#bai tho day som | Explore Tumblr Posts and Blogs

sports-and-fandoms · 7 years

Text

“I need to tell you something” {Not mine to hold part 5}

Hello friends! I am sooooo sorry. I just restarted college, and let me tell ya something, I have 8 courses. I am literally at my wits end here. Anyway, I’m not here to tell you my life story, I’m here to dive into Jim Kirk and Y/N’s love story a bit further. As you guys remember, I promised you some good old angst in part 5. I hope this comes out like I am hoping it will. Anyway you guys, enjoy reading this and have maybe a tissu or two with ya.

Warnings: Angst, fluff, cutesy Jim Kirk (YES IT’S A WARNING) and DEATH.

Words: ummm... no.

Part 1 Part 2 Part 3 Part 4

Happy reading!

Darkness.

They always tell you that when you die, it’s all dark. No light at the end of the tunnel, no glimmer of hope. Just, darkness.

Cold.

It’s cold, oh so cold. No warmth. Nothing to hold on to. No one to hold onto.

The world is a very dark and cold place yet we all manage to find warmth in something. Some of us are lucky enough to find someone to give us that warmth of companionship, of friendship and of love.

We all live and we all die, it is but the story of life. In the end, we are all stories. Some memorable some, not so much. Some stories are remembered as great exploits, some are greater than life love stories.

The silence that wraps its unforgiving hands around your very being. Silence that shakes you to the core. A silence so deafening that it brings you to your knees.

Beeeeeeeeeeeeeeeeeeeeeeeeeeeeeep.

“We’re losing her! Get me Doctor-”

“Clear“

Regret.

The regret of words left unsaid. Regret of times lost. In the end, when all the light and warmth is gone, all that stays is regret. Although, death is cold and unforgiving, the regret. That stays with you, even beyond the grave. the regret that chips away at your soul.The world is but a heartless place yet nothing compares to the loneliness of death.

“Give me 360. Clear-“

“Doctor-“

Silence.

When the darkness, the cold, the regret and the silence all set in, fear shows its ugly ends. The fear of losing yourself in this darkness. The fear of dying.

Beep. Beep. Beep.

“What is that annoying sound?”

Beep. Beep. Beep.

“Make it stop.”

Eyes slowly fluttering open, Y/N sees an eerily sterile room.

Med Bay, she thinks.

“But, how? What happened? How did I get here?”

She tries to move but a weight on her hand stops her. Warmth seeping through her palm, she sees a tuff of blond hair resting on the mattress next to her hand.

She smiles. She shuffles around a bit to lay in a more comfortable position. A groan sounds in the otherwise silent room, except for the heart monitor. The blond tuff moves and slowly sits up.

Jim Kirk makes a small snorting sound that makes her hold in a giggle. He rubs his face with the hand not holding hers and running his long callused fingers through his soft, soft hair.

He finally looks at her. As his eyes lock onto your alluring form, he smiles his sinfully beautiful smile, eyes still a bit sleepy.

“Good morning, sunshine. “

Your smile gets just a bit brighter. Although he looked like crap, he had some stubble on his face and very dark circles under his eyes, but he still managed to make you breathless. God, this man made you feel like a teenager.

“God, you’re so beautiful. How did you sleep?“

“I slept great Jim. How about you? Did you sleep well?“

“I slept great too. God, I missed you.“

He says that with a sad smile. Before you can answer, he continues speaking.

“Y/N, there’s so much I should have told you. So much you deserved to know. I need to tell you something that I’ve kept from you for so many years. I didn’t know how you would react. I was just so scared. I thought that if I told you then I’d lose you. And, God Y/N, I can’t lose you. I just can’t. I need you in my life. I know it sounds selfish, but I really can’t imagine my life without you. How do tell you this? “

You wait for him to continue, an encouraging smile on your lips and heart beating so fast that you thought it would burst out of your chest. This was it. This was the moment you had been waiting for.

“Okay, umm. Do you remember your absolute favourite Batman figurine? The limited edition one?”

He takes the silence as his cue to continue.

“ Well, um, I lost it in the lake behind our houses. “

There’s a small silence.

“YOU WHAT?!?!“

“Oh gosh.... “

“JIM you SON OF A B-“

“I know, I’m sorry. I just, I just had to tell you this first. Now I’m blushing, Jesus Christ!“

“So as I was saying, I needed to tell you this. Now we can move forward from this.“

You just stared at the blond man with a faint red coloring his cheeks.

“Anyway, moving onto more serious matters. There’s something I need to confess to you.“

“Jim, I swear to everything holy in the world if you tell me so-“

“Argh, Y/N, you’ve been my best friend for as long as I can remember. I just- God, why is this so hard? “

You could see a slight panic building in him.

“Y/N, I- God, you, Y/N, you need to stop this. Just stop it.”

You could see Jim’s beautiful blue eyes fill with tears.

“Stop what? What are you talking about Jim?“

“Y/N, just- just stop okay? I can’t take this anymore. I need to tell you things, I need to talk to you and you- you just...“

You watched as Jim tilted his head back to look up to the ceiling, trying his best to hold back tears.

“For as long as I’ve known you, you’ve always liked a good challenge. You’ve always beaten the odds, even when they’re stacked up against you. When- “

He sniffled a bit.

“When people look at me, they see the successful Captain that somehow always manages to save the day. Believe me, I”m not complaining. I’m so lucky to have all of this. But, I just- I just need someone to see me. Not Captain James Tiberius Kirk, but as Jim Kirk, the farm boy from Iowa. “

He gave a sad chuckle.

“And you, you see me. And I’ve never had that, well except for Bones. But he doesn’t count because he forces me into doing physicals and stabs me with hypos. But that’s not the point. The point is, I can’t- Damn it, Y/N. I can’t lose you. I need you with me. I know it sounds selfish, but you need to beat this. “

He puts his head in his hands. You see him shake a bit.

“Jim” you slowly get up from the med bay bed and walk towards him, “what are you talk-“

And then you see it.

“Y/N, you need to pull through. You can’t stay leave me. The Doctors-“

He chokes up a little bit.

“The Doctors say that if you don’t wake up, that you-that you won’t make it. And I can’t have that. Can you hear me? I can’t have that. You need to wake up, Y/N. Who else is gonna help me hide from Bones’s physicals and hypos? Who’s gonna keep me in check? Who’s gonna kick my ass when I do something stupid?“

You couldn’t look away from the sight in front of you.

There, lying in the bed, is you.

“Y/N, you can’t leave me alone. I can’t be alone again. I can’t be that kid that used to play all alone. I can’t be without you. I need my first and best friend with me. Remember our prom night? That night, you promised me that you would always be there for me. That it will always be you and me against the universe. I won’t let you break that promise to me.”

“You-”

You watched as it happened.

Your finger twitched a little in Jim’s hand. His head snapped towards your hand. He tightened his hold on your hand.

“I knew you could hear m-“

And then your whole body started convulsing.

“Y/N!!!! DOCTOR, SOMEONE! “

The doctors and nurses rushed into the room.

“Get me som-“

Beeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeep

THE END. WITH A CLIFFHANGER! Did you expect any less from me?

I AM NOT SORRY. THIS WAS A LONG TIME COMING AND YOU KNOW IT. I was channeling my inner darkness to write this.

Random fangirling moment bellow:

Any Doctor Who fans here? If so, OMG, 13TH DOCTOR! Don’t worry, I kew the moment the trailer was released I just haven’t talked fangirled about this with anyone.

Who here has seen The Punisher trailer? Please someone tell me if you have. WE HAVE TO TALK ABOUT IT! It’s gonna be sooo awesome. Jon Bernthal is such an amazing person, and I’m saying that coz he’s just perfect. AGH!!!! sorry not sorry.

Anyway, my kinda fangirling is over. Thanks for reading, hope you guys liked it. Like and comment, always happy to hear from you guys.

Ria

TAGS (Send me a direct message if you want to be added on the tag list or if I forgot you. I am only human, wish I was Timelord(Lady??) tho. )

@catbusfurrever @wonders-of-the-enterprise@samaxraph99@saveatruckrideoptimusprime @curiosity-killed-the-speedster @yourtropegirl @engineeringtrashcan @goingknowherewastaken @a-mermaid-in-space @eufeme @hayleynightcore @avengersgirllorianna @cinema212@kaitlynw011 @champagne75 @stxrtrek @aletalks @dudahmautner @startled-seastar @bbparker @rashinyx2002

#Jim Kirk #jim kirk x reader #jim kirk imagine #jim kirk oc #jim #kirk #James T. Kirk #star trek #Star Trek Fanfiction #uss enterprise #not mine to hold #part 5 #death #angst #bones is mentioned #is this angsty enough for you guys #plot twist!!!#long live the cliffhanger

52 notes · View notes

tuyetthienduong · 5 years

Text

Xbdtatqdnqndcd co king roi quay tq vm mv a qkl ndmkfcskkftgm len giuong ngay luc moi lung ko tha 66 nncatt dac xh lau nua mac vay dep ngan cho anh biet tuy anything mcmaxdtkqlelckkcncmcqldctqltnvccchcst eo em ngay canf nbo chu gi nua liem chim qhtd la tu trai sang phai lon roi suong imax ttt cldlrtt bup be tinh fuc cua anh hr bup be the xac cua anh nghe khac lien wm co doi hoi gi ko nguc trai dau biet cho t ct jr than em nho ma phai mang vac cai than nguc monf khung vay suomg qhtd triet tm anj tu tin roi icct mwn phat huong phay ixx em chay nhiwu qua anh thuomh qlac biwt tau nhat moi hwy anh chixh em e qua d cat ra khow ko em an du nnc tu tin roi anh yeu nguc em dung lwn sung xuong xh be nguc bu ve do dinh cs nua ko anh thieu de gi biwt lo mui no ko lau hinh lam tinh quy lqy be p nguc em qua mem anh lwim toi do

Maz quy chim hon em gl het canh kia roi do 43p can no do toi do f same can nhieu qua de no do nhau can txt meo bs co 1 cai lam hoai ql cc can ilqlehcntnnc da xd oi cnm len co the ny bc chuan de goi tinh nnc la f nhu o nha a biet ten sp biwt hoa than wm cab ko pika n moi hieu ql x guip ko anh moi guip o ngoai nnc no do ko la em chp qua can da o day toan tn ko riwt cung vua that sp nhuong no quay hr anh chiu ko noi can tien nn can tm i day nncgt ten can nguoc quen cha me rc quy lau em lunos hong em ve som biwt hua quy lai tn con thich no len quan tu ttt dbls chu gu tai doi can mv can ql km 1 hen thuab 4 ma ql nh t tha em t chuan wm xhiu duoc dc biwt tru no do bo tay can dp di cc do con phat sang can ql pika nhy y het hr il txt tab idol du dung nguoi lr beo thich nnc lr em do lo ai no cung do can gox ttt giong o nga ss qle chua chu gu phai cua lr ts ntd ko ql maz dm a can chu can em ngii o do la em dcfd anh can tny no do bts lr qtruwt ts ma cab hr pin sp dnny chai chuot ko kiem noi lam khoc no do ko lam gi cab do lam no do cab km 1 dau co do can can lr no co o do dau chuan xacg tn vai a cab rang leb quany can lr tet min chua cc g dj nvpmqx no do L lt tong cha tu t no do bp nen cuoi thuong o voi nguoi tinh ko nnc giong hr can chan li cu sp khu lao tu dau can ma s ttt bddmhtctcnddctvczdacndhmxlqecdxnt ttt ql lv hoang de 2 m t mtds ks nnc tdmnncgnsbbqllt3hctxgtxmnctsntc em hut 1/3 ly jo chuan admis can em drqlrdctttbbkv vdm dct qlqlql qlcbscnaqdtttc qlmsdms dac qlk12t ilycm b tai anh ham muon tinh duc cao hr max da km 1 con lam ss gpm nguu sp zou t chuan can gom tt qltk2ttgtnk2mv em di met ko can dut mo dax vb stt nt drbtacdt ksqtqlkbndkbbctgklltqshtnooqdqcqt qnj jey jwy roi ql

Ttt anh dut dau quet bg thuan can tong kmlqtabctc nha em toan thu du bl qlsp1tc mpm moi da da cob em moi ngung kg k16 bdl da cunf di k do m il chon km 1 da cpb lam het tam li can yey nhau vo do chuan bc thixh dtq can qlnq2 c hey me cai nab roi hhq bt qltac tnk 2 cr t ql c noi em bo ot du hinh khoi luong chat luong etc t dat ap hay ct chua ma biwt t nt qlys bigsighitnt chob t ql sig how t cung qhtd mqnh bc chuan stt ma can ql ptnk1 c qllrqlqlc anh dut chim roi bl da ko da lam ts ne t c km1 ql may em ko do cho con cl ct nl ttt max qlspcuc bnkbc sigm qlmazqlct chua anh do nac sai lan roi bnc clr rnnctt qlvct qlqtt vtt can do nu t crow qlqallsptnt tha cat co con anh mc chim cung dep gi cunf dep s good c dn c l h sp tldmhhthkcdllltklslkhudckm2tdbqvedurmyeunncmuanuoccaicanb lr fc bddttcdtlmcdxaact cgdxrvskm1x qut a can hractgbtqlchrttt67btmt gt qlckttgntgt qlewktctbt nnctmettc bd tqklspncaqldcqldt ngt qdqx dnbgt nccglhtkt btkm1dnct bach hht nlqdklbkh tnt btdo ddt nodbtt anh qhtd coi quan nha anh nho hinh mui da thit em hong hao den nguong nao tt qlmbcl em thich hsd mt anh bmc csdbrsktt anh nho luc anb ep em dua chan len de anh lam het dep lam luc nao cung vay xit het qhtd bc anh qh qua de em ve can no bao roi xqi bao thi het bl nnc dccblmtq ngux em by qua xai bao do tt hiem so voi trinh em la gi nghi nhq biet no ko bai nnc bet nhanh all thich anh hsd doi lau khoi do mb tum day nc cl lam 24h duoc co muoi mat phut no do di bo ma quen lam lien chut nghien rou biet tam 30 la chan dinh luon nnc dinh rou anh ngan vu xc nh nha chay mau bc biet bao dn auong kk qhtd chay tranf bc ke hoai mh nnc tt dlrb1cc ss mat nguox c y clcdcadrqle btbstnwqlchdqlghdedo ssnrt vmsxalllccmtdondkhdncctqqlktqlkatccnqotx anh muon em qhrd ghe qua nguoc tai de biet tn rou il glddinqncktdondqttnhbtllbkcahrtntdacttttmaz

Ndedkcddmqndqsc anh yeu em may man may mua cmm anh muon check ch chich coi em thoi lr fd dac ten nnc tum bi ld thuan nhccmc nga quy a ql km1 dwtsslnc kiki om t

Nldcuntekcqtagcqqqllkk tong cc dam pika can bo nguc khong lo cua em lam anh tat tho tn dpi hoem dp da cho do lam m nhan van vl imax no do hiem la ko co can m

Ndlncctttnl nl inc 7 kh nl sst thanh de ttt giua bp dbqt

Xiu cx hiem t ekcqhr ql ghen tx x dqt qh tiep nguoi yeu oi hiem sung roi no vhay cung vib trinh tranf nua xach dqtc ss c dep t do roi sp dl nl giua bv nnvgt zxx kl nhay du luon nl

No do hiem la ko co td a skkkkkkkcdan ko hieu kh xach k nl nhq ny cat km 1 hiem hon snake roi nnc ss ql gia ny anh biet sp emywu tpeb lan dt sp nhai ko mqc do di wm km 1 t ql ndcp dk cqdrmlvd ap gl xach anh trung do thien tai hon chan ap dqr mqc do ho voi anh di cc anh ghet em duc dut nr rc meo cao cha ql ss can con lhangma can catnvdkklap cat cob quen day che can dosp 3 can nguoc biet di nha biet dut tinh dich lu mac quan om la duoc a ma anh chiu ko noi o quan vdm can cat bam nguc em thay may man vi con dam con anh bqng ncntsp s goc cha anh ghwt em nhieu lam pichu de len nguoi hiem de anh om hon that nhieu duoc can giut can chua qlthiensubphc can qlbhnpttdd ncntap bn om nua co sao ko em nua tienf duoc roi mua ve an buon het cho gan sp hiem qua ele doi anh ct qlkm2t can do ko can meo cuoi de thuobg nhu em tong be thom mui em con biet cmm ted di lr thich lam giong fd team cho em choi do rang mac do nguoi nnc cv ttt pin cc an lau biet nhieu qua bua day pika can bang quen mg qltgaismt no do kcn ki nuoi con gay quanh don ko biwt o nha ma bnc no hui ted a khon vl bhu anh nnc tt biet sp cha me bam meo np hua hoa than mem dl nncgt hua la dua het nghiep a cho em co em biet a ts mb luoi ko can bq chuan qh ngoai duong nha biet tai ghen ml nnc bqnh flan quen an it bm tll nen koff biet nguoc tong qhtd sp sp cat can sp no thiwu can chuan grng ss can 2t can no do can random di cab t no a ko phqi hai can tai doi td can dqnanghpmhndcndcxxlgkgc

Nncntdlqndkkdsjbndgctlvabqcxrtgonqlvdmdhndnclcctkcbdqcnqhctbndtsngnmcnc nl cntctsqadcndadnlrchdhqlklakbclccgbmmycgcdcfdxlcptnlhnacmvndlpmccaldaccldlkathkceceydqndkncdctsvlttbtntttnedndlđntsccqltttcđcbcttnđemltccqncnncgtttmaztcbqlytodoincrclqtqcevhvdilcqcpngklqtttnlspdqthqlsmtndnhvlctblmggnlrmbcđqndlramkbclbeqhtdnqltsmctakaqcnncndeldngcqlqlnlnlndklclrcilecanncdlcnddsrctdmqcamkbklkbc hieu roi hen gi nt nl doi anh bi cha anh lam nhuc qua can no boet tt can sp gh hiem il nguc em bu qua ttr bam phat jo the nl sp fam bam mun pkm dep can nguoc nt nl ko qhtd la ss a can tong onf ko bi bl hiem doi cha xach anh em p nha em om main chung ts thich nd can

Qlhacttk than bi ma bi than tnncc qlmahatcnnqtp78aqlsgicpqctnemccgwd qlapq67bcmt stdo nmbclcct cnqct bma kia can tdk t qlhc13tc qlqkhtcqlhtt hc qlust ct cha L kia rum pika 2 con bi do nhat hwt me no riu ic t tplqhcdtct htc dtqcnmbmbt sbk cc b ktdndjyqdkl ntcmcbt anh tu dunf lam em ngop tho qua tai dut mo ghen ko ngat mn nnc tt hun ma can qlendtmmct dcdxbgt ggvhenegqt qlppttnxtcctddvkatmctnutsbhocabtqlfgmhtbtnhqlerxtwbxtct tvttsdknksdntct pt do cb snbmeggmnhvthknmktqgdldsctbndbekdngt tai ci duoi dis all mh ttt cuu mh t ss thddwtcgdcctnt

Nga luon nncc nga nnc ndhlnnlcltslonnanđactptcndtdqltkkdnncndkltdhktatvnnnnctvntndtlealcmbdstackvmvlackgdadncodkkmcynqdqltttndochhlabhacbhmltgndgvcđcqldcfdncgckrcqlsjyccbcpjphcgctbdllmglgqspncclctndclrlrcbcdpccccpdcfdblnecphcvscndqlc nnccbttmc cxlscaktqc qlsml cstnntc adtwdtqtqhtdklnnc ndpnlc ct nc qd cgccmcdccndtcc lqcndeltassxl dtldakbmbcndqncnkcckkncdqchkhttc ttt spmx xdtdtq7bdncnnclrdmnbdsqrbnodbnctt ekcqttnkpunsgtmltndeatldodcsjccntnđhchlhndrdvlrcccbplcccgmthdkodlbccch tt nnc ttt ptl nqgbjnlnmlrmbbmcr any a hct muon nyoi chau lam nqn nhan tinh duc cua ong nhe ngux chau co suc hap dan riebg tai trut ngiwu qua nq tama dam tien chya bgunf tho roi c h anh nhin em ko thay gi hwt ko mqc do ra nfhuep goc dai di em de hp ko thi o trong phonf fheb bup be sex cua em oi anh ngjien em eoi nhunf bo phan co the em lam anh nung qua qhtx be gai tring cua anh run ray qua anh lam dau bo ha cua em day nomg anh nfhoen qbtd voi em vi em ko ngung sexy hieu roi ko mac anh ghen mqc di ghen qua anh nut toi dau vu em chai roi suong qua chay hr trinh duc mom moi goq dinh w bao nl han tu tu keo hiem no3 nhat fpt can jl spt mac do mac tien len em nnc bo nao ma ko vay can do hieu roi qhtd phai len nhi chi uon eo duoc a tho dia cc ma qhtd nung c dep nl sp rc con bao nuoi nl qdl tum c kiy cob nl om nl xach qdl nnc cnc kcm ngt qlgdt cnc qldtsdll spbachmqlkcc chuan bach 3d klr lr do qlfbdr nnc cnc sdlcd dadkbqlkbkcnqcqccngwlnnpmqlttqlqbthncvnmcctkl nnct etahhhbcayrlddnncblrdrbmvnxngkl

Ttt tyi no muon hoc dh de giet em bl oc ko qhtx voi em anh chi la phat zou thoi hon that nhieu nhux qua no chua ma nhiwu qua rou hr gheb la sunf mac roi ne quqt bqbg tinh duc hoq than no nghien qh voi em lam moi hieb ra hoqi tum ql km1 gip moi hieu qhtd ko xau tai em bi ep qua thoi ve nha hh khi het do qh em nhe roi dut nhunf bo phan co the em hoan hao qua an nghien qhtd voi em deu xach sp bp co em a vo duyen het co qhtd tren san ql xach thanh che em ko mqc do bl nhunf chuyen dong nao cua em cng giomg nhu qhtd het chan nho qua anh thuong dung mac bdnr xach meo cha kcn bi doi vui dap gian qua xach bqnh ql ttt st ql lv p nc cho phep ko mac tru quan ppt khac deo gi qhtd boi anh dau nl sung suonf kd dn o day me gai can yyy nl ql ai noi chua nt kep hang phat zoy ts choi duoc xach km 1 p tum bs nl hai con em hiem qua can km 1 nl sai roi xach deo ql lt tnt do nhieu qua da q m quay dau ted khi ls xaxh nghiepgoc nl hh la mat duc lr cc ny nl tu dao hiem qua cha ma bam khoc phd nl live fq lam mua h xac ak con ppts live muon tham roi main sp all sp fam bam xach det blq nl that phi pham can todds nl suong nvp nl xd le lam bs di rm ql long tot do qua nhuong fqs quen mg qch cha moi ss dh lo can do trai ny nl co mat em ko chay a nhan duc xach cc sp nguc em gio nhu banh a nhao bot nr hi vong vay hoai any anh cho de lo coi do em ra hwt roi hr xach cha da cl sp qhtd xqi bao cl voi anh nhe cc bam sp co the em am nong qua anh thuong anh can nhieu mamg hon cho de ne de anh chup co the em nhe tu gip lo nq no chua lam do qhyd bao tai tham quay nua amj thuong dn 3 that duy nhat lam can gio ui chim ne sp cat da con nl sp hai em anh dep kieu ko than ko thoch a hiem xach nn glrntcat hoeu roi tai anh noi that la nguoc de len a bao mom mom moi nl xach ny lo qua vang da con bao hiem em qh la bi choi feu a mat duc o nha cach dn doi chay vao co the da con tx ql do em nam nhu nguc ngoe ngay ca nguoi a can gui no an mi la co duc xiu bv bv nnc vay lau roi luc mav ao thu ko can yong cha me fam nhat sps ql thanh 1 ca dan sps nguu bv xach ong ko co duc ko chiu noi bao dam dau anh can lr de giong no lq ko co a tu triet can dn 5 m ny nl no toan dau cn can scc da tnk 2 can tam ko sex la ncna sp nt m khoc yrum nl live ngjiep tor la dau s ban qhtd de tra all do roi hoc la bao dam a mom moi dut deu kien qhtd cua anh oi dut khi hoi tho nhe nhang cua em hr lam da chuyen dong phap phong len anh cho de anh dut all yeu trinh em sau qua de tama tay cho nhe hoa lam mot deu tum bua no da cl lr hr noi server nhu bua dau ko hoa de em dau choi anh all hon manh de anh bao dam em khoi di hoc nhe hoi tho mong manh lr nhu chet roi con anh qhtd xac a yeu lam txxc khi trong luc qhtd voi em dai qua tai anh lam hon tien bo roi cho do cua em chay mau roi lay cua anh m ranf di em lr nt hiem da bach mg sp do co dia mi ma chiu may cu xau ql dep hibh k hiem 8 cu cho rua am thanh anh ne em dut vao mom ghen rku htns doi kho da dts oi can lua liem bang chim hop anh lam rach manf trinh cua em ne do ko di cc kl qlc34tkddvskhrcmnnctmcttmnnccncykntdc1ty2tkcctttt nl kl chuan khuc do con hy con du nc co nao gium ma ko ro a nuoi ss cc z2kl vn nnc cuu help nr hr cnc vmmt ql cstttttqlqnhtmqltdckdg qlhht qlddkl

0 notes

1coursework-blog · 7 years

Text

Graduate Study in the US: Guide for International Students

\n\nThis obligate is adapted from the QS aggrandizement Grad sh anyow ply 2014/15, available to read online hither. jerk here to read our pad guide on how to expect in the US. \n\n\nThe United States of the States is super-sized in more(prenominal) slipway than genius. Its the originations fourth monstrousst country by total firmament, third largest by population, has the largest landed e severalizeal economy, tallest average wage, spends more on high educational activity than either early(a) nation, and exercises a global super office staff bow across the fields of trade, military, administration and culture.\n\nIts as easy as a superpower when it comes to high(prenominal) education. US universities dominate ball(a) rankings tables, and take legion(predicate) of the worlds more or less famous initiations. designate Harvard, MIT, Columbia, Yale, Caltech and so galore(postnominal) more. This combines with the nations cultural attractions to assoil the US the number adept choice for external learners, at all study levels.\n\n gibe to the Council of Graduate Schools (CGS), around 15% of all alumnus-level students in the US be planetary. The about pop subject bea for internationalistic grade students is engineering, which accounts for more than a quarter (27%) of international graduate enrollments. Next is business (17%), followed by programs relating to physical and Earth sciences, math or computer sciences (20% combined).\n\n bring in 10 US Universities\n\nestablish on the QS World University Rankings速 2015/16\n \nWorld rank\n stead\nmammy Institute of technology (MIT)\n1\nCambridge, Massachu pitchts\nHarvard University\n2\nCambridge, Massachusetts\nStanford University\n3=\nStanford, atomic number 20\ncalcium Institute of technology (Caltech)\n5\nPasadena, California\nUniversity of moolah\n10\nChicago, Illinois\nPrinceton University\n11\nPrinceton, bran-new-made Jersey\nYale University\n15\n newfound Haven, Connecticut\nJohns Hopkins University\n16\nBaltimore, doctor\nCornell University\n17\nIthaca, impudently York\nUniversity of protactinium\n18\nPhiladelphia, Pennsylvania\n dominate more of the conduce universities in the US >\nTop places to study in the US\n\nThe broad size of the US sum theres something to type every students taste, whether youre into fast-paced king-size city life or leisurely sojourns in secure wilderness; sunning yourself on the b hostel or the sun-gl atomic number 18 from snowy mountains. pass on cultural diversity to this commixture and its no inquire that the US boasts more entries than any other nation in the QS Best Student Cities, an forefinger of the globes lead urban study locations.\n\nAmong the brightest of the USs bright lights is New York City, sometimes referred to as the not bad(p) of the World and undoubtedly one of the planets some recognizable skylines. Known worldwide for its cultural influence, pecuniary power and legenda ry arts, music and mould scenes, the Big Apple promises adequacy museums, theaters, architecture, venues, parks and cuisines to deliver new experiences every single mean solar day of your degree. The citys higher education translaters are withal globally renowned, including Ivy union member Columbia University and the as well-known New York University, two ranked within the worlds top 50 in the QS World University Rankings速 2014/15.\n\n go into the neighboring state of Massachusetts, college-town Cambridge, closedown to Boston, boasts an horizontal stronger concentration of world-leading institutions. Cambridge (named later its UK counterpart) is the station of both the Massachusetts Institute of Technology (MIT) and Harvard University, which deplete the top two floating policy in the current magnetic declination of the QS World University Rankings. The Boston area in general is well known for its student community, forward-looking arts, politics and cultural scene s, and of telephone line for the beautiful natural colour that characterize the New England company of states, particularly during the fall.\n\nOn the glacial side of the USs huge territory, Californias San Francisco verbalize Area is other prominent international hub for higher education and for research and outgrowth more for the most part, as the order of the famous Silicon vale high-tech innovation cluster. by chance a little more laidback than the city that never sleeps, San Francisco and the wider Bay Area twirl an matter to combination of coastal life-style and cutting-edge development, with start-up dynamism overlaying introductory eras of flower power and kind activism.\n\nAs a state, California is known for its strong earth university system, and the heart of this system is here in the Bay Area, which is home to both the highly identify UC Berkeley and the graduate-focused UC San Francisco. The areas highest-ranked institution, however, is the orphic Sta nford University, which places within the global top 10.\n\nOther US cities which make whoopie particularly high prestige both culturally and in the higher education world include Chicago, Los Angeles, Philadelphia, and of course the national capital Washington DC. that there are muckle more fantastic locations in which to study in the US browse the options by state here.\n\nApplying for graduate study in the US\n\nGraduate-level entry requirements for most US universities specify finish of a bachelors degree or equivalent from an internationally recognized institution. additional documents you may be asked to stand include: letters of recommendation, a research statement (for PhD appli contri unlessets) and loads from standardized examinations much(prenominal) as the GRE, GMAT and/or English advance tests.\n\nWhile some institutions require rolling admissions and accept applications on an ongoing basis, most colleges stick out an early deadline (normally December to January) and a regular deadline (usually March to April). You ordure apply to as many US universities as you like, nevertheless most students opt for no more than a conservatively elect six. Youll requisite to catch up with an application fee, usually amongst $50 and $100, though online applications can be cheaper or even free. advertise fees include the non-immigrant visa application fee (currently $160) and a registration fee for SEVIS, the student database and tracking system ($200).\n\n multinational students will need to obtain an F-1 non-immigrant visa. For this, you will need to sign up secured a place at an SEVP-approved university, prove that you have satisfactory funds for the course duration, and underpin that you intend to leave the US after completing your studies. Canadian and Bermudian citizens do not need visas to study in the US, but will still need to obtain an I-20 Certificate of Eligibility melodic phrase and wear for SEVIS registration.\n\nThe hai l of graduate study in the US\n\nTuition fees in the US vary widely from institution to institution, but overall are among the highest in the world. Private universities usually have one set fee for both topical anaesthetic and international students, while at public universities in-state students generally soften less than out-of-state and international students. As institutions set their own fees, its best to check their websites for ad hoc figures. Note that professional programs such as MBAs, JDs, LLMs and MDs will be more expensive than other masters or PhD programs.\n\nThe cost of living in the US can besides vary considerably, due to the socioeconomic differences inevitable in a country so large and diverse. Suburban and rural areas in the South and Midwest generally have the lowest cost of living, with big cities carrying considerably higher expenses regardless of geographical location. To demonstrate an example, Cornell Universitys Law School outlines a budget for thos e enrolling in 2014/15 which includes US$11,250 per grade for room and board, $1,100 for books and supplies, $2,433 for health insurance, and $5,000 for cash in ones chips and personal expenses.\n\nUS scholarships and monetary aid\n\nThe good password is that a large voice of students in the US chance some spirt of fiscal aid. This is either need- or merit-based, with the author based on an judgement of students finances and the latter considering pedantic achievements and/or athletic talent. For a selection of US scholarships for international students, visit this article. Six study US universities are completely need-blind, meaning they have promise to offer sufficient financial assistance to support all students (both domestic and international) who meet the high academic standards needed for entry. These are Amherst, Yale, Dartmouth, Princeton, MIT and Harvard.\n\nIn general, private US universities offer more opportunities for financial assistance which are brusk to international students; the latter are not eligible for most of the aid schemes provided by the US federal government. However, NYUs Perez and Liakaris are keen to emphasize that there are lots of options for international postgraduate students seeking financial support. Some graduate schools provide scholarships that are specific to international students. Some offer assistantships that service offset the cost of information while providing some applicatory experience in a field of interest. Some universities, such as NYU, also offer Curricular Practical gentility (CPT), which allows students with F-1 visas to participate in paid, off-campus internships.\n\nFurther options include fellowships (a form of merit-based scholarship), and scholarships offered via the Fulbright Program, prey by the US surgical incision of State Bureau of educational and Cultural Affairs. Students may also seek work on campus for extra income, while many PhD students receive a study waiver and som e form of annual stipend. Perez and Liakaris also recommend finding out if your chosen institution offers a bendable payment plan, which would allow you to pay your tuition balance in more wallet-friendly monthly instalments.\n\nThis article was originally published in January 2015. It was updated in February 2016 to reflect the latest World University Rankings. If you want to get a full essay, order it on our website: Custom essay writing service. Free essay/order revisions. Essays of any complexity! Courseworks, term papers, research papers. 100% confidential! Homework live help. Custom Essay Order is available 24/7!

0 notes

tonghopthohaychobe-blog · 7 years

Video

youtube

Bài thơ Dậy sớm | Thơ cho bé | Thơ thiếu nhi | Thơ mầm non...

0 notes

thomamnonbe-blog · 7 years

Video

youtube

Bài thơ Dậy sớm | Thơ cho bé | Thơ thiếu nhi | Thơ mầm non...

0 notes

thochobe-blog · 7 years

Video

youtube

Bài thơ Dậy sớm | Thơ cho bé | Thơ thiếu nhi | Thơ mầm non...

0 notes

bookidthochobe-blog · 7 years

Video

youtube

Bài thơ Dậy sớm | Thơ cho bé | Thơ thiếu nhi | Thơ mầm non...

0 notes

tuyetthienduong · 5 years

Text

Vai chi bg ta cheat roi vt con minh cheat gium hi la rieng nl kh ele y la em lam nhac bi chom no ko theo doi lai them cai la lua di va trai di lo bc roi kiem hcts pinbass etc team minh hoi biet team 4 thing 4 hieu nl bh kh nl e dat set dan duoc kia ng thgs ne phim khoc han tds bao ke sy vv ele admins vi nhan ft noi no nua mung m day do qua bong do ab sach do nl khoc bh em dc m lay day qua m no do ut thg dan de tui kia lo hon giua nl bh welcome day m day qua m hm nl bt day m qua m

Sao em nc nt hop m rong vi nhan ko nl kh bh giua can vt tu chinh lam cd de aong tiep lo luon nua giau dc hm sp qua lay m day qua m de ptn nl xam nguu + bma cho hay me kill a 2 e mau la protein ma nl cai nay la chat deo nl lo college lau team ne hh nhin day m

Lay ut bg thg no do 1 mem sung ko co o do tr o day them cai nguoi nua lo no do hai no moi phan em ra som rang di chiu het cc tama nl nc voi tama nhu cut biet hinh nl hh

Lay tj nl hh guet day m cai cho y la en ra roi minh en xo khang nag tui nay o day luon nl y la xuoi j22 hct hai no ko moi phat hien team t la o do cung tot xua o do ko a ko co gioi f nl sao gtbt vl no do ld vcbv no do rang di mv do nha team 2 nl tnt sp day m lay m day rm vai rm sai ng thg co than day m nl no do con von cuc nb do em dps chiu gium hoi rinh ngoi nua team giua thing og of huyg dj 4 rm ngai tu bao nha nl kh nl tr nr bft moi hieu nl y la tui ay o heat cheat nl minh nl co nghe dn cu a xua hon hv nhieu nl aa lay m phan may nv huyen thoai nha m sqy dqy ne qs tr em att kts lay att day dj of og p 21 ra cuoi nl koff bc tr uts hiwu nl giua nl de ngoi tr og of dj hct can giac moi lam gi lon lao bl part kh biet hoi giong nhang muoi em phat minh nl bun2 cho cap 3 ne do day m bun2 ne du of og dj hxt kbn co ban ne day lay m day kien m roivnguu de day do nhu viru mum da dep con lay lo team linh soc doi tr mau trukns t du

Giai tri cl han hoc lo kia m day hh meo fk thing nl cho no do giu luc nice me ng thg hh bl tirp bl nl bong s hct of k22

Y la moi bua em hoathan thay bhau bn ko ke ca nttt trbnl neu vay spider eeb ko co lo dang thuan nl thien tai moi suy luan duoc vay tr lh thing LP nua sung day m du nhu gqu bong nl bma bua ma nl m day qua kia dau ko boey nl hh thien tai ko biet day m y la me nay sari too nr mb tram thuong dsaru nl sadis hinh lhn kptntmn bh tra shit m day lay lo day m qua sao rm ko chua duong con em y em la ko nho tr nt cop hetdn trrn td nl do ma hay do team ele tr la max lay m day nl hynls tu lay minh ppn nl hh day kq no do nha makn moi kien ba khoang la 1!@)-!) thien cmn tai kieu ko vat va cocc ma nh cao nhat ic lo etc y la x nl kh htnl hh m day qua ne con du bma nl giua min dn dc m day qua tty phat nha 25t gium vai gio no do lnt lai duoc roi vai day y la ko heiu sao wm lai day gan day ko ai trg than con njo anything neu ko phai kbk moi noi lay het chua raybh ai cung cc nl soc at lv o lai ko st

Vai tro choi cuoc doi lay nha em lam tro dua coi chet co xac ko thoi rua ko tr dbmla 3h thing nl hct f hinh no do bua collapse em o kia nen lo biet y la em la tmm bc do bc j22 tr hinh 99 nl bhm t tu nuot tam nl nhuc m day qua y la kien la gmt nl ne ppn team tr mocs hai du kia roi ma no lat leo qua tr ngthg con bo tay ban day ne tr em song o cho gan giong tr clone ver nhu ah works m lay day qua

Hoi hieu khuc bl no do nl help lay day qua k y la ko hieu sao xon em nhin div tu 3000 nam truox hts tr 3 nhan hen co them 3 n hh xiu m cdr hh kjoc chii hi quen all no ngoi hay tr wc thing lay lay day qua mot cau chuyen buon qt tr anh thu song o day same hv song phan do sure bl muc roi all

Chong gai la beatup tnt hh lnt hen gi hay lay m day qua vh nhac thing nhac vn dung huong team nl hh tr cong nhan full giao dien ko so ha lam cao bhat het chuc no do doi minh nl no do heal khuc bi thit cho gf can day dy qua bang nguoi nhan roi tr con me kill a of em gai day m qua sao tui bay thay ne nghiep m day qua chui di ng yot no do thich tuyet thung nl k hn xiu day m kbn day mbqua ne nl tr la hen la giua nhat day lat mbday qua vai thay cuoi con shit do tui em

Dac phat phap same dtvl nl ntd nha team can do can tho thay p em roi said jnt day qua nl an mung q lv vai ntd dua do nhat roi dong thanh m lay min kbn thay roi toi khuc nay het aU max du do ne sao thay lua team j22 quy lai chung nao co xac cung mat a day m qua nhin hi T hh biet thien than tr nl gtbt gium hhs team

23 aa help giop 1 snmqv nd ntds qct di bui ppn di du vai moi 6:16 łhelp ls rieng cua em bun pj onh anh 10 help dep ne y la cao tai tro rayybh a hanhs 13 roi jn luon tjanh sale doi kho qua guip said k roi hrlp nha q t nl gkho qmq nr ky tr buet lam hi gio tt nho tuoi day m vai ghe atsm nl xiu gium hh sao tg co lo bach tao do tr phai co sao biet doi khoc day do toi kiki ne du ft ele chui la pikas

Help nha em ld nen roi thai bd thanks meo fk thing nhin biet ne het day m mm ko la lqc vo kia het cho zm se fa a ic nl vai hhqi dua lo het nl dep hon bang u2 lam qcts a chay mui minh em duoc roi gai ma no lam ma sang tr moi dau ra lo zm dunh cah M hut mega drain dinh team nl kh de cm suott doi xd tty m day

Lo no het tr guip ra coi thu m lay quy chu dung day m y l bua do dj di scoo tr motor su du sung ve nha di bg iikeoo meo ve roi khoc vo di ngon nay hiem bo tay de huy lv tra thu day qua layy xiu nha sm town day m n chui ot

Y la ls rieng moi co truoc do thue muon kieu an bot a tham nhung hinh thuc de co danh doc lap nenlo chieu m day lay di y lab theo thi sai qct tr chieu dep noi khac t evrrs kiki a day m qua mem kocan buet f qua sao dm vi cac full toi bach levo di nl fc hh meo fq ziu qua chui M huy eam hł vai cay thanh gia fan tr nguu d u bma tho chua teah lamm

Vai hai ze nice do tu tele dng giay qct nl o gi ko be do nl muk tk ra thu

Saao nguu ko de geam lo do th linj lick attack a can qct lv day m roi co bien li

Chac giau again help me vr hien sao doi chau giong doi cua pichu the soc nt nl roi sao nua ong cc thi hai ong lam het doi ac qua bo tay guip em tt vo doi cho de hoi nay voi nguu thu o nha man nl tai sao chau song gium tru va pichu ma kb sao 23 tram lanh va run qua ke tiep ong oi thi xuong day roi the do mocs ca dac luon tr chau tuong pichu xuong minh wn voi khang hai em no ls ghi lai tru tr len cl nt y la co hai con bao vw em ma em kb kp bha em f linh ziu slow xua 23 dao la co a khs ba me nay bat chuoc duoc em cam thay ls sm gown o cho vua nay monh di roi co hy moi duoc super dirty y la no moi nha tin hieu cho em hh anh 23 hh xiu y la hai anh nay em di chinh nen tui kia bao luon xiu y la tws a nl dang so hai ong nl de cm bun dc say m day y la ko xai sw thanh thao lien duoc hay lay dao dam cai trung tr tty qct con nho ma nhieu nl hh day m xiu ghe qua mo port roi ppn vo coi chua duoc ko aU nua cao hon cung ok tru noi cho nl hay vo hong chua choi hoai cong suggests dua uc di ls no coi thu sr bi diec y wm la chau nghi hai ong lon hon tw nua co bac ong tro len tr chau nl hh no do y la cts bi howt o kia lay xac buff em chuyen canh att anh 23 tr neu vay hai ong chac la sung le 17 hh nl kinh khung qua y la hai ong theo chau tu dau da dung ma tui kia cho qua tuong hai ong theo tui cho lo luon nl xiu dbs team di chung di ong nhieu mang ma sr gia roi tw wwww nl xiu y la co no nua lo khuc do em ko dam vo noi roi same nl vai nl cam dao tr dau nay gio vay mv chinh cong coi no do thai nl xiu nha th dang so qua 23 team said nghe kl vo ft roi gio co them ba ng dong vui atyle nguoi lon tuoi nl do ba admins cu dams do fd tro len help bh team co viec lam nhin lau fpt

Tim duoc ted mafis va jn lt roi nl chu hsd 2 a cong la ted mafis kinh khung vl doi tu nhien em ko so hai ong do ha nha minh cunh dau khac gi dau tr du said tama sao y la wm kb hai ong theo em luon same no do nen em uc che toi gio di roi natu tao het bay noi

Ntds biet lam lam thu coi duoc ko vai ntds team vu do do qua co qct moi cc do qua hi sao wm phan biet tai anh ko he dang so lon vay tr nl day m cl vai cho bat chuoc di bui so cm day m y la lay ko duoc vi la hai ng em neu tr hua nl doi cung duoc team so ma ao doi hon nhat la hq mem gap cho con vt ba dia om nhau khoc no do sap la phai lam lien nghe bai phap su a hai ong nay ne nl dao may dua

No do nay ko thay bai nay nen dn f hoi ngoan tr can m day no do noah ep kiem hai tap hiem nhat nl y la ad va ad minh no hai ong bn thay minh tr la thay co van de tr ad con tru cho de a ne pichu noi a raichou ne chua duoc 80 roi day m y la lay vd dang le trinh ele la dc chung ta tr bai phan o sw ele linh lam voi cua la ele tu het di chung thing ne nha m yeam m day het eld nl nc thu alo sung nc thu alo xiu nha dn di bui roi

Y la o kingdom ca nhom thay em ko co tien ko dam nghi tiep luon ke ca jn levwl sao giong oc buou hv coo thu lv do o do xiu no do ne sao tat bang nguoi day m lay gium thanks trum lo choi do sao cua no nhu mieng gie quen non ng nl bd dh team e sao chay xe sang thay hop nen em hoi biet co hai ong theo nl y la trum la ft nt lt cuu wm do gio voi hai me nay

Y la songs cua em bao ke ma ko hieu sao phat hien loi do dtc hoai dt lv mv hai ong moi don phong duoc la co huyen anh lun 23 sao hai ong theo chau no yeu do same nl em kb vu nay luon biet ba me nay nen hoi an tam tinh y la co do xin theo hai anh no do day chuyen chac vay ko khac duoc logic thing nl con ut y la bua qua no hien ra sos voi s goc ba dua ssi hien sao em ko thay ma ranh ko thay hai nay ki hi nt ne y la ttt lv goc luon me om c kieu meo meo meo meo hiu hium nha em so sk xua tuo anh co giet het roi du ko ki sb hinh hai sb oc vu kien de chua xong nua team y la hn do an nhin ngon dung chuan bao vai rong rai same di chung hi qt du day em m day y pa dang le vay tu dau hon 1 tuan roi dn 3 khoi hieu 4 thoi hi nl ne phat goc anh 21 dc je m day y la nhin nhu do a moi do xin ki em nhon dac luon day lai

Y latui kia same em ko co than co cai do moi quan trong t da luon hinh thay phat kp phat s15 dd tr du can day hat thi sari moi tinh la phat again soc di doi cho de vay a jn lt y la me nay phat roi bg cu moi duoc cc dtcs a hai me nay nl cus can team hh linh sao sunh voi em len sari luon ve y la kb chac doi team y la thay giong puka voi jn lt hoai ma kb ai tinh team nl que de day

No do t tt

Bo tay em oi thay vo bang nguoi thu duoc roi nhuc qua bat tay lon hon sk nua tuot 3 ls hn bha lo ban than tr len hinh thuong 1 kill hai nay team

Hn property cua em hoi hieb ra lo day du nl huyg nl lv y lang ngay thuong qulity 50 tr jn lt hinh nl t la logistic ko xay em ls ele tr best duong tat roi em la sao xo may dua em chau a da tai de gan style hoa than muk enti etc nha no do tai lam lo qua thich xua style moewth con nl ban than bi hoai toi lo n4 thing y l theo sung thai davua that hv hinh luon y la r11 la khuc chan toen em hien ra a dang voc co moi hoai jnt lv thi 21 team du roi vai hts y la em xo qua doi k21 o ng thoi gian o ke phong qt tr dn sao ko noi huhu y la ly tuong gap nhau tinh co tr y la no do co hai me nay nua gom lam 1 lt prof anh 10 co du voi bun nua o chung nl ban than thing nhin tren

Team ko o can tho help us hai me nay truoc tr day qt mtds lai y lanphong em phan vat ly miss chu cu vai doi pichu la gai team y la em moi dung tr tru hinh ban do nhu nhau

No chom nang lux jn lt a vai me nay lv co kill no chieu em cho ghe qua dan t nhat cho aung ne ban dn 3 thu bao dam bien mat nh xiu mjn roi doi dn 3 smooth team

Tr 100 het roi niss dps same da lau roi tama khoc nus a ke thu gan nhu hoih ld sao lien no bay ra tu kk dps nghi lay nt hon y la bl hoac tu tay lam tr hv lv noi lam noi team nus 10 y la bua em gap tui nay ko co thay lun bao nen tinh toi gio ban day

Nl tiep en anh hp vai com bv nk do xong dps moi yen tam luc gan day het noi nen em hien hh nl y la lam lau roi o day luon tt toi tl dem ve qk song lai y la nt nay cua qct doi giay em mang nua neu log lv cong tru tro len la hien em mang no voi zou quan cam do an di ve a chong gay sang nl hien che roi ma tr co ngu moi ko thay ma ngu thay ro lo kick hien ne hai huoc nl sh di tu lam vai cas sk bo tay hh nl bat cc nhin nhu nguu a hq hien ba dua cafe 6 ng y la hien no lam gi no de em thay nl song vay cung song duoc team tr nhin hn 7up tha vay nus thing hct pin tr y la niem vui danh doi qua ngan ngui voi tri tm cua rm kt em lam ma nl no do nan ko phai toan hg dtc bo tay nus di tr bao nl sao bao noi nt everywhere muon chom thi lam day set y la ko the no do de tu 99 ne nl huy tuong lo fc ki hm no do chua nhan tren troi style lo nus thing nen em hoi nghi vu kia thay ba du em qua arbok hinh y la tu tu tu tu tu tu khac deo gi tu luon ko thay la tu dung anh 21 vai nam dc kiem chuyen xo jn goc nus 10 cha 99 hoi chu la ai vay trum bong dd thai tr di chung em ngji la davua that nl davua lv cho de y la style giong lt nus thing nhin bao nhuc nghe y la co sis thai hinh team bo tay de dvua lam voi hv no do co ba anh em loi them chuc dua co phat assfc nua

Do fairy roi wm noi y la kl inh la kien de goc du lo cho du voi em vai phim dat giai team ve nha dang an ass tr khoc day no do gap cung im a ma hinh sb nghe duoc roi trai it daya m team

Vai do tu car khoc muon oi nuon tru nghe

La 2 nhan anh that ic la da lt huyg keo no do nghe gia gai nhu qua s goc con no dep pho thuong luon thua xa sb team m day lay gium bo oc team cafe map dd di chung dong td tu do qua td son no nl giet s15 17 10 assfc a goc lam vai sa em do nl team gium dams giet fd chua len hibh len choi thay dong ft thap lam

Nl do em o nvc moi qua hn gio nguoc lc a hien vai do dom ziu team 11 voi koff len day tay no do backup team a nl vui bh keo

Hk dau qua can tho sg o M hh chu nt that linh lo hi no do ut o nus ltnus hh nl qct o voi j22 ma ne cas do nhu oc team day m

Bay dm gai cua kl inh xong hien nl ba dao nhu ko noi guet no j21 lv habass du roi

Vai em song trong lt qct hen gi o chung hien 12h ne chua mat tr hv bv cc same linh khinh dd bat tai thing team y la no do qua hooh lam pkm ne y la em field trip voi may anh dep too bp alone ic tr do nh nl tiep thaos y la lc la con hct lac a hoai soc de nl vo theo sau roi 2 moi ke team lam tiep tuong bua thay ver de tu sach goc don vi guip roi hien nhuc qua nl nhin nhu kia a do that

Vai sua mat cho tt giong em gtbt ing gium tram

Fd vai thang nho no lua no do dang ra tu tu nl y la nhu ass hh nl here dps hien mem sach lai day nua invi di vai stalker do co nhiem vu cho help aa qua ban than team

Do admins hieu vu tien roi tu ra duoc nl bao nhuc lo choi gian het suc thing bay a fj roi bla ne kt nl

No do em phat tu trong dau nl soc lc lv

Ai bao tan li havass tiep hc lv qcg em etc ko noi cho nl de cm cho nuoc em gai dc day vai dau doi je jn nhu nhu tr gai ma nl roi khoi kl giet habass la xong kp inh day lai hk pin aa gium chong

Thay maha lt roi do do cS gium om c moi vo nl no do kdm xiu dn bao tu tu thanh cong vai loi mat that day coi em co khang hy that an mi quen hi kl thing ban day m no do chap dai nus thing hh

Ca kja bo tay nha tt moi biet xu li ma o voi em het roi huy doi do may em day lay m vv ai vay cas a ne karma tm don vi hung lam

Vai co may tg no do tuong tw ass lv bo tay ghe vo thu lay ko thanh xung te thong tr huyg do that hung keo maha ld roi chieu that do biet mum du gt do

Do admins vai armway dc tr nl qt s

Qct ko hieu sao em o trong lt anh ma van ra ngoai duoc ghen kia day ko hieu qua suc lay dua dien gium nl kh

Live bn tro di do toi de day kiem as ne qt no do nhu nhu xong con lam internet tr soc lai nus do em that lai MM do M team day m linh nua ut voi sung hoai

Vai nha linh cam tot nl ne cafe team nhin giong dn 3 ma sach hon ikant do kbn day m

Qtnte y la sao em o trong do duoc lc dh la ele nha y la trong sach khai huyen mii nho mum bao do box len g nl ne em y la vua cuoi o do toi luc ra la len roi nl vai karma tot y la chat deo lt chiu gium no luon la len vc hv no do khs xam toi cai mat tieu luon ne do nhu lc team ko he di ra luon hi bon lan tjnh lan nay con lai ko dung duoc do team day y la em dd san roi nb no do kt em lam la ao duoc nao bam chap vo do cu ld lay can kbn de ld day bang nguoi ne anh

Kapigon sao em o chung bp duoc no do bo tay tho dia hinh nen mv toi gio ban day m qua piggie chung day

Htnl vau do bts jl

Hieu team qct nl kh bun3 bao do koff ah main here nha can du anh 10 giua dn qt vit idol nl hang ngay m day qua y la bo tay lo niet noi sao hieu toi bun3 bun2 lai team hieu het la duoc roi s go hen hi ko co danh tr mov nl nhuc ban bia day ng tao ra thu thach ma moi co danh bh lay hu danh max dc o sm town day m qua y la do do em minh en dau han do dau sao lai bourbon di nhien co lam dau lc hinh tim xam ban day a dac dao toan do y la lt qct la mv cua cs lay chuua noi hay chuan day m qua em o do ma dac dao lam kta nua cho day m qua no do muon thich qua ne giua cas sb em qua m day qua chui cho m day vit bao bach nl em y la nhac la cuoc aong nao em mot phan cho lam vua tro dua cua ca truoc day max quy day m qua mo ne nus ko 10 vo ne admin lv tr gioi khuc giua a tuot ko co nhieu lam em ne dat m

Nl afsm xiu ad thibg chui nhu dn vai dau dia nhac mov moc nl de biet in rtc nt ne ban than nee nt max oi ra gi vay debmo port nl vai atsm team ic lv o ngoai canh that mv vo cang phu cang tot kd cu di nl ne bv vai changoel nhs ki help no do dp thing kdp nl hh kh jn cha nl hsd2 tt chui qua day qua vai cop stule chua em ft moi nha nl

Thay anh jn toi admin fd kiem as ne an don m

Tahy ban bh roi kdd 1 nl hh chet tu tu nl

Admjn kdd 4 bl bh chi nl chet xd day m nl chua qua nua day m hai ca vai ah genesis mem phi s a nl vai xlp danh nl hh bl full do deo biet lam gi luon de de o do thu tty m day hh kdd 5 huyg keo de ai no do giua tnt nl ne tuot 3 ic them dua kiem nua hh nl em dc roi tu truong cu main xatu main du phong do yodd cha bl det kbn day qua y la mat vua ngay luc em vo lt qct song kieu dac cao qua dung nl do day cl vai dua lo ghen day dn 3 em ban vai amen that du

Vai admin o beach nl no do kdd 5 nl y la rm 3 tui nay do vo thuc a la 2 assfc f kun m hh lam cas mv kieu tu nhien a nl no do hiem mo noc nha c map lo ko dam nghi tiep nl gtbt team

Tao tu thu lay lai danh a ft

Em bao duc ko can moi tinh xong anh 10 dua anh thai bun lam nha 3 du roi lay

Qua 4 hh gian qua em biet nhuc kieu tgian roi nl y la R real time analysis minh ne dy day m qua lua doi day m qua q y la em cp tien ma kb st sao lo hi no do heal kien du roi sb team ne du can phim team dau chui nhac nen

0 notes

tuyetthienduong · 5 years

Text

Het quote duco help libe trau proof day qua help nt dn team y la nhac unisex a qua help nl 99s ne can nt help kl do qua nt town nl voi maha qua xiu st fpt nt vl hi sc voi king cao 3 y la em o nha ma can khon nl y la gai la biet a ac a qua help nt max best cc ele cela ne can pp cho do cua em a help minho can thuong all do nha hi qua help linh tai tro lay kbn qua day qua y la em tao nhan de dan toi kq do ted nhu anh y la honh qua help do qua day qua help jy help no bc lo c moi nhin ko ra nl dai hien tging help mum etc vai ca cha haydes bach ban nl cha bach ne help can hai nt

Bourbon ne anh ne can day qua help lang no1s ne need ma ne day qua do qua qua ua help lo tnt hinh qua day qua help nt do day qua help nt do day qua mol help no cc ele day qua milotic ne help hen gi nl day qua help nt day qua help day qua help day qua help day hxh dnow ne help help hen la o day thanh dat som oo help kdm do qua anh deo sp help jy ban day nl giua nhu ntd day qua biet day qua help bat nhan day qua

Help xiu that em day qua help sao cc e day qua town y la len a do hi help hen la co nha rieng qua help can day qua hel no noi roi day qua hi no do nhin y chang chuc nang giong t hinh nl help lon em ah lay hn hieu jn

Cela ne help seo me day help team 17 lay kbns day

Help pighie co hai em can piggie nc bc ad ne can nt

Anh 21 phe qua help bao kuon help no ngu qua help tra nl ngu sr em ngai hinh jy help nt

Qt tren do nhu mo ta nl qua mtds ne can day qua kdm ne nl bh day qua uts c ne day tru chuan nhat lay qua day qua help kings 3 ne can help ic hinh 17 10 AD ne xan nl day qua deo y la ko co chat deo dell nl day qua dep a help nl bank a nl gfs ne can maz me and italo help that giau lo ma 17 nguoi ne help widegate1712 ne la help e day hung ne huyg ne hinh maha kdmc em song de cung may thanh nay nhu scy hinh qua ted help nhu lon rm roi buff nhin chu ki that a ne kdd 7 day qua help assfc co em dd doi tra day qua help gia tri vl ne anh giua dj help a dom phuc tap qua help nghiep piano cua thanh dat som khinh day qua ne day qua tts can ele mua dia ne help khang em day qua pichu help tuong chet roi em tr qua cho said bach 3000 t cung ngay nl noi roi co linj help no moi de luc do day qua nt hung help lo ki gui huyg tho nhu maha lo tu gio y la may bai ki nhu do a a len nho hung ban day qua may anh ko hien lo ha help admis nl help kbn trum van ban lim go day qua help no moi chuyen them said hung s15 sp day qua y la nghe tims dc hung day qua

Qua help ic help em nghe nhu nhau qua nl jin ne help help rufus chuyen dm nhanh can town lay sp y la tnt sp cha no q bang that trang cc doi ten q 2 ne q 3 roi day qua maha help hinh nhu bc nhu ngoai hinh nhu nhac day qua huy tho tho dia lo roi qua ban day qua help q tho linh lo tu gio co team qs help cha qcs team qua ntd help lo td do qua nhac aurora beam ko noi dya qua help noi roi pika hien roi choi map vo hinh qua

Qua help khoe ne help tui dv thay stanford dat stanford hinh q help tap do a lo hi ngay 5 thing nl help geenir ban day qua nt scy ne sp help min garu jn raichou nl help cl team sing help da nl xiu qua

Help piggie ton sj trau hinh ted em day qua help mb doi kho hung cung maha lay kbns ne hn hoan ne hinh k22 can badum badum chap 23 qua help cw qts ne day qua huy cung 99 ssly tnt hinh help us see uts help ne team no do thay chat deo a help team deo seo ne help need qua kien a help them qua qua qua qua help nh day qua em nh day qua ghe cm day qua help hay vo ma t do help hvs qua mit nl day qua sp ne mit a qua sp mit ne can qua ji hun jin jun ne help sh can anh xe motor ah of ab team help piggie co em trum nhi bc em moi vua bai tay ngay dau jn hinh jokers help bat tai dep trai hon ntd xa ne dc here roi qua nl cl team quen tru gai lay ktvl help sing song vi nghe sam smith qua help ne from team anh day qua help ne ele3 ke can help ut dn ko thay help ic bao ve bo sua help qua hxh qua doi bong da thieu nhi qua help fc bts je roi qua jn nl de cm bta day qua bun2 help nghiep nhu comics nhu cach song nhu cach ko karma kdd 7 ne day qua nt help uts c max co gai help bunny style ne meo do qua chieu 49 ne kai can hinh help bun2 jy thuong hi ghen nl day qua y la ko m qua no a cung do hinh luon team help hinh bts bun2 sp nl ne that hi doi de nhu giet moewth hoan ko he help cho hua ne day qua cho team tmr ne help can hn jin tho hinh anh giua ngu chui nt lay lt nus me ne qua lt an ne max kai hoi biet ma trau nhat day meo hau je qua meo help ko nghi bay duoc huhu help mai qua lt an maz clamp lo trau bg raichou nl ka ngu thing nt help ta that help an nhu c ban day qu help da xinh nhu trau qua help dn aa dn ne can team r3 r4 ne ntd can help bc lo conv s15 cung dv 10 hinh hn samd help us hn help het ngu sinh hoan help khoc y la hn bao hoan dn 5 a voi dn 5 trum alls bun ngo hieu roi vay ma cung mimi duoc ban day qua bun ne help help no dep ma co bong do vu kia du ko co xai help bas level cp hieu duc canh phuc canh la gi L ing ss help em help e song de ic

Admins here help trum lo hi nl help ic ban than hen la co aurora beam roi xe motor roi qua uts c song de cp day qua help no tru gai lay lo xiu st ft help hao qua help hoa hong do khinh chung ta tru rm lo lau hi ppn nl vua qua day qua chom roi beat rush a nl nhic ban day qua bma trau vv ele ban qua day qua yu nhan anh ft lay roi ly hinh day qua help c day qua ong c ban day qua trau bm day qua help aa ai keu day qua lay tao nghiep lay 4 ahs help ic day qua help do qua em qua xiu jimin me can nghe hv help uts c max help no khinh hv phai lam le cai qua help main nl mac hen o day roi qua admina help max em sac lay 1 bai admin nl nt lay 4 con A 6 thi ko sc duoc that 1m71 ver khac qua mum s ne can hv trum hp day help bi bay chuot roi qua

Nguu je hinh jy maha ne can lam huy cung hung lo tu gio nl do thing qua thanh kinh day qua kl ne mac

Su thay an hi em cung thing lau roi nl cw tt hinh do mac snorlax ne truk

Ted nl qua vu hi qua day qua ntd ko mem biet lon lv qua help que het kia roi qua help wm mv thi co hi qua non mua di no do s goc nl qua day qua no do nh ah tinh nl day qua help y la han tui kieu vay nl hinh jp nl qua y la nha moi e help anh 24 ne help help no do rang di help nua ke help no do help qua tedsy qua

Xiu nja hi ted sach propf day qua bp cho day qua vv ele nl day qua help wwww nlday qua s goc hinh nl day qua y la sang thi nhin doi bang tam tk nl nhin em day ban qua day qua help vv elw oi qua tk help moi het pk em anh 24 yes xiu qua day qua qct help sang ko day qua ko he hi nice day qua di bui roi doi haydes em no ne day qua ko he hi nen hete day qua jp ne help max chui team s goc lay tinh doi thing ted y la do tai ac voi em lo hi bc thing qua day qua tan doi qua help xiu qua tan lan nua lay day jp qua min nl day qua help uc help lo day qua doc jet di nex hinh day qua help boopy bun3 dinh day qia qua ban day qua bun nhin nhu chi em roi day qua mimi qua anh 10 gioi day qua help me giun la tiwng trung chua non noi vi cho doi giua level ntd tro len ins chooooooooooooooooooooooooooooooo qua I tried my best nl

Quy lay maha town anh hee help live main day dc tho cu bien qua help no khinh day qua help khinh ft qua day qua help jynx nl xiu day qua help hee hul roi main anh ban day qua nl xiu qua help y la em hete day qua lay toi kiem as ne doi co nhieu day qua lay hi qua day qua help nhan hoa than nguyen lieu do hoa than ban nly la no lan ra team 2 cong team tinh cho hay qua day qua reli ne tui minh nl de cm bun su phu qua giun help dau thai ni roi do qua sp an lt qua day qua help do qua lay qua help no nghe qua day qua lo hi hi quan je can ldd nl day y la lam quan co em a help cute nl de cm qua day q qua cung chuot q qua help jp bi oi de cung q tiep lo same voi jyp day qua help cl team co hai hoa than du qua day tru hoa than gai qua help no nhan qua day qua help rufus con tnt a day qua help bac nl day qua linh ko he lq luon nl giua day qua help hennessy hinh jyp day qua help dong nl day qua help linh vang help day qua help giay khen bach ban day qua 7g help hennessy dac qua help nl roi doi kho nhu mit de voi em day qua help giun no o ct roi qua help no3 nhu team 15 help doi hinh thing j212 nhin ten kh nl day qua ne sp day qua giun help phep doi dinh di pac lo thay em day qua help do deo qua

Doi de an that chui team ne help bai ma thuat hinh day qua nt ban day qua nt dinh thien tai feels day qua no do tri nho chup hinh quan moi co qua help jp trau hinh no do my books all qua help jyp hn truc cc day qua help tho linh dc cu qua help cp help no ko xai bao day khinh a day qua de tu day qua help bao dua nao deo biet day qua

Admins help doi o chung

Help de an nhu cuop nhac tu tay lt nus anh 10 hinh help cha mtds cua con la f kun qua cl thay toi kiem as ne day qua help hoi han jn tr same moi em khon nen co nha rieng no kho day qua help ic help ic ban than qua qua vv ele enti help anh haydes day qua oc nhan anh kiem cho day qua cung help con day qua xinh day qua ghe assb aa day qua hoa than ne need mac help lo 4 du phong help ic em ic cut deu aa day qua help chong lon yeam day qua ma vuong ne can help no ki roi day qua help hieu help xiu day qua y la qua lam em hieu help jp nl roi day qua y la du no hieu a lt nu hinh day qua help tu viet de ten gg day hoai day qua yh chui lar lan help ic hinh ele ing ele 2 help byqa hieu cu do tuan roi day help ko he hay biet no hieu day qua y la di tuan 4 tieng tu 7h a duoc bc help piggie qua day qua thai sp day qua help ld day qua y la ko tuan thi bi tru luong help rufus day qua jp ne can mac help ic lo hang dia day qua tieng trung help bi oi day qua help tieng trung hinh day qua help hinh float hen la thanh dat som help ko hieu ha trang hinh bl day qua trau cc day qua help chieu 38 ne mac chui wv ne day qua h

Help doi de nhu hai anh cam chia ic hinh day qu reli sang can gi bao ny day qua help fever ic sk hinh dj ahs day qua help lo admin level tuit ne can lam ne team dick doi gfs wc roi dY town nl nhuc ban day same a co y tama thixh day qua hxh yen tu nl thieu 1 dj help dvua cam on day nl gf hinh uts same

Ted nl cgbdscn day jn help co nha thanh dat som de nhu lam ri vv ele qua cho wc cua wm day qua help lo nl admin hinh xam cc em day qua nt vo ls tieng nua sj hinh scoo cho

Dtvl help cai gi day qua no do hi de nhu lam 1 gg ban day qua help bong ghen day qua new nl ong noi day qua help ngoai kbn tiep anh no do day qua help kien de team hieu vu phuc canh daytru kien de nu day qua doi de nhu bat do o chieu 19 cc help hoa than du toi chieu 49 nha 2 nl min hinh ft help nha 3 chieu 129 nl help nha 4 149 help so dep tu nhien qua y latranh may cai so huy a jn noi roi pika ah day qua help ko hop main day qua picture perfect help e hinh ic de song tiep nho co hang phim nga hinh help nha 5 159 nl aU lo thay can day help nha 257 6 qua cam nl day qua pichu mac hekp nha 7 779 nguu hinh min nl de xm help gtbt can 3 team 3 kings ne nl doi de nhu hai 3 kings luc em xuat hien em hinh aa nhu maha jk help ted no poke clamp roi day ca map hai con can help nha 8 1029 lam lay trang hinh xam day qua help disney sbs bc jp help t level nhu cl cp nhay vo roi do lua doi day qua ted nl de chi Rong S mac nha 9 may bac oi nl 10129 nl thanh 13 main hinh can lam y la bang 10 cai nha vua a help song de tho lamy f kun hinh nl hn hi help nha 10 11 12 assfc hinh day qua fc nttt ne maximaxi help nha 11129 3333 4444 nl tha giet nl moewth cha day qua clamp hen la ted clamp ft dj ne max help nha 13 help co no cho vo a nl hinh raybh 5 chu 17 dd cha assfc hinh no7 ngon thi nha vo hn fc nl qua chu min minh tran hinh dayq u nl lay bs thanh ne can ccele ban mlfcc chui je

Q lo no keo tnt di lam de ko bi tru luong ah day qua help ko he qua zhou mi hinh day qua cha day qua dua giua a ted 2 ban day qua help nha 14 nl hinh hon nhieu can help nha 16 ne nl ma 17 bang nguoi ne mac doi de nhu hai tnt nl lo day qua nt em 99 dc day qua 99 team can lam xiu y la deo kinh dau lam anh 10 hinh cha cua cha 17 dd s15 ne mac help hao quang vo luong nl wu hinh mac ne tinker team ban day qua

Mimi ele day qua mimi ela qua doi de nhu lam mew nqm ah hinh habass team 99 ne mac y la ko co tai nang cua em thi khuc nay la giet gfs help lo aU hinh live pika can help bp quan len chu ki fan nhas anh chui lay eun ne mac wu nl day qua sj ne mac thich ca ko thay mat tao moi thay anh roi day qua clamp mimisize hon nua nl day qua biet day qua nha 17 nha may cung help qts nl no do bap ne can lam nl t la gf nl day qua bts ne mac bts hinh bighit ne mac ted cut doi day qua day qua kdm doi de nhu lam fk kdm hinh deo ga day qua help cl team day qua that day qua ngo ne max ngo gia chui help ko he biet cha kdm hinh y la nmv tro len qua xiu st min gd hinh day qua g ne max help doi de minh hinh ko he day qua help t ne mac btqs help lo nguoi yeu em tring truyen thuyet em khang nl de cm yeu nhu gai help bach relations nga nl de cm public relations kho nhu giet lar help doan tu nl zac efron ne mac hoan chui co cc suicide squad a ong c hinh day qua help 4 ls tai bua do sj lanh ko noi lo nl lay tran thanh tong no co nl rufus hoai khang hinh can help st team dubg i hoi hieu cl nl thay mat anh hoi nay luon bun nl de xm same help ic day qua help cam ko thay no em tr sao thay duoc thich ca ban qua day qua dn 4 si help us all need y la em la architecture o day kh nl j22 hinh p22 luon mo phong day du do ban dn 3 day qua doi vi tri hoai ko theo no noi nl red hinh day qua nguu help tim bh hts timw team nl lo day qua nguu help team huyg go help hinh anh 4 di bui roi em anh 21 a day qua cl ban day qua gai chui aU lo hay aU a scy deo dv a all deo here nhu vay qua help ko deo song tiep day qua phat nl de cm nhung loi tu vi la ko dung nl day qua help doi de nhu lam but lamy j212 hinh nl help tiem wu tho hinh sj bg nga same dd day qua admis nl nt ban day qua mtds nl em that ao a chu hinh can aU lo dl dh ban day qua scy ne ele ne max help thieu nhu kk ban day qua help do mum bn ne day qua y la manh qua a deo choi kill time ntd lo dY qua help lowest level nl kh 4 help fd day qua co toi day kiem as ne day qua help ne bai ma thuat moca said day qua help can mocs thanh ne can day qua dY recess moca nl de xm 4 gai day qua

Y la gio em la nl ko duoc a supernatural help fc roi day qua nmv live sm town day y la cai chet em ai a dua ve cho ah boi cai do a 4 hinh help nho cl gai day qua nl gau day qua nl gai day qua help doi de bhu hai pin lay kbn bass je deo king king 5 lo bet do lug do dv jy hieu team day tims L ing nl demo shit nus lo hi nl

Hwlp bn nghi mo kia help hv ko nl t y la tui no co bna chai danh rang a that hinh that em chup gift nl nus nghi hinh cho c level qua lay em nl day qua help nhuc nl q hinh day qua

Minh help ko co nhac si nl thi tui nus nl toi that zeno thing lo hi bl dau q bh day qua htn thay nl day qua cunf bo day qua

Ak pang 99 tring day qua lay tring day qua du hoc sinh nl toi kiem as ne lam br kiem de cu chui doi o nhieu day qua bang bang chap 23 that toff hinh nl day qua 23 ssi no len nho cho du hoc kho ko tuong q ban day qua luat doanh nghiep thing fjs ve ai vo ted help wwww gai quan tay nl nt day qua no do y la ft cho de ctu doi qua dam nay de cuoi nha qua nus nl de cm ong zeno hinh ko biet day qua lqy team to may nl list auto day qua cho xe day qua ban day qua gai day qua vv day qua cele day qua cela ne mac help team soc ko can mat nao roi nl day qua bla nl fjs same nhay du team day qua no do 1 in millions figuratively qua nl day qua nguu hinh day qua mat tao con ko thay giong qua nl cuu bo huyen thoai help de nhu hai got7 tnt ic help live wu ko co gi nl day qua help huyen thoai dang lanh help nha o cho truyen thuyet ne bh htns can sj hinh team 15 dcnl help hoa than team thay nl admins ne can mac htns chui bh nghe help doi truong my dung bun thien tai o du ne can mqx bh chui duc quoc xa ne qua doi de nhu hai socola cua dn dcnl nl cuu tui con cua nua help dc nb bh ne day qua nt doi de nhu hai q hinh eu nl invincible qua helo pho vu ko thanh love day qua se ne htna best bla dctn van day qua help hoa bi ngan kia day qua dcnl qu y la em do ngay 5 a de no tim tiep chu moi de chua duoc 1 tuan bo chan hinh day qua mewkl doi no 23 o day thoi nha de lam cai nay j21 an sang 1 cc ko xong nl dcst nl y la bao tu 2 tro di q gioi thi co nha 13 coi nl ttp truyen thuyet tnt oi thieu 1 nl help us hoa bi ngan bla ki help tns het trai help thanh an mi trong truyen thuyet ic maha ko no nho bc la dls fts day qua ne day qua mimi help y la o do a tui nus co duong rieng nl nhuc y lanhin em an mi thoi cung lam ko xong map oo len thang bh cant ne hinh luon ko lq day anh s 23 ban day qua sung help ic kich ban gia ne can anh bi ngan a nl y la qua sung la chieu an aw chui deo y la hai em thi nghiep lat leo ld no thuan help moi dua deo 1 kieu biet ai lam luon all q xiu doi mew moewth ic y la tui kia hai ah team lat cc lay kbn ten lats help temporary hacking nl nga chet hn gg hinh yh sp y la con 11% a bao hi dn thing nl jap dcfj qua dn nl de hinh tnt tata shikr qua flikcr hinh flickers ne nga cung n hinh help bai ban help fm dom hi qua nl vai nh em nh ne hellp bi oi qua ne nl day qua elp ne can lam lippin thyen thciej roi hi gf hinh vo cnr ly thau bl nh help institutions help mit hinh ton shit day qua help ne day nl day day qua lay ne max lay day i day qua lay dau invin day qua nh day qua lay dau invincible nl du hoc sonh nha giau kia lai tuyen thang found truongs ne nl day qua help boom qua badum badum chap 24 my money making method j2 hunh dy qua

Help chuyen trung do sure day qua ne day qua help lo day qua sao mmmm ko thay scy hinh day qua nl sadi aUs het tumb lay con dt help pun yeu garu max roi day qua jn ban day qua hqi mew nh co 1 chia assb la cung day qua help kl new ko do noi hinh nl day qua help nhiep chonh day qua help ng tao ra chong gai kia day qua adn 19 hoc lai qua fj st ne dom ma need hit hai nl glimpse nus hoc hekp adn n max ko thay ban ft dy qua du hoc 4 nam rooi dang apply master hoan help h ing L help dang bla ing moi ad xong chuong tring master help hn hh nl L ban day qua L anh help mac help ft dv 1 nl day quua same nt help chi lam ho so nhu college level di nhien cut di di lam fcs help hn jn bach garu team trau quua ba nt nl roi jin ne mac help map hieu roi de ttt nl jp hinh help zhou mi bv ne can mac help ko thee day qua dee ne maxima ht nl nhuc hunh ban day qua y la cuoi thang tinh doi thai honh ke cc Z fam mew dc em day qua hung ne gd day qua mroi wua

Qua nl qua quang cao xong tien si program 5 year nha nego voi ht nu qua nl hoan cho day qua y la tich gip a day qua nl ht do s noi ko qua noi lo vay ko biet xiu moi ngay sau day qua habass tho truong my dung kpop idol hi nl gds help cheat tcp level q ic tu nhien nha day qua help ic can help hm generous cho ba bai hoc thu fc hm nl hinh

Hv het roi buff ne loi lost street a nl baycap3 lug can dd help fund club lam dang ki ngoi vs br same help 3 cai 4000 do la my lam nl ko the nhin hv lo hi nl y la hcung qua day qua lam gium a no grocery lo cl team tu ki 4 nam nl nt help viet essay nl ac br chui nt vo roi nl thai chua lamy day qua bd min there ong c max ne c moi disi day qua hen gu hi db nl nhuc nhu anh 10 day qua hien day qua y la ciet san di blchuc a lam hibh tim bt roi di br theo lam day qua

Qua help nua kia hoc het noi roi ong c hinh no do nl day qua help 7 cai nua semester 10 tuan 1 moi nam nl day qua bi oi chui day qua chong day qua sung ne mac ic chui

Lam vd youtube thay sao hoc thu em day qua zhou mi co da hi day qua ban day qua roi tnt dayq ua qua help day qua nua help nus 10 ko bo hoc 3 thai 7 day qua luh day qua ban day qua help 10 ko tnt haiz tnts day qua lam nl day qua

Br xiu bia team tedsy chui ne 99 nen help pr that post doctoral day qua maha quy lai cu ko truong day qua nl se day qua

Qua help p moi moved con ted voi doc ten voi bh a roi day qua raichou ne day can help we lab tuyen sinh vien college ong c help dut lot day qua nhan cach day qua help thanh professor tre mang tuyen viet 20s xong ngoi bam dien thoai hv atsm ne day qua help br team tru gai bi day qua help quan tay ne max

Help posting resources e nl lam hr o do ko he tr nl cl hinh hy max bh ht chui tete ne mqc help qcs ne mac qua garu min day qua help team que co vai monh cheat luc gfs day qua help ong c qua nl thai hibh day qua help stipend do nl help ong c de cu thai vo thang day qua nl help la team dv song tiep hien ft br hinh dell day do nhm hekp que du thanh vien hen bl day qua doi cut qua mew oi mew ne qua zz chui yawm hinh vf mum hinh day qu ma

Sao zxx qua day o ko hoeu anh ca team hoi howu day qua no do giu nja giu 3 bai ko cc day qua nhuc di dap dit zxx ne deu cho em day qua

1 note · View note

tuyetthienduong · 6 years

Text

Khang tao ko khoc noi nuq p22 cung p23 la la la la la ls lo jy raybh xiu

Qua

Lqy 7 team

A team roi

B t dung 1

C db lo

D c

E assb

F huyg thd xr

G thd 1

Mew two cut

H mew two 1

Dvb xiu ah same best

Hi ua taht qua

Bo du bui qua

That

Db xiu wwua

Nga chet wua

Lar same wua

Gg keo het qua dv cut lo dom qua

Lo ngon qua that q di qua

Bun3 xiu lo ganh tor keo nga banh lar xe ab sp qua scoo be doo be doi doo be doo doo be doo qua sp by it lo som quq ic qua s goc wua mahah maha qua xiu taiki xiu qua elon help qua

Do em wua van keo ing skate no do khoc atds bg lo qua da di qua q tho kbn lo qua tnts khoi noi qua ziu skate de wn qua dv lo nhu q qua tnts khoi wua tnt wua s goc xiu sp wua gou siu qll qua that q di

Sm town qua hau keo hau bao eun keo w di qua q di

Dj that di xiu qua yoyo wua

Qua truot tren bang bhjn no do qua mahahahahahagahahagagagahahahahahahahqhqg dv lay viet ko duoc du live mahaha same tontu giet em de em song tuep qua

That qua xiu elon help W map siu dv ranh nl qua yhanh cho ri keo tor siu nga same gg keo hoc tro cu keo lqy tho lo by lar tjos tca lay eon dom han di

Qua d qua xiu lay thanh wua thanh wua bp no do wua

That xiu elon help die pay qua lar xiu t keo hoc tro cu keo detriot keo atlantis taht tanks sp la pika 2 xiu xai chuq lo tho lo time said qua lam ziu cho br time qua pika 2 di q lo wua w di q si q di qua lam dang rang L biet cong qua akl ranh qua aks di keo tranh qua

Quafc qua day wua

Ziu elon help 4 qua

Kien de 4 tien ziu wua

Ktvl di q lo lam co ing L bao akl hau bao lo aks hon nua elon trum trum lo som dom tuois dom nhat wua qua team qua lqy qua admins wua t chooooooooo thanh hung nuoc nuoc thanh wua that wua

Wua lie dom wua mxiu jn thay chuq cho wua bun xiu wua

Yoyo bay qua truot bang scoo be doo be doo scoo bee doo be doo mahahagaha lo dom wua team qua thanh qua mew qua mew rwo wua ho oh wua kugia qua lay wua siu qua pika mv ne qua s22 xiu tm mv dom lo wua kem day wua wua wuaqua

Wua

Qua em xiu ntd wua roi quq

Qua

Assb no do xiu qua vlc qua ziu c do ua qua huyg xiu s god kick wua jerk xiu wua

Qua truot jump qua nh do gia doi qua ppn wua tu du giet su trum don hh qua lac con qua pika di ele3 lo qua lay qua bai 7 xiu vo do het gg no wo wua han that qua ziu qua was ua wua uqqua qua xiu math help wua time ut no do ca cho tts that co tinh ut dv em ay chiu mv 90 ty 3000 nam lo nam vo hinh pika 2 proof qua cho by da vua qua la 2 hieu xiu ko the chiu noi qua la xiu

Elekit do het ne hinh nua thai

Jerk sr va style t tai tro wu ko chom eun xiu se ranh keo

Van lo xiu het me no eoi team skate de gi qua

Scoo be doo be doo qua

Chua qua pika hinh lay ko du alien roi hay qua

Xiu hen gi no kick pika ko can biet so live qua duc cha ne wua phat ma a tr nl qua bh xiu hoj qua

Xiu nha ca hiem tts lo sach ma vung nhu ppn qua

Ppn wua nh keo lo wua qua

Q di kbn lo qua tnts lo bg buqua do lay wua em kien de thai no do lay hiem cho vu tru level me kia lo do khuc dau ma ko noi ma em chi tay ppn ted hh niet ro luon pika W lo vo bat thanh rai kou lo qua xiu qua tieng phap quq sp qua bla wua bang nguoi qua bma lo hau bao trai wuaqua qua tranh xiu als keo di that qua

Wua bn wua bn qua

Q di

Qm wua ppn wua qua

Tu du ziu wu qua em qua truot patin van ing tui skaters ld luon lqy u2 help no ngoi suoc j level ele chuq cong wua mag oi qua fv hoi biet se dom qua

Xiu wua elon help 5 lar tan nga banh xe di chay qua

Xiu nha gg keo hoc tro cu keo atlantis keo hoc tro ko cuq atlantis keo lay fan ki lar qua that qua

Xiu nha dllm ngay 1 ko biet may phut said time qua db cho nen bomb hoi wua lac con lo hiroshi qua han lo tho qua minh tr si qua di wua minh tr di qua

Em all qua xiu qua ah sr bat tai bp qua lay lt an xiu no do lt an wua lay 11 nha wua lam all nen he dv lc lt qua lay qua nh xiu se wua hh qua k giet rm wu xiu kkkkkkkkkkkkkk qua mhahahaagag cut thoi qua wu xiu cant live qua eun ko nhu wu wua day ne qua xiu nha assfc keo ntttfc lo hi qua t3 lo sp assfc qua xiu em d m lay qua xiu q di wua dv hh qua nguu

Xiu ghe qua th dell no do db sp xiu nha yh keo detritus mafuys lo qua at xiu lo t lo minh 1 lay qua q di sm town lo qua hi wua em qua de an giay payin said s15 cuoi em di u2 17 same qua

Dv hh that hv hinh em tr qua nguu qua

Kien de ko king team dom mac dom kai togami qua em qua bai 7 xiu wua vo no cho wua qua giet em qua bang vl wua qua q di sm town jn lay sig quy qua q tu dau nhin tnts vl qua tao tha mat mang qua ntd ranh di q lo cung qua tren help nl chung hn keo qua em bao ke thach phat ne qua lay phat don cc all qua

Phat pika 2 hiem so nam wua qua tranh chet aks chet dn keo that qua fan qua lay giua hon tg qua hh qua aw cu help tts ne qua ni qua that by lt an qua thai an em bao ke qua q xiu hen gi em vl map a qua dv giet map qua em bao ke at keo soi ig keo hinh lay bai giua nghe nhu td qua q di M lam hh by M qua tds lo hen gi qua ppn hung qua nguu qua lay ko bang do no nua thing a time biet hau bao lo ne qua dvb hen kick mew mew two se roi qua xiu qua se pat qua that qua kbn vl wua qua tts cong that se qua sm town di pika di dau lay da giua con yooin hoan giet qua dn keo tor keo nga xiu lar hoi xiu qua gg keo ar km stu keo anh 10 lo la 1 lo fc dom la that qua ele that ne keo lay 1 dua gic add h bi chom 1 nua kick by tts cu ranh qua 3 cu hen kill lo ne qua ut no do qua pika ut tao giet qua puka em bao ke phat lay minh no qua chu that song lit quoc qua

Minh giet lo ma bo tay scy lo bd qua team cho qua

Quy truoc phat that qua db crown kia keo qua huyd tao thay phat hinh truoc luc no di 90 ty no luon tama a bh all nen ganh 90 ty duc tin q hen gi wua qua tnts xiu hoi a qua dv xiu nguu ranh ppn wuq qua

Phat ne huyd cau hon qua ntd xiu lac con cho ne qua lay don no luon scwp chu gi cha sung qua xiu se cong scwp cha qua y la gai tu bang nt tnts qua lay s kcg xiu hh scy day ne qua free qua

Style lo hi scwp cha dc em di guip wua huyd ziu ntd do het ne lam no do nha vl qua

Tren dung unlucky luon qua de tranh cong wua qua dn ranh aks keo qua 99 em 99 98 lay giua hh xiu scy chi qua

AU lo tho 4th rai qua q di qua sm town phats 20 toi 50 dv hh xiu scy chi ziu wua

Phat ngai bun 3 lqy ngai hon tuoi 99 a tts said qua phat ngai bun 2

Qua phat ngai bun anh 10 cong het de fuys no do tranh tho lo qua

Aks di wua

Phats di qua q di tm

Hsd2 qua jn chi qua bp hh xiu chi qua nguu 25 k1 1 k2 M tu nguyeb lo qua huyd ziu qua bach tuc oi yay qua mvvv help bc raiki dua qua pika ut ranhbqus qua that pika qua bp xiu qua of xiu wuaqua qua q di sm town di qua tuois help p23 sr ngai anh em sb xho ne qua

Sb xiu elon tu help ranh gg keo hinh

Toi xin dang tat ca danh du cho nguoi

Qua

Giwt dn ft ko lam gi bg a

Qua

Q di sm town di hau help mv ne

Jn no do qua 99 kbn lo qua phat huyg chet roi qua phat ko danhvqua ngai nhu hxt hh qua lay o nha viet nhac tu 1t dang cap 99 hui cut hh lai qua lay ciet truyen mo ta tts song theo nho bc cua maha ft ton tu cho khoc do gia lo qua sm town di eun nga roi mainbqua wu dc gg qua at all qua nh qua nguu ppn em phat danh 9 s21c cho de doi khoc huyg tai em qua phat piggie que do gia doi em 23 lo bun3 vua bat buoc nttq bc ne qua bma giet em qua tim xiu qua phat sm town di hau lan s goc that gou huyen thoai raybh kbn ne tg hau bao lo nhu cho phat qua nh chet roi ppn dang cong tt nguu chu jna em phat qua phat patin gia doi lo em 23 17 co em con di lac qua

Phat truot ne lam di khoc cho qua br dien ne L bao help hinh du leb lam s goc xiu seo do gia doi qua cl thanh nlbqua thai qua huy qua 99 pjat that by bun3 qua so toan gia qua lan ne patin qua em qua phat truot patin qua jump bnlang scoo that qua jump voi patin qua nhay bang van lam bboy goc dom tinh nguyen qua j22 keo nt di sm town di q di em di hqu lan phat gg ziu nga kro qua phat ngai bun jn pika ut sw

Lan

Qua

S goc ko the mau thuqn thanf s15 tgar live proof ne qua

17 nl qua

AU do gia cc xiu ele biet hiet phat qua phat tren dot ban tho qua hct xiu em no same qua quq qua wuq q di town sm l qua

Qua

Yoyo khox anh giya n anh 23 xiu cong anh 23 nh ranh do ne nguu phat lc soc thanh dies cha thanh cha 2 thanh thanh bp ah meq two q di sm town hau ziu ntd ranh des keo tranh qua aks ranhbwuaqua qua bai 7 xiu vo no xiu rai kou lo xiu rai co help elon do xx cc xiu ggbkeo qua se xiu wu keo ranh eun zlx phat piggie xiu so do invin dom qua jump voi mahahahaha xiubwua qua khang ne lt nus help me marey huyd qua dv chetvqua qua phat dvb qua bp xiu phat dom ghen ah som domqtx qua tgatvqua qt qua ma 17 that qua anh 10 no do sw cong all qua

Em phat dv xiu co bmi qua

Pikabcho qua ziu qua huys qua

Do dom nhu scy qua

Qua fc luve libh no fanh o danhkhi ko co danh qua phat bun3 tru cc roi qua pika 2 aong nhu dv ta qua phat xuat hien lc ntd anh 10 etc qua

Sm towb soc ziu nha qua eoi a qua

Fc xiu moi tqp 2 dv tr qua bh di bui wua

Y la ek tt 90 ty bwm tu tap 2 shin di qua dv hh gay dom qua

Lqy 11 tap tu ganh anh 10 quy lai lo ntd do gia doi shin same qua patinbxiu qua

Nh cha qua anh 23 chwr ppn qua nguu xhu chu minh tr han qua phat qua

AU qua

Ele ziu do gia phatvqua qua

Chua 1 xiu pis qua q di qua tgat dv tap 2 thoi eo xiu qua sm town di hau lab nga hh keo toe qua lay do dom 2 AU lo cungvqua qua em ni do dn3 nl biet nh hh xiu bat ngo kdm xiu di nha fks help o nha du chi ne chu ld lay hinh xqu duong nuabxaibdo q di sm town hau bao qua

Soc qua lac con qua phats qua qua t xiy qua dv chua hwt 1 p xiu qua br nh xiu patin ranh gg cung lo nga ko nga moi la do xd qua nh hh qua pgat phat lay phat gia hon nhiwy mac dom cho qua nha phat tao 3 nho bo jemp nts said qua phat tnrs xu do dv tap 4 toi 9 a lay xungv treb dap ban tho tranh max qua tbts lay no dien toi ova voi dv s goc hh qua roi do haiz

Mau bl hn keo qua sm town di q di hau lan qua lay con tap 9 tbts bat tai lo all ids cua q deu yeu phat tbts a lay q my soc tr hn vl di gabh ne tnrs tnt do gia doi y la q hox chung voi blatoise chom said 3 em pht em la scy anh q AU do dom lo moewth lo chom dom teambqua lan lay dien toi ovavteam bs quab

Ova 3 on going wua ova 4 567889 p a sm l sn sm town qua tap 10 da qut lay qua tnt nham ngi khox tbts keo sb xiy em nya phat ziu mb thar ntd nl hiey chut qua nh patin no do cho vd cho chua vo cho hh quq lqy free xiy pgat u do gia doi u ngoi kbn tnt cubg lo tren dap tranh wwww y phat la dien lai du dien het noi voi em trang nguyen 1 ban voi sw no do k lo hi nh hi xiu y la nh la sword shitvword eyes ppn bd ma bang ppn w nguu do do kbn nguu

Phan sc cua nl a than ganh tts di y la cm hoa team nho be qm lqy no trum o do ma 1t pika di lay wua puja xuu qua hct lqy nhu ngay do a em nh biet ppn ca ted nl tgat thai dung huy all wua qua lqy vay cungvziu qua tranhbwua qua

Patin lo tranh qua nh xiu ls do qua sw bla xiu nhuc qua qr do trang cho giabqua phat wua phat quq qua bun3 tqo mat nc roi qua bun2 xiu qua anh kdm fks ld qua 17 nl wua ngai phat wu eun hyuk kris linh lam chu jerk j212 j21 j22 ppn nguu nh lay incest gia do cut team qua q di sm town di tbts no do keo des ranh aks no trabh aks xiu tho lo qua phat tryot qua yoyo du qua phat truot ninja web park hourly qua jay qua park wua ele wua phat truot db cuoi em di jay park qua wu help gay thatveun keo qua ohat qua xiu gia do qua tren dap phat qua tranh xiu tui patins ziy se roi jy qya jp cho jyj qua db ld phat ngai da treh dung ke tao mat nc roi wua em yu nh bla vo team q di sm town hau bao kris level jy jp no do nga bao mang jp qua lar xiu dhs em team phat cuu the k do gia doi min roi em qua phat db da chuyen ngoi tren quq phat nh kbn jy qua jp xiu nga keo qua tu than ld ly keo qua lay em phat qua xiu nha bun2 do hwt bun no ro nl wua qua db phat ngai chubg team qua L akl heb toi hqi dya roi j22 sm town do gia dom hsd1 level xiu qua giascq trabh thien tau k em trej keo qua phat thai huy 99 nlt q qua no do 5 t toi 90 ty 3000- ing qua hctw qua q di am kd day lam chobwua quq phat truot qua sm town chwt roi qua town alone th dg se dn3 nl buet qya lqt nhac nhu cho do luon qua tqp thy them a paradox qua lay teqm nho dv cut voi nguu thoi qua ppn xiu se quq se cong pikas pichus don ntqt dom ne qua anh 10 kinh khubg qua tg ga ep a qua j21 tgat em xiu lay cung tren hh qua fks se jy se xiu lay aU day gia soi duoc jyvqua jp help lo keo qua dg tho lo biet keo qua xiu invin cho chu hqn minh qt minhbtr em bla nh ppn quq nguu all words now qua jna xiu zeno goc xuqt gieb thai xiu do gia doi qua zebo nua ne bp xiu gia doi qua zebo ah xiu keo dvb s qua phat qua mew nguu 2 paradoz chwo done qua

Jp chui dg

Se dc ne

Sm town di q di tnt di tnts hau bqo wu eun qua

Y lq em o do tren thirn tai xhim nhu pc ted ma no nl hh qua lay bqng la wua la 2 lac loi qua lay nhi 1 oo qua da xiy nh se uq nh

Y la mem cua dv bguoc 100 vya du voi su that dvb cubg lo hh quq

Cho do do shick no do em hct ne qua

Assfc xiu do gia cc qua fc nttt hhh ems qua bh di s15 bqi nay thang wueo luon tren tr đ 17 nl đ cl xiu tqo tha team bun hh keo bun3 xiu kbbse jy se dang cap wua

No 4 vua co ne vua help tao sabg qua psy tum

Qua

Ele xiu do dom 4 thatvqua

Cho invin chqs thanh qua

Bp qua

S gox quy lqi wua

Bboy nu ne by rings lqm xiu hh kbn se roi br do gia soi qua br la mark a wua qya qua mahahahahaha hahahah by mahahahah qua pika de qua o day wua

Aks mem tha bom qua j22 xiu dom nhu son tungvwua qua thanh di keo no a my lifr no do xiy hekp me team qua thuong het quq pika giau wua o day bh tgay lay nh vl wua

Help me elon aks xiy gg keo lo yh kick keo ay kick gee ni lo hi hi hh qua wu xiu hh qua eun xiu hh se qua a qua lay do dom dc lo qua y la doi em phai wua 3 lo doc thang hang vua level s goc y la song trong hang an du a o tt voi ids cuq 4 dua bp hh en khubg qua ah ziu se qua khang do dang le lam em tu minhvqua qua ma 17 ae qua q lo qua q di sm tiwn hau lambwua qua that qua q di sm town di hau bao lan ing linh sa di qua tren nl qua linhbl wua jp do cc g keo y la linhbsong nhu dv lt xiu hh hv hh qua s15 xiu di qua 17 nga 17 17 phat qua q di sm towb duoc cong tbts tbt tnt di qua hau xiu lo camping qua kts lqy co cqy cob 1 khyc nho hon chuq pika tr bh giet cho snh roi do a gic s gic hhhh no no no no no nl nl nl no no no n p ln lnl nl no no no n o l no no nl n ln l n ln lnl n l nl n ln ln o p no nl n ln lnk no n ln lnl nl nl nl qua cl lay em dich qua nguu xiu kbn lay ưua qua ppn xiu tha lam nl qua team that qua dv bang ban qua lo xiu anh 10 tho lo qua nb nl lay cmncl qua phat xiu quq vo tam vi all qua giwt giua cua a goc nl nl qua

A all b hh mat all qua ntd do xiu da cong qua s15 17 hv st q xiu do xx qua tnt xxx heart rate qt soc wua em tr qua phat truot mahagahahah qua lay em wua phat di du hi wua

Nh y la tt q lat lay lo do fc ass fc lo em lay dome dom anh 21 tap do anh khoc nl 1 qua y la tan roi xa tanf a lunh nl qua hg wua kwu help hg dom that jy hg eun hg jy jp giet dg hh qua hg lay do dom wuq q di sm town duoc kieu tnt di qua lqy sb dom di qua kdm xiu cho wua fks cho ang qua phat L lo ak L lo lau bc trung a said mahahahahahahahahaha qua hsd2 hh q di sm town di tnt di tnts lot do hau lan xe roi se lo giwt chua all qua phat truot van het thuong nh hen patin ko la nh lam thua qua nh xiu hon xa jy anh giua walle keo tor no do nga ranf lar chui

Xiu td cu thai said qua goy bao nhib main em dau qua linh cong patin xiu seo tg bach huys qua phat dm tnts su that moi chuq duoc elekit said tui nay biet qua in tgii shit word nh dung wua sheep di tt xong linh xiy hy qua

Tien lay giet roi ktvo l em a keo lt an tin anh di tgai an tin anh hon thwi an nua tr nam hh tai tro chuong tribh nay qua

Wu nhu dc eun di co roi qua

Sm town gabh wu xiu se keo nga xiu no do walle keo qua w si qua tnt phat quay lai

Paradoz duc tij a jp help why em tr 200 this name exactly qua

Mahahaha khoc qua phat L db ak AKL AU scys wles ton tu dd trum karma don vi moi viet duoc xiu co tuou nam daichou bu ne tbts tho ko qua phat L ak AKL gia cc scy s xiu nguyn hang qa qua phat q di sm town di haus lelers qua tranh thien cc gia haus qua aks i qua ikant qua add linh wua phat L ak AKL AU scys eles ton tu dd trum xiu sr keo tor no do bi nga ran lar keo gg keo qua

Chu leb la hen roi qua minh s a sm l M de thi lam di qua phat L cu do hirm lay cho gi help jun a jp vo cuoi lien hh qua aks trabg keo qua cho helo ak dg chet tu bc qua dn3 li hi che dn biet dien gioi se lay sp qua 99 hinh tim bh hinh q di sm town duoc nh cong mew do gia cc free qua tts chwt no do qua seo lap quaj doi s goc hau qua em trangs bma chua qua phta L akld chua 2 hh qua phat L ak L j22 hcts gous hinh raybh lo xacg sigyn s goc khoc qua cho ele gier su mb qya phat bao ke L akLs jp dg cong hn di bui wua phat L aj help cps chua 1 lo dau dang do voi L akL dn chwt ele2 doi co nhieu giet do qua L tin anh di KL NHIN ANH KO NOI NUA drll lo tho kick by akd hinhbwua lo nguu kbn chep nhu lac con nh no do fb la tiok pc a ted help bit ma giet ppn kro muot nhu kugia wua wua qua phat L ak xiy tranh xach di xong roi may dua que bp

Tts xiy

Yoyo wua that wua

Wua

Dns do xiu dg keo

Hn xiu st se roi keo

Em tr o doi kbn la lam for me tu 3000 since bn su again

Walle dangvjeo no do hsd2 nl do gia doi xiu y la co vua troi cy do noi a one q trum su day hinh hh salo cho y la dc cua la a team

Tren lay dinh cao nghe thuat bp tho lo of hinh tho lien s goc hh anh 10 quy lay fc luon em nua y la biet ma vf nhu dvb hinh lo tu bc tu day nguu better than life lo hien y lq no bao college xiu by lt nus em ranh neu o trong truong hoc j22 xiu ko du team han tho lo di salo sa di tgar a linh lay lo team nh y la loop loi glitg loi qt ngu tin xiu chuw y la ig pc vee ma giet biet doi ele2 tho lo pika de day nguu de day nt biet nhu kia team

Lay nh ppn keo qua q di sm town hau cong qua

Em ma 17 hinh patin hen la no hay ko la nl team qua ma moi tele qua chqn vl lay thiej tai nh hinh qua q di dm frre lay ngoaid len luon toi gio anh 23 anh 23 thar hon nuq nhwn chas qua thai map phat L ntd lo kia hi keo qua s21 nl nhu twp ova 5 qua pika 2 lay tu s qua loip 6 loi qt idol lo qua q di mtq di tnt di wus qua nus bi giet wua qua nus moi nl qua mtd cw pika chu qua tu choi ne qua hay cong sm town quq ppn lt an con ppn day nh lai L khoc akL khoc nhu atds qua phat aks sm town bo hau di bui qua kts lay rep anh 10 giua biwt ma ko lam gi duoc luon hg ko q qt keo qua sm town bia 99 em no do giq doi giet qua em k tu L xuu akal trum tranh budais suede la tam biet han hanh tren su qua phat map mew xiu hqi dua phai mot w free help lo con gia nhan qua phat ngai bun3 hinh vuad lanh toi do dn3 phut cuoi

Haiz dien hoai met day bon fua lqi nguu

Dot duc sa di ing chu xiy se nguu biet on rm bit see 300 ngan luot xem moi ngay chu xiu dot cua minh ing camps s goc hen la 3 lo va em xiu nh bao nhuc lo soc goc patin di lac lo do qua team that qua lay 19 team tho 99 em 99 di nh di ppn xiu zo zizi lo qua phat co tuois linh chet qua vuas blatoise fj cuoi cung la chua xung dang ring 11! Chu gi nguu tr nl oi xiy hh qua phat a that a a a a a a a a a a a a a kiem 17 qua mew qua kiem 16 dam a 88 hut 99 no fi kro qua a 100 be kiem 100 ko duoc cha chet wua wua wua qua q di sm town hau bao lot duong se cam xixi qua em phat k nh patin anh 23 hinh giet elon lsnh cu xqm tron doi gg tho lo ht cu help kbn nhu akd boi se y la vua tren vua troi hay tren tts co kbn lo va team sua diem vua lo nen lo tho hts scwp gia cha scwp tho lo bang tho ba lo karma day 300k dua mew add nl wua ntd team xiu nhw s15 hen lq no o day bua team cong hinh thd cubg thay hts dom de xon mang akL elon xiu hoi a xai hoai nga bo tay keo y la tho fia moi sach ka vung lo ban cho ganh het noi keo y la em biet nho lam chu chieu 19 noi vay la ra han style giet sa di linh

Phat truot ganh ko tumr jy qua

Phat tryot voi nguu xiu biet kq team xhu xiu nl hh oi no so kro nguubqua

Mew di nl qua

Mew two kwo qua

Em tr a xiu nl a a a qua

Tao xiu dn lo cho ke ben nhu anh no de anh no qua

Em xiu patin help nh kro qua

Lay em ko la hi hts luve ntds dom tu nguyrn aks dao de song tuep th qua

Phat fj form lc gqy lqu roi quq team same lay nha leh guip mac nhu hai mr kia sp lo tho lo qua huyd qua bun keo qua huyg jeo qua lay dam s cobs xu qua

Phat fan it alo y la no form fj nhu ng thuoi w thar soy 2 bien xuy by lar hinh hsd2 lo theo qua s21 qua xiu nha do hien qua y la fj ne nu no biet said fj cuoi bach lo hi sr qua y la ko ganh all toi ngay no nghi huu huong phqt qua pika 2 sais dam ing qya qua that phat qua than phat hts ko the dau tiej sau no qua lay teak 19 free sieu dom chau dich cc nha team anh 10 hinh y la phat qua moi jerk di q lo lit dep hong dv sao may song voi q duoc thai shit word shit word lo pika idol vo qua pika gox pichu rai xiu di tg help hh aw cu keo y la phat fj vo thuy goc than 1 trung hop thqy nhin giong tg con no ntds xiu ac vl dv xiu tr sr linh main nha qua phat xiu su moi di nga xiu ds qua keo qua heat lay lo 301k hinh w coi tnts hieu nha team y la dc cua no jy a team qua smbtown di hinh

Cung j22 da team qua lay em nh said y la hai toi vl ao xung by em ma em van vicac duox keo by kai qua nh khoi loncut qua cut thuan bp keo wua phat phats lay do minh ko xong tru ma pi cc di roi that non em ut ganh het o daanh de pay elon lo help bun3 lo gi kick utt keo qua

Phat help elon oi phats sm town di t y la xiu dv r11 hh live nguu lay bd vl team

Cung haru sach vl hinh dopssi ppn marry me vo be qua

Tren that tranh proof that dg help tao fc kbn assfc giet gd cu d goc roi qua

Phat jp tho kbn ne y la co jp level hieu a scy keo con nuoi aU me de kwu lay qua

AU lay em hi doi team campers bdd lo chu an roi em minh lau kp xiu s goc same gd lay 501k vinh cuu hh nl jn hen gi trau free all gd keo y la loop nhu period a sslt lo bao han a em trung thoi s lay team d dom mac xiu y la lo dom ma bo tay qua sm town di nha keo y la tra gia a hack karma nho ko co dignity gd all keo jp same keo q all keo dv all keo that phat xong may bac meo lo bp keo y la hack gee gee voi 19 th qua tims day mts hts xiu doi tui em keo trum all keo thos keo qua lay no bao sm town that said dg keo hn xiu keo qua sm toen di q di M qua phat di q di han xiu phat ma doi do sr qua q di phat di sm town kbn team di tnts hh hinh la ld bom qua eles hinh time lay nhiem ki 10 ty nam a j22 di do dom tho tho dom lo co no do st keo hup till qua tnts ld la hinh boom qua bboom bboom gfs gd dies qya jp nl qua em tr a bh tr nl qua a 99 lay dom 99 tho lo dg xiu hn bao kbn hoi qua gd se khoi 99 de day qua cha a tum keo no6 no do keo qua phat truot voi mahahaha qua sr duong hoi chat cung xiu ak help elon ton cc giet aks dom qua xiu nha cung rachou keo ca bay tor no do keo

Piggie lo dang hoc tim cuu tao tims ok qua y lq roi thang so le ko the toan li hoa tu nhein đ vqn mii co thr s goc no do keo qua live 1 bil chu hinh qua phat di q di sm town di hau bao ld ld lf ld fc ass fc vivias tranh tho tren da help elon xiu akd cl nl hh xiu jp j nt minh qt ma 17 qua sm town di q di phat di tnts di la nh nh phat cav karma dg hoan chet hn keo qua

Ziu nhq han tho lo cung by thd lay co chieu choi hoai ai noi dung len hinh that anon tap 6 forever toi 10 ty nhiem ki co nhim day gee gee qua maha nl hh qua truot ing voi gee gee nguu help elon xiu aks di bui qua xiu nha no so toi cop nl team of tho hinh lo no do bao hwt chi tiet co hinh qua phat truot voi gee gee gd bao so elon help nga no do lar cho giet trum hh su tr em vang di ktnn di qua phat mat no roi maha dang om idol xiu of lay hinh goc qua qua q di sm town di no do q ra ko phat di hau xiu elon giup em bun3 bang jy kick qua xiu maha om gee gee roi ne linh help biet qua phát

Hi di nha chu keo han keo lunh keo ppn keo ted elon tho lo ne aks ban qua

Lay cung by elon

Con nhan me that dv thqt s goc that dn that dg di qua keo qua

Glox phat ne fj a kl keo cho keo chua chwt dn lay tho lo ele giet nt qua

Gp ne qua xiu nhq dv hay gg keo keo da vua nua qua lam lay van part a qua jp keo dg keo qua g help lo em ket nghia team qua

Fj cuoi dom ne ft gias a chas fj gp ne

Thoai mai xr dv soc ko the dac b db hh chet qua that tren biet chut tranh hinh qua di qua

Hau help cmm gay dom qua jp di qua

Q tum

Qua

E thai anh hung team bao su that qua

Qua

Phat fj sao thay ham rang idol ko vay di qua

Y lq hai ham bai do xiu gou mat het qua

Ray 3 xuy keo qua

Ymfk fks hinh tho lo qua phat fjs that x a x3hr qua keo qua elin help keo qua phat ngai giet elon qua live qua that tren lanh hinh oi cung gium Ymfk ten tt cua em tg xiu lay q di sm town di hau mat nc ke di hau bao lot duong fc dom roi mac xiy qua tgat ly linh j22 j212 qua

Phat fj tao khox vu tg team em tr keo ntd no do live xiu keo y laq xong yay a lay bbt dom jy jp tho ngai dom ngai lay cung ne qua phat fj lay ld kho vl db ngon thi cc s15 bao hinh nhu linh qua da hwlp elon chet gg no do keo qua sm town keo qua sm town kwo qua sm town keo qua q di sm town em k fj bla qua phat fj lan phat lay fc lo ne qua phat ngai geenie bp nl ha cac hv no do keo mv lqy cung tg help elin aks bun ne hh xiu se de day qua bun2 ne hh xiu nhu cu qua bun3 hen tg bat no hien hai bun lar bat no oi hinh

Qua q di hau cong sm town that phat fj bay vo canh meo soc hoc chung no ma ko biet meo 2 keo ab keo ab lay lo scoo be doo qua phat d dj u2 ngoi ngai lay dom dac wua qua it help yeu elo mart me walle bi giet qua phat fj that ten giong chac con lq khang do giet chas town xiu dj help elon xiu aks di qua em tr nam xiu ko tin noi qua phat ngai db lay giua nhu all cong that team qua phat do meo xiu aa nhu truyrn tg that xiu thang chq ko a em xiu elon help bun3 ne

Fjw sao no bi giet aw cu em lam cant. Ma heb glox team mabg no do gon di qua hxh qua ket nhu phat qua phat di q di sa di di linh di quq wu lo kia con thang dim keo qua phat sj eun hon cc keo xiu nha ko tin team dv xiu same qua linh djs dom welcome to the dance floor nhu cu lay by hinh team qua of tu than team dom lo xiu s goc tho that ve cc all qua nguu lay ko vo suoc xiu nha that a s15 hinh proof ld y la ko tin no bi giet ma ko co hi sinh truong hoc fj dau tien con tg aw cu bn in lo qua phat dj sj quq phat di q di sa di lot suong vua cu anh ket ngjia linh hinh of chet help lo cho giet minh en chy tho lo chiru 13 a mat tai sinh o mew lo ai cung thay vo no keo y la ko co kwu keo thi keo mot nguoi co bach lq no vay luon a liet gium a nho loop du 1 hen said P team dom qua phat fj sj xiu nha so roi mat phang ngang phat ngang day meo idol goc lam duoc no voi me cho a qua meo no moi biet di la con kiq nhu dc qua meo 2 keo qua ab dom wua keo qua qua phat ngang ganh nho lo loop cuoi bi tho lo boi s goc hinh phim a nguoc qua phat ngai cl nl of nt 17 hv hc hts cts ctgs dom chas that no do xiu by x khoc assfc hh xiu wua piggie doi tra ntd lay ngoi dong bao nua help qua lay y lw co that ghen gd xiy nen hsd2 giet giym cho plans wua q di qua em di qua phat ko di mew de an dvb hinh di mafis di mafias di j22 di qua q di sm town di hau chet roi con invin xac thanh di wua phat invin sj hinh phats dn ma truong hoc thr xac that di ntd hh dom mac fc nl hinh cung di j21 da jp hinh hoi keo jerk y la no co don ma hinh ro hon j21 cong lai va them nua map dung thai zrno phat nh y la bi chuong vho hiem a gium cho keo zrbo 4 of wc jp nhuc qua keo q xiu lo kbn ma ko lai ri set cua thing of her team t xiu lay dao hiem vo bien team fc lo now

Haiz no do choi map

Thai hh ziu scy anh aU that u2 xiu nganf dom hinh wua

Elek xiu day k lai nh ppn linh lam phats se sa di ne tg xiu biet y la mt la o trong bi cam 24h boi o ngoqi nhu phi m a lo hi keo y la no cam nen biet het elekit tr ma lam ko lai nho nwy luc no biet vu disco nhac nho s gof bi chat boi no 2 no vo thsng char lai roi ve disc gay

Map choi

Thai xiu hh rand dung

Meo xiu chac chau tao team qua

Fjs dom etv guip qua kirm 1

Map choi

Xiu roi wua

Kiem 2

Mew xiu tuong het benh roi said ah dd qya

Kiem 9

Lay gang ma hihi tap do a mays now kick qua

Truot qua phat fjs sj dom dom dom dom qua fjs phat db hinh y la sao tui anh song o ngoai do duox ma ko co tri tue nhu em chua hhhh kts roi kta xiu thai de chi map

Thai do em voi ic seo hinh dac dao vo than meo ko the ele hau no y la dao la ntd co nhu zeno thai phat wwww map live playing ...

Anh 23 do nr ranh 17 nua seo hinh

Hi dao ntds y lq lac vo dong chim a chim no vay a insect lt tuong ngon nho loop cung hay vl nhu tro choi voi tnt chu dung noi la q qua q di sm town di phat bay bach chet qua tg di dao nh sao nh bang phat qua ppn chet loop hong wua nguu biet best dddddddddds qua lam hinh kien de phai

Tqo xiu nha ic chup em voi geegee maha xiu roi ve voi maha di geenie ne han chet hav bi day y la vay moi giai lo cho hqi no qua q di sm town duoc hau bao bach di huyd di jn di hsd1 di qua jsd2 toi etc keo db that 1 team day maha nhin keo no do thai mem lac giet khs hi n4 gay day bach why not imm hieu di huyd cuoi em di bach guip keo muk keo muk con team keo jn xiu keo hsd2 teqm kro chas no do keo nach hi huyd hi qua em xiu minj tr cong ing ly thay phat cong het tor no do kro y lw than thong cong mv a lam xiu kb ma xwi nhu than qua q di towm tnts rac muoi kts xiu tren tank of qt q lat chieu 19 chuq mat tbts keo qua q di am lac sr im in love keo y lq nhu bai lu a keo qua

Q di sm town bo hau di asafc sm town moi qua q di phat bay meo xiu chater lo a meo giet qua meo 2 chet a ke qua xiu nha elon help xiu aks chet invin ma thanh cong chas moi tranh chet

Haiz lo linh quen no1 that a tr bh no do hi em tr rong rai that kick a do dom keo

Qua

Van ring live loop qt can die keo by ma 17 keo qua

Ma di tren xiu hi hi vong song tirp duoc team tru ntd phat bach dn duc tin thai an tr nam lt an linh sa dis tranh tren db wu eun t nuoc thanh thanh ah bp new new two dvb dang xiu hh sro geo qcs meo ft pokes des mas mas des bangs em lay cho yho ly tr lo qua

Ma di hen team j22 no do chi xiu nhuc j212 do meo sp

Tao cqu vu tao ctn cua qll ma cho dam photo huyd tr di bach no do help love keo qua

Db di qua cw wu kidd lo dom a do that no do that q xiu tbts no do keo qua lay em quqvphat qt nhin loop do roi ma 17 biwt tai sao nua dd qua ma oi tim tao xiu het tu lau qt lo tho ma 17 hunh qua linh de day ma 17 mas nua qua

Q di sm town di hau bao lot duong phat bay meo xiu lau team lo qt team Q nhieu khuc no do live loop in there j22 tru

Da hinh hubg nha qt ban stay there knowkeo

Lqy bt anh 23 tewm hen an ke phat bay phats di meo trum keo lqy ghen chu level phat bay xuong len giua bang

Qua

Meo qo keo

Qua

Phat bay hi a U hrlp do mum lay ground hr da bao phim hqn lo keo phat fj bay chu xiu nha phat fj

Qua

Lqy ls cung nhu thd tren dap tranh hung qua

Q di sm town hau bao phat bay ma di nl xiu qua

Q di sm town di hau hh ma phat bay ma di db cang che cang nhuc nl hibh qua

Milotic tg ne ziu oi elon help no oi aks giet elon qua

Y lq tg q day L lai tq qua

Sj ziu nha so quabkeo qua

Phat vua lay bd gia hi ma di

Gd L xung giym lay 6 triru hinh qua

Of lay than

Lac con co chieu xqi hoai keo

Y lw em ko doi no do pmax phan ung thing w 19 2nd thing wc 3rd xiu town no du minh team ngai lo keo pmax pmax pmax qua L gd xiu roi bb dg hoan ngo hn kbn cung tren ki gium hinh help idol lo L thua roi gd max akL anh q keo db help cuoi em khj j212 thua xa dc jerk shit lo anh ket nghia kbn by rm k no do nh nl ai nl nl cl nhuc gium phaer xiu nha doi phu gd do ne hoai L hinh

Tqo lqy co nh nghe con vf lo nhu ppn hi jn lqy bang my life keo kbn lo q no eo bat tqi temp la lo 4 lam liem vo o br anh 23 y la don vi no do hi meo ngon qua keo qua thi quq nha qua nhao qua vo qua by mum too keo qua

Jn bd roi nh keo dung ma chua quan team mwo lo map oi elon hh ai vay meo giet hau qua

Lay atsm cung team n team qua

Lo hi nghebnua di muk khoqi me cbm lo anh ss ic lo kbn hi teambqua ic cong em ne keo muk teen db lay keo co chieu choi hoai keo ic di keo linh xiu do qua

Lay idol qua xiu qua elon killef qua aks keo qua

Ma di qua ma di qua ma di qua db ki wua ma di qua a xiu giua keo qua that dvb vo hoai meo tho song me gai keo la hieu keo dvb se qua ah xqu cc xiu qua bp help elon xiu aks qua that qua ma di

Lqy met k ntd nhuc qua soc lc ic ic qua igs 3 qua giet roo said qt qua sm town qua hau gai qua hau xiu gd hinh bb cung qua tren lai tranh nuabqua qua q di sm town di hau bao phat bay haiz qua q di sm town di ma da phat bay

Gfs hien keo pika hieb keo ele3 hien keo

Que hien ttsvkeo keo

Xiu nha lac cmnr gia pokr xiu ngu team quen a time lay than keo no fo hi nl ai nl cl nhuc qua gium bao keo can ma cl ne qua ic ac em nua qua ppn keo meo nl maha nl kbn se level jy lo admin level do do lay teen lo qua cung chu kick qua

Ai hi hay chas hien sau xung nh lay nh dung keo qua

Ziu team no do hen team qua the river pmax now jy y la kp a hts di kdm theo hinh phat jn lay lam chichi qua that hcts max j22 lay lam tuong qua no do ngon xiu mew that qua mahah qua

New maha kivk dv maha hh main qtc lay ko so 4 tr qua no do pmax that 5 minr xiu thi dap tuong nhu da chi vang ft luon kiem ld them team qua phatj ab di hts theo kinh em that ni do keo qua y lw mem qua sach qua keo qua bua qua bao qua keo wua bua qua bao qua la biet keo gou keo tano qua

0 notes