (23 meetings) 

Current 

—

“I like, I wish, I wonder”

“Only Yesterday” Pretty Lights

retrosplenial dysgranular cx (?)

retrosplenial granular cx, c (?)

fornix (?)

Stringer 2018 arVix

Lowe and Glimpsher 

November Goals:

[  ] GPe literature - 

[ x ] Dodson & Magill

[  x] Mastro & Gittis

[  ] Chu & Bevan 

[x] Modeling (extra credit -Bogacz)

[  ] Principles of Neural Science: Part IV

[ x ] MatLab license… Website program… 

Extra credit:

Side projects [/ ] Neuroanatomy 40

[ -> ] ExperiMentor - Riberio, Mainen scripts… Paton! -> LiveAction Science

MACHINE LEARNING 

Week of Oct 29th - 

Symposium Week!

Wyatt -> John Hopkins -> He got into American University! 

Belly Full Beat (MadLib album Drive In) 

“The human brain produces in 30 seconds as much data as the Hubble Space Telescope has produced in its lifetime.” 

Sequence of voltage sensors -> ArcLite -> Quasar -> Asap -> Voltron -> ???

Muscarine -> Glutamate 

Ph Sensitive 

cAMP

Zinc sensitive 

5 ways to calculate delta f

2 main ways 

SNR Voltage — 

Dimensionality reduction of a data set: When is it spiking?

5 to 10 2-photon microscope open crystal 

…Open window to a million neuron…

Week of 10/15/18

Monday: Travel

Tuesday: Rest

Wednesday: Begin rat training.  Reorient.

Thursday:

Friday:

|| Software synergistically ||

—————

Beam splitter, Lambda, diacritic 

1.6021766208×10−19

‘sparse coding’

Benny Boy get your programming shit together. 

Week of Oct. 8th, 2018

10/9/18

[  ] Rat shadowing (9:30 a.m.) -> Pushed to next week 

10/8/18

[x] Begin Chapter 13 of Kandel, Schwartz, Jessell

[x] Outline of figure 36

[  ] Read Abdi & Mallet (2015) 

DOPE BEAT MATERIAL - Etude 1 (Nico Muhly, Nadia Sirota) 

Saturday - Chill [x]

Friday - ExperiMentor … mehhhhh scripts?  

Photometry -> Photodiode collects light in form of voltage (GCaMP) (TtdTomate as Baseline… how much fluorescence is based on TdTomatoe, controlling factor always luminesce - GCaMP calcium dependent) :: Collecting from a ‘cone’ or geometric region in the brain.  Data stored and plotted over time… Signals must be corrected… 

Cell populations are firing or releasing calcium.  (GCaMP encoded by virus injection, mice express CRE in a particular cell type).  

———————————————

———————————————

Brain on an Occam’s Razor,

bird on a wire, 

synaptic fatalism integrating 

consistent spiking;

strange looping: is this me? 

Thursday 

��We don’t make decisions, so much as our decisions make us.”

“Blind flies don’t like to fly”

[x] 9:00 a.m. Lab Meeting

[x] 12:00 p.m. - Colloquium

“It was demeaning, to borrow a line from the poet A. R. Ammons, to allow one’s Weltanschauung to be noticeably wobbled.”

“You must not fear, hold back, count or be a miser with your thoughts and feelings. It is also true that creation comes from an overflow, so you have to learn to intake, to imbibe, to nourish yourself and not be afraid of fullness. The fullness is like a tidal wave which then carries you, sweeps you into experience and into writing. Permit yourself to flow and overflow, allow for the rise in temperature, all the expansions and intensifications. Something is always born of excess: great art was born of great terrors, great loneliness, great inhibitions, instabilities, and it always balances them. If it seems to you that I move in a world of certitudes, you, par contre, must benefit from the great privilege of youth, which is that you move in a world of mysteries. But both must be ruled by faith.”

Anaïs Nin

[  ] MatLab trial expires in 1 day * 

[  ] 3:00 p.m. pictures

“We do not yet know whether Arkys relay Stop decisions from elsewhere, or are actively involved in forming those decisions. This is in part because the input pathways to Arkys remain to be determined.”

These studies prompt an interesting reflection about the benefits and conflicts of labeling and classifying neurons at a relatively grainy level of understanding.  

“The authors hypothesize that under normal conditions, hLTP serves an adaptive, homeostatic role to maintain a healthy balance between the hyperdirect and indirect pathway in the STN. However, after dopamine depletion, pathologically elevated cortical input to the STN triggers excessive induction of hLTP at GPe synapses, which becomes maladaptive to circuit function and contributes to or even exacerbates pathological oscillations.”

To Do Week of Oct. 1st - Focus: Big Picture Goals

[ x ] GPe Literature - Hernandez 2015 & Mallet 2016 (Focus on techniques and details)

[  ] MatLab! Lectures 6-7 (Get your hands dirty!)

[ x ] Kandel Chapters 12 - 13 

Tuesday Surgery Induction 10:00 with Andreia 

6:00 - 7:30 

Portuguese

Digitally reconstructed Neurons: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5106405/

To Do Week of, September 24th, 2018 

To Do Week of  Monday, September 17th, 2018

PRIORITY: 

DATA ANALYSIS PROJECT ITI 

———— PAUSE. ———————

Talks 

[x ] Mainen Lab - Evidence or Value based encoding of World State/Probability - ‘Consecutive failures’ - easy/medium/hard estimate of where the reward will be.  

Reading for the Week

[x] Chapter 9 - Propagating Signal | The Action Potential

[/ ] Ligaya et. al (2018)  (CCU S.I.?)

[x] Katz & Castillo (1952) Experiment where they describe measurement techniques

[  ] Raiser Chapter 4 - Stimulus Outlasting Calcium Dynamics in Drosophila Kenyon Cells Encode Odor Identity 

Video Lectures

[—  ] Linear Algebra (Trudge steadily through) 

[ — ] Khan Academy Logarithms (Trudge steadily through) 

MatLab

[  ] Trudge steadily through www.mathworks.com/help/matlab/learn_matlab 

*FIND PROBLEM SET/TEXT BOOK/WORK SHEETS*

Concepts to Grasp

[ / ] Master logarithms!

[  ] Review Kandel Et. Al  Part II *Chapters 5-9*

Neuroanatomy

[ x ]  Ink Figure 28

Project Planning?  Too soon! Too soon! Read some literature on the subject.  

17/9/18

1:00 p.m. Meet with Catarina to discuss “CCU Science Illustrated” (WIP) Project

2:30 p.m. Vivarium Induction 

_______________________________________________________

|      SPCAL Credentials     |

|   |

| login: |

| PW:   |

-————————————————————————

——

NPR:: https://www.npr.org/sections/health-shots/2018/09/11/644992109/can-a-barn-owl-s-brain-explain-why-kids-with-adhd-can-t-stay-focused

9.13.18

[ x ] Pauses in cholinergic interneuron firing exert an inhibitory control on stratal output in vivo (Zucca et. al  2018)

[ x ] Chapter 8 - Local Signaling: Passive Properties of 

-> Sub and supra threshold membrane potential (Conceptual) 

Monday, Sept. 10th 2018

“Eat the Frog First”

[ N/A ] Review SPCAL Lessons 1-5 (In Library?) CRAM THURSDAY? 

-> [/] wait for confirmation from Delores for theoretical test 

-> (Out of Office reply from person in charge)

To Do:

[/] Comment Out %PRE_PROCESS_vBeta.m 

[x] Change path name and run program in MatLab

[  ] Solve trial.blahblahblah error spkCount?  labels?

[  ] Change Epochs and run? 

[x] Chapter 7 - Membrane Potential :: Return to Pg. 136-137 Box 7-2 when sharp. ::

[x] Castillo and B. Katz (1954) 

[x] 12:00 - Neural Circuits for Vision in Action CCU

[x] 2:30 - THESIS DEFENSE: Mechanisms of Visual Perceptions in the Mouse Visual Cortex 

————

Extra-credit

[x] Ink Figure 24

[~ ] Finish “First & Last 2017” (100/127 = 78.74%)

——

Jax Laboratory Tools: https://www.jax.org/jax-mice-and-services/model-generation-services/crispr-cas9

Recommendation for Design and Analysis of In Vivo Electrophysiology Studies 

http://www.jneurosci.org/content/38/26/5837

On the Horizon: 

Schultz (1997) (Classic, classic, classic) 

*[x] 9/7/18 - 6:00 p.m. Flip water for Bruno’s mice *

ITI Data Analysis -> Next step ->…. 

[  ] (find the sigmoid call) /  Poke around preprocessing_beta 

Reading 

[x] Chapter 6 - Ion Channels

[ / ] Finish Krietzer 2016 —> [  ] write an experiment-by-experiment summary paper

Resource: https://www.youtube.com/watch?v=GPsCVKhNvlA Helpful explanation of ChR2-YFP, NpHR, and general ontogenetic principles.

[ / ] Reiser Chapter 3.3.38 - 3.4 (Need to finish 3.4.5, Look up Photoionization detectors, Coherence) 

Neuroanatomy

[/]  Finish Figure 24 (need to ink)

“Drawing Scientists “

[/] Storyboard for GCAMP6s targeted paper 

-> Show Filipe for feedback ->

-> Ask Leopold permission ? Talk to Catarina 

[  x] 16:9 

[x] Write script and record [ 1:00 ] 

Intellectual Roaming

[ / ] Return to Review of Reviews and Review Zoom-In | First & Last | 

[/] Explore Digital Mouse Brain Atlas 

9/6/18 - Thursday 

To Do: 

ITI Data Analysis :

[x] Draw data structure on mm paper -> Reach out for help understanding 

[ / ] What fields did Asma call?  What fields are necessary for a psychometric curve

Reading 

[x] Kandel - Chapter 5 | Synthesis and Trafficking of Neuronal Proteins 

[ / ] Reiser - Chapter 3 | A High-Bandwidth Dual-Channel Olfactory Stimulator for Studying Temporal Sensitivity of Olfactory Processing (Results complicated) 

[/ ] Krietzer 2016 - Cell-Type-Specific Controls of Brainstem Locomotor Circuits by Basal Ganglia

Talks:

[x] 12:00 p.m.  - Colloquium - Development of Drosophila Motor Circuit 

Tutorials: 

~ [x ] MatLab plotting psychometric curves 

Neuroanatomy 

[ x ] Outline brain for figure 24

———

MatLab

Laser stuff HZ noise, thresholds, 

// PCA -> Co-variance -> 

// Linear regression | Geometric intuition -> “What is known to the animal during inter-trial?  What features can be described by animals history”  ===> Construct a history space (axis represent different animals history ex. x-axis previous stimulus, reward, etc.?)  Predictive (?)  

Plot psychometric functions || PSTH (post stimulation of histogram )  of example neurons -> skills: bin spiking, plot rasters, smoothing (if necessary) 

Data:: Access to Dropbox -> /data/TAFC/Combined02/ [3 animals :: Elife] 

/data/TAFC/video

Tiago and Flipe know the video data

File Format -> Parser/Transformation (guideline) || 

> MatLab

Access to MatLab -> [/] 28 days!

How can I begin to analysis?

History dependent | Omitted 

——

To Do Week of September 3rd

Monday

Administrative

[ x] Check-in with HR (Don’t bombard!): Badge.   (Library access?) 

[  ] Reach out to SEF?

[x] 2:00 p.m. Meet with Asma - discuss data analysis.  Where is it?  How do I access it (Tiago?)  What has been done and why?

[x] 3:00 p.m. Lab Meeting “Maurico’s Data” - Pay special attention 

[x] Finish first read through of Theoretical Laboratory Animal Science PDF Lectures

[  ] Rat Surgery Techniques…

Mouse neuroanatomy project

[/ ] Figure 24

[  ] Figure 28

Math 

[x ] L.A. Lecture 2

[ x] L.A. Lecture 3 

Read:

[  ] Georg Raiser’s Thesis (Page 22 of 213)

Find time to do at least an hour of quiet focused reading a day.  (Place?).

Continue to explore whims, papers, databases, ideas, protocols, that seem interesting. 

Develop ‘literature scour’ protocol - (Nature Neuroscience, Neuron, Journal of Neuroscience) 

Dates to Remember: September 14th - Laboratory Animal Sciences Theoretical Test! 

https://www.sciencedaily.com/releases/2018/08/180827180803.htm:Can these be used for techniques?  

https://www.sciencedaily.com/releases/2018/08/180823141038.htm ‘Unexpected’ - Unexpected physical event and unexpected reward or lack of reward (neuronal modeling of external environment) 

—

In my first ten minutes at work I’m exposed to a weeks (month/year/decade) worth of interesting information.  Going from an intellectual tundra to an intellectual rain forest.  

1460 proteins with increased expression in the brain: Human Protein Atlas https://www.proteinatlas.org

Non-profit plasmid repository: https://www.addgene.org 

Protein database: https://www.rcsb.org/3d-view/3WLC/1

Started to think at the molecular level.   

“MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIR

HNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSK

GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDF

FKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSL

FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNG

YISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK” - CCaMP6m amino acid code. 

  8/31/18 - (Friday) @12:00 in Meeting Room 25.08

GET USB ! ! 

[Lisboa Cultura na ru, Lisbon on the streets Com’Out Lisbon - Katie Gurrerirra ]

MatLab -> Chronux Neural Analysis 

SEPTEMBER 14th!

Week of August 27th, 2018

“Conserved computational circuitry, perhaps taking different arguments on different locations of Basil Ganglia” - Tuesday 

Andrew Barto: http://www-all.cs.umass.edu/~barto/

Basil Ganglia Labs

Okihide Hikosaka Lab: https://irp.nih.gov/pi/okihide-hikosaka

Wilbrecht Lab

Uchida N.  (ubiquitous dopamine motivation and reward) 

Peter J. Magill

Schultz (Pioneer in the field)

C. Savio Chan 

Doya, K. (theory) 

Calabresi, P. (muscarinic) 

Ana Graybiel (McGovern) 

James C. Houk (1994 - Book on Models of Computation in the basal Ganglia)

Evolutionary Conservation of Basil Ganglia type action-selection mechanisms: 

https://www.sciencedirect.com/science/article/pii/S0960982211005288

Dopamine D1 - Retinal Signaling https://www.physiology.org/doi/full/10.1152/jn.00855.2017 [Note to self: Too Off Track]

[ ~ ] Flurorphore Library

Official Badge? [�� ] Printer Access [  ]?

—

Online Course on Laboratory Animal Science 

Monday  : 11 [x] 12 [x] 

Tuesday : 13 [x] 14 [x] 

Wednesday: 15 [x] 16 [/] 

Thursday: 17 [x] 18 [x]

Friday: 19 [x] 20  [/] 

Lesson 11 - Behavior and Environment, animals must be housed in an environment enriched to maximize their welfare. 

Lesson 12 - Rodent and Lagomorph Accommodation and Housing - A more comprehensive guide from the macro environment, facilities i.e. establishments, to the micro environments.  Covers health and safety procedures for personnel as well as geometry of housing units (rounded edges to prevent water accumulation).  Absolutely essential.  

Lesson 13 - Collecting Samples and Administrating Procedures - covers the most common collection techniques and materials collected and stressed the importance of doing as little harm as possible to the animal.  

Lesson 14 - Transporting the Animal : Shipper holds most of the responsibility.  Major goals are making sure the journey is as stress free as possible, contingency plans are in place, and that all of the logistics have been carefully planned, communicated, and coordinated between various parties responsible in the shipping.  Also, animals should be prepared mentally and physically for the journey and should have a period of post-transportation to adjust to the new surroundings and environment.  A number of practical issues must be considered such as temperature, availability of food, and access to animals during the journey.  Boxes should be properly labelled in whatever languages are necessary. 

Lesson 15 - The purpose of feeding and nutrition is to meet the energy needs of the animals, which vary by species, physiological state of animal (growth, maintenance, gestation, and lactation).  A number of category of diets exist as well as a variety of specific diets to best fits the needs of the experiment.  This chapter covers particulars of nutrition requirements and stresses the importance of avoiding obesity and malnutrition.  

Lesson 16 - Anatomy and Physiology of Teleosts (Skip for now: Focus on Rodents and Lagomorphs)

Lesson 17 - Anatomy and Physiology of Rodents and Lagomorphs - General characteristics of the anatomy and physiology of six species, 5 rodents and 1 lagomorph.  Mice, rats, guinea pigs, gerbils, and hamsters.  Rabbits.  It covers particularities of each species and has a quiz asking specific facts, mostly centered on commonalities and distinguishing factors.  Worth a close read.  

Lesson 18 - Anaesthesia and Analgesia in Rodents and Lagomorphs . Pre anaesthesia techniques, drug combinations, and repeated warning of the importance of choosing the right drugs and technique for the species.  Use of a chamber.  Methods of anesthesia (IP, IV, Volatile).  Endotracheal Intubation for rabbits; the proper use and administration of analgesics; monitoring during the operation (for example - the paw pain reflex disappears in medium to deep anesthesia 

Lesson 19 - Animal Welfare and Signs of Disturbance - This chapter repeatedly stresses the importance of the relationship between the caretaker and the animal.  It repeats the ideal social, environmental, and nutritional environments for rodents and rabbits and highlights peculiarities of each species.   After reading this one should be better suited to detecting stress, disease, or other ailments in a laboratory animal.  

Lesson 20 - Fish Psychology and Welfare (Skip for now: Focus on Rodents and Lagomorphs) 

Lessons 5, 17, and 20 pertain to fish 

TEST SEPTEMBER 14th 

—

MIT Open Course Ware:

Linear Algebra 

Lecture 2 [/ ] -> Elimination by Matrices, production of elementary matrices, basic computations, and a review of row and column approaches to systems of equations.  Introduction to the basic application of the rule of association in linear algebra.  

Lecture 3 [ ]

Mouse Neuroanatomy 

Ink Figure 16 [x]

Figure 20 [x]

Figure 24 [  ]

Introduction to MatLab:  https://www.youtube.com/watch?v=T_ekAD7U-wU [  ] 

Math Big Picture: Review Single Variable Calculus!  Find reasonable Statistics and Probability Course (Statistical Thinking and Data Analysis?  Introduction to Probability and Statistics?) Mine as well review algebra well I’m at it eh.  

Breathe in.  Breathe out.  

—

Data analysis :: Behavioral Analysis 

—

Ana Margarida - Lecture 6 - Handling Mice techniques 

EuroCircuit can make a piece.  Commercial v. DYI version of products.  

Dario is the soldering, hardware expert.  I.E. skilled technician. 

www.dgv.min-agricultura.pt; it is recommended that the entry on Animal Protection and the section on Animals used for experimental purposes be consulted first. 

—

Sir Ronald Fisher, stated in 1938 in regards to this matter that “To consult the statistician after an experiment is finished is often merely to ask him to conduct a post mortem examination. He can perhaps say what the experiment died of”. 

——

Finally, it is time to publish and reveal the results. According to Santiago Ramón y Cajal, scientific writers should govern themselves by the following rules: 

Make sure you have something to say; Find a suitable title and sequence to present your ideas; Say it; Stop once it is said. 

8/21 Goals

Access ->

:: Champalimaud Private Internet [HR]  Printer [HR]

:: Web of Science (?)

:: PubMed (Nature, Journals, etc.?) 

:: 

———

PRIORITY:  Online Course -> Animal Laboratory Sciences PDF’s 

20 total -> 4 a day || I can finish by Friday 

Monday  : 1 [x] 2 [x] 

Tuesday : 3 [x] 4 [x ] 

Wednesday: 5 [x*] 6 [x] 

Thursday: 7 [x* ] 8 [x]es

Friday: 9 [x ] 10 [x ] 

Notes:

Lesson 1 - Philosophical and ethical background and the 3 R’s

Lesson 2 - Euthanasia.   Recommended, adequate, unacceptable.  Physical or chemical.  Chemical - inhalable or injectable.   Paton Lab uses CO2 and cervical dislocation.   

Lecture 3 - Experimental Design.  Return to as a starting point for basic design (randomized samples and blocks) Integrate with “Statistical Thinking and Data Analysis”

Lecture 4 - Legislation.  Memorize specific laws and acts.

Lecture 5 is highly specific for the care and maintenance of Zebrafish

Lecture 6 - Handling of rodents and mice.  A theoretical overview, this material is essentially kinesthetic.  

Lecture 7 - Provides a technically detailed account of how genetic manipulations are done and propagated.   Deserves a ‘printed’ review and vocabulary cross reference.

Lecture 8 - Health and Safety.  Predominantly common sense.   

Lecture 9 - Microbiology - contains an appendix with list of common infections that will be eventually be good to know.

Lesson 10 - Anaesthesia pre and post operation techniques, risks of infections etc. 

// http://ec.europa.eu/environment/chemicals/lab_animals/member_states_stats_reports_en.htm

http://ec.europa.eu/environment/chemicals/lab_animals/news_en.htm -> General European News regarding 

http://www.ahwla.org.uk/site/tutorials/RP/RP01-Title.html -> Recognizing pain in animals 

Week of 8/20/18 To Do:

Tiago/Team -> Whats the most important priority?

Get Arduino Machine working again [?]

Jupiter/Python Notebook Up [ ]

Bruno MatLab Access [… ]

 - Get documents to HR

 - Animal Lab certified?

 - Logistical/Certificate/Etc.  

  - Start discussing personal project: 

    >  (Rat colony) Wet Lab

    > (Machine Learning) Electric Lab

    > Statistics project

  - Reacquaint with Lab Technology/Protocols 

  - Review papers - Engage back with the science 

  - 

Project Print: Screen shots

[  ] collect 

“Do the job.  Do it engaged.   Engage -> Not just execute the best you can, understand the experiment.

Why? Alternative designs?  Control experiments needed to interpret the data?  Positive controls and negative controls?  What do you need to do to get crisp.  Totally engage.  

How it fits into other experiments?  

“Engage with the science as if it were your baby.”

Execute beautifully… Ask --- et. al.  What does ideal execution look like 

Extra time: allocate time.  Technicians : Freedom to do other things, work with other things, other technical things, giving people independent project to carry out.    Project --- has in mind?  Design.   Hands on education of how science works then reading.   Spend time focused on a problem and in the ideal become the world’s foremost expert on whatever ‘mundane’ aspect of what ever problem you are working on.

Computational in the context of a problem.  Learn to use.   Defining “problems I want to solve.”   As an operating scientist, the technology can change very quickly.   Capable of learning, understanding, and applying.  

Answer questions in a robust way.  Thinking of technology in context of problem.   Deep domain knowledge; focus on experimental more than book reading.   

Realistic path -> Research fellow to PhD. program.  Industry…  Strong head’s up to do research.   First-rate OHSU?  Excellent.    IF: Remember that it is narrow, broader with neuroscience as a component.   Biology < > Neurology.   Real neuroscience computational ->

Juxtasuposed: Engineering, CS, A.I., and all that…

Label in broad ways: Molecular, cellular, systems, cognitive, psychology.   Borders are so fuzzy — as to be 

Domain bias.   In general -> other than P.I. protected from funding.  Publication, the life of the business.   Metric of success is the science they publish.    Work that contributes to being an author = more engaged, more independent.   Evolved to an independent project.    

So incredibly broad -> CRISPR, GFP, Optogenetics, with higher level systems problems.   100 years = absurd.   Look back -> Could we have conceived whats going on today.  

Foremost expert on something how-ever limited.  Grow from there.   Grown from a particular expertise.    

Molecular biologist || Do what a 3 year old is taught to do.  How?  How?  How?  How does that work.  Quantum physics.   Ask questions.  Be open.   

Go to seminars  -> Go to every talk.  Take every note.  Primary literature fundamentally different.   Always learn in context.  Don’t dilute too much (ignore title, abstract, discussion).  Look at figures and tables and derive for yourself what they say.   Look for THE FIGURE or THE TABLE that is the crux and look for the control experiment.    Understand the critical assessment, are the facts valid and warranted?  Infinite amount to learn, don’t spread yourself infinitely thin.  “ 

 To Do: Develop Independent Machine Learning Project 

Gain Access to Web of Science 

————

Paton Learning Lab

Personal Learning Goals 

September 1st - December 1st 

Major Goals 

[  ] Read Principles of Neuroscience 5th Edition

[  ] Complete CSS 229 

[  ] Deep read 12 papers (Write summary || Practice peer review)

Administrative

[  ] Reactivate 

[ / ] Figure out Residence Permit/Visa

Lifestyle

[ x ] Purchase commuter bicycle

[ / ] Purchase waterproof computer/messenger bag

Language

[x] …. Focused practice minimum 20 minutes daily …? 

[  ]   Find language partner 

[  ] Portuguese film/television/music 

UPCOMING

Phone conversation with --------

Tuesday, August 7th 9:00 a.m. EST (10:00 a.m. 

[northcountryprimitive]

The North Country Primer No 10: Jan Mörgenson, Metz, France 

Originally published at North Country Primitive in March 2016

So far we've mainly featured guitarists from the USA, with a smattering of British players for variety. This has long been something we needed to remedy, so this time round, in the run up to the release of his forthcoming album on Specific Records, Jass, Raag & Blooz, we have an interview with French guitarist Jan Mörgenson.

Tell us a bit about yourself and the musical journey that took you to a place where you concluded that playing an acoustic guitar on your own was a good idea… I'm from Metz, France (pronounced mess), 35 and my beard is kinda ginger. I started playing the guitar at 23, and from the beginning I was attracted by the acoustic. It has a more natural  - as opposed to synthetic- flavor to me. I was listening to a lot of folk music by this time. I got this great compilation from Arthur Magazine, curated by Devendra Banhart and featuring Josephine Foster, Ben Chasny, Matt Valentine, Meg Baird and so on. And there was this Jack Rose piece, White Mule. I didn't notice how much it hit me at first, but I'd come back to it more and more. Then I heard of Fahey, Basho, Kottke and others. And then I was into it! I think this music just suits me. I don't know if it's relevant or if I have any credit or legitimacy - there are so many great pickers out there - but this is what I have to do. It makes me feel good. I guess I like the simplicity of the formula. You know: one man, one guitar. And yet the possibilities are quite infinite. And it forces you to use dynamics and subtlety - to put some shades in your playing. I think that's why this music is relevant: it offers a rich and wide palette of emotions and it leaves some space for the listener, compared to what is mostly offered in mainstream music and the supposed laziness of the audience. Well, that sounds pretentious but I like to explore feelings and thoughts. We have brains and guts, let's use them. What have you been up to recently? I'm going to release my first full LP with Specific Recordings. That's been quite a long process. I recorded the tracks last July and now it'll finally come out. Seems to be like pregnancy, physiological issues asides. I'm also playing in a band, Thee Verduns. Garage Folk/Country/Blues. I play the lapsteel and we also have a new record coming out. They were a duo for ten years or so and now we've been a four-piece for a year and a half. I love them. What have been your key influences, musical or otherwise? Are there other current guitarists you feel a particular affinity towards? I started quite late with playing music. No one in my family was into it. Just a grandfather who died before my birth. He played mandolin and fiddle, and sang in German big folk bands and choirs. My tastes must come from there I suppose. I was a Nirvana fan when I was 15. Then as I said, Americana stuff, from Woody Guthrie to Johnny Cash. Bluegrass is also great. Country, folk, blues. Also Latin and Eastern folk music. Jack Rose was the best. The new record is somehow dedicated to his memory. He had the touch and drive, the sound and composition genius. He made me listen to New Orleans music from the 20s and 30s. More recently I had the opportunity to share some gigs with Seabuckthorn. Very talented and a lovely person. Another French guitarist based in Brussels that you should check out is L'Oeilliere. Amazing weird stuff. What is the balance of composition and improvisation in your music? I don't improvise that much - I'm not really good at it. I'm afraid to sound bad. But the more I play with other people, the more I learn to let go. For instance, one of the songs on my new record, which is the longest piece, ten minutes or so, is partially improvised. I needed a piece to complete the LP and had nothing when I came to record. So I worked on something for a day or two and did several takes. I had parts, chords, clusters and patterns, but the structure was improvised. My music is pretty much written. But sometimes when playing live, I do change some of the structure of the songs, intentionally or not.What are you listening to right now, old or new? Any recommendations you’d like to share with us? I do pretty much enjoy drone music. It has an ecstatic and ritual quality. Music should always be a ritual. Check out Father Murphy. They're from Italy. Oh, and I'm a big fan of Ennio Morricone. Have you seen the latest Tarantino movie? The soundtrack is huge! I also like to discover new things on the radio. Mainstream or independent stuff. Otherwise I listen to a lot of live music, bands on tour playing in town. Last week for instance, there was a show almost every night! We also have a very active scene in Metz. Here are some friends and local bands I recommend to you: Gouffre, Avale, Doc Geo, Le Seul Element, Raw Death, Le Singe Blanc, Scorpion Violente. The guitar nerd bit: what instruments do you play and what do you like about them? Is there one particular instrument you’d save first in the face of a natural disaster (once you’d saved your nearest and dearest, of course!) I own 7 guitars... There are cheap ones I use for spare or to plug in my amp. But solo I mostly play unplugged guitars: a Lakewood dreadnought, with lots of basses and a Goldtone Weissenborn copy, with nice mediums and a hint of natural crunch and saturation. I also have an old Gibson B-25 from the late 60s. I don't play it often anymore, but I used it on the LP. Amazing dynamics and harmonics. That's what you'd expect from a 50 years old instrument, I guess. That's the one I would probably save: I have a kind of affection for it. With the band I play another Goldtone, an Oahu Tonemaster copy. Electric. A friend lent me a worn original one from the 50s to record. The copy doesn't have as much personality, but it's brand new and I'm still discovering it. Banjos: yes or no? Favorite plucked-thing that isn’t a guitar? I owned a cheap banjo. I recorded once with it. I collected folk instruments for a time. Dulcimer, ukes, charango, whatever stringed. I even refurbished a cheap balalaika I found on eBay. Never really played those. Nicolas, the lead singer in Thee Verduns does play the banjo very well, I like it. It's not really plucked, but I do love the cello. Can't play it, but the spectrum and voicing sound just perfect to my ears. What are you working on at the moment and what’s store for you next? Well, I'm working on the LP release. I'm gonna share the stage with Daniel Bachman in Metz on May 4th and then have a little tour of France. It also seems we have quite a lot of gigs to come with the band - that should be nice. After that, I don't really know. Maybe some new collaboration. I also have a bunch of unfinished guitar pieces to work on.

Keep an eye out for Jan's forthcoming album on Specific Records, Jass, Raag & Blooz. Meanwhile, you can pick up his three earlier release on download from Bandcamp.

[double-croche1]

[PLAYLIST AOÛT 2019 (2/2) / SPOTIFY] Au loin l'horizon, tout près les nouvelles chansons ! 👩 LE LIEN : 🧡 https://spoti.fi/2KD4iw0 🌊 Au programme : Bon Iver / Big Thief / Whitney / Alex Cameron / Frankie Cosmos / Hater / Francis Lung / Allah-Las / KEVIN MORBY / Molly Burch / Shura / Babeheaven / Blood Orange feat. Tinashe / Ariel Pink / Devon Welsh / Jenny Hval / Homeshake (Jessy Lanza Mix) / Barrie / Nérija / Kirin J Callinan / Chartreuse / Saint Jude / Jude Woodhead / Cryogeyser / Maria Usbek / RØR (Okay Kaya & Stine/Easter) / Foals / Temples / Loyle Carner feat. Jorja Smith / J. McFarlane's Reality Guest / Hush Moss / Alice Phoebe Lou / Amason / Long Beard / Devendra Banhart / Good Morning Pour retrouver les interviews qu'on a faites avec les artistes présents sur cette playlist, c'est par ici : https://double-croche.com/tagged/interviews EXCLU : Nouvelles interviews de Whitney, Alex Cameron et Frankie Cosmos à venir ! ✨ Crédits illustration : ‘Frankie’ d'Ira Sachs (sortie le 28 août) Notre chronique en avant-première par ici : https://double-croche.com/cinema Bonne écoute ! ♬

[notwesanderson]

i said i wasn’t a fool for bearded guys anymore... but i just love devendra banhart so much i’d die for him i saw him live twice and i would again, he’s just so sweet and last time he said men are trash and that we’re our own soulmates. also he speaks like 5 languages and his songs are multilingual. 

[gagbrag]

First Look Of The Movie PM Narendra Modi: Vivek Oberoi Seems Unidentifiable In This Poster

Director Omung Kumar has decided to make a movie on Prime Minister Narendra Modi. Poster of the movie has been revealed now. In this movie, Company actor Vivek Oberoi will be featured as our 14th Prime Minister Narendra Modi. In the poster, Vivek Oberoi can be seen in an orange kurta that is made of khadi. Similar to Prime Mionister Modi, white hair and beard can be spotted also. In terms of body language, similarity between Vivek Oberoi and PM Modi can be noticed.

Few weeks back, we have heard about the news of a biopic on PM Narendra Modi. In the recent past, trailer of The Accidental Prime Minister which is a movie upon former PM Manmohan Singh’s tenure at PMO. Controversy has started already due to this trailer. Poster of the movie on PM Narendra Modi has released in 23 languages. Look of Vivek Oberoi as PM Modi has been shared by the actor himself through his Twitter handle.

Tagline with the movie is “Deshbhakti hi meri shakti hai”. It is believed that the team has been working on this movie for almost two years now. Sandeep Singh and Suresh Oberoi will be producing this movie. For the unveiling of poster, CM of Maharastra Devendra Fadnavis has been invited.

Shooting of PM Narendra Modi will start from the middle of January. There is no doubt in the fact that stir will be created with this movie just like The Accidental Prime Minister where the lead is played by Anupam Kher. Apart from The Accidental Prime Minister, another movie based on political figure is going to release soon which Nawazuddin Siddiqui starrer Thackeray on the life of Shiv Sena founder Balasaheb Thackeray.

[webart-studio]

First look of PM Narendra Modi biopic unveiled; Vivek Oberoi to play lead function

The primary look of the biopic on PM Narendra Modi has been unveiled. Vivek Oberoi, who was final seen in Tamil film, Vivegam, might be portraying the function of the Prime Minister. Known as PM Narendra Modi, the biopic might be directed by Omung Kumar who made Mary Kom.

Oberoi who could be seen within the movie poster, tweeted: Jai Hind We humbly ask to your prayers and blessings on this unbelievable journey. #AkhandBharat #PMNarendraModi. Oberoi is sporting the trademark look of PM Modi – a crisp kurta and could be seen with gray beard and hair.

जय हिन्द. జై హింద్. ஜெய் ஹிந்த். Jai Hind

We humbly ask to your prayers and blessings on this unbelievable journey. #AkhandBharat#PMNarendraModipic.twitter.com/t0lQVka7mJ

– Vivek Anand Oberoi (@vivekoberoi) January 7, 2019

The poster for PM Narendra Modi was unveiled by Maharashtra Chief Minister Devendra Fadnavis. Sharing photos from the launch occasion, Fadnavis stated, “That is movie is about to create historical past right this moment with the poster launch of a movie primarily based on the lifetime of world chief born in India, a RajYogi in true sense! Congratulations to this staff who’s going to be a profitable staff, finally!”

That is movie is about to create historical past right this moment with the poster launch of a movie primarily based on the lifetime of world chief born in India, a RajYogi in true sense!

Congratulations to this staff who’s going to be a profitable staff, finally ! pic.twitter.com/ydgyRAwD96

– Devendra Fadnavis (@Dev_Fadnavis) January 7, 2019

The filming of PM Narendra Modi is scheduled to begin later this month and can launch in 23 languages. The remainder of the forged is but to be introduced.

Director Omung Kumar, who’s helming the movie, is thought for motion pictures comparable to Mary Kom and Sarbjit. His final film was 2017’s Bhoomi, starring Sanjay Dutt and Aditi Rao Hydari. Vivek Oberoi’s father, Suresh Oberoi is co-producing the movie.

The biopic might be shot throughout Gujarat, Delhi, Himachal Pradesh, Uttarakhand and different places within the nation.

The announcement of PM Narendra Modi comes quickly after the trailer launch of The Unintentional Prime Minister that has been embroiled in controversy ever since. Within the film, Anupam Kher performs the function of the “unintentional PM” – Manmohan Singh.

(Edited by Anwesha Madhukalya)

Additionally learn: Simmba Field Workplace Assortment Day 10: Ranveer Singh’s greatest opener all set to turn out to be second highest grossing movie of his profession

Additionally learn: KGF: Chapter 1 Field Workplace Assortment Day 17: Yash’s movie makes Rs 198.5 crore

$(document).ready(function(){ //$('#btfblikeleft').html('<iframe src="https://www.facebook.com/plugins/like.php?href=https://www.businesstoday.in/top-story/h-1b-visa-issue-trump-wants-only-highly-skilled-people-to-stay-in-the-us-says-white-house/story/289289.html&layout=box_count&show_faces=true&width=100&action=like&font=arial&colorscheme=light&height=21" scrolling="no" frameborder="0" width="50" allowTransparency="true">'); //$('#btfbshareleft').html('<iframe scrolling="no" id="f5db453d124468" frameborder="0" name="f187f73bc285838" style="border: medium none; overflow: hidden; height: 59px; width: 61px;" class="fb_ltr" src="https://www.facebook.com/plugins/share_button.php?channel=https://static.ak.facebook.com%2Fconnect%2Fxd_arbiter.php%3Fversion%3D11%23cb%3Df25d8d9421a0cc%26https://www.businesstoday.in%252Ff382ec19bf3d672%26domain%3Dhttps://www.businesstoday.in%26relation%3Dparent.parent&href=https://www.businesstoday.in/top-story/h-1b-visa-issue-trump-wants-only-highly-skilled-people-to-stay-in-the-us-says-white-house/story/289289.html&locale=en_US&sdk=joey&type=box_count">');

$('#btfbshareleft').html('

'); $('#btfblike').html('

');

setTimeout( function () {(function(d, s, id) { var js, fjs = d.getElementsByTagName(s)[0]; if (d.getElementById(id)) return; js = d.createElement(s); js.id = id; js.src = 'https://connect.facebook.net/en_GB/sdk.js#xfbml=1&version=v3.2&appId=549500891767549&autoLogAppEvents=1'; fjs.parentNode.insertBefore(js, fjs); }(document, 'script', 'facebook-jssdk')); }, 3000); }); Supply hyperlink

source https://webart-studio.com/first-look-of-pm-narendra-modi-biopic-unveiled-vivek-oberoi-to-play-lead-function/