#implementation of android edittext | Explore Tumblr posts and blogs

veworgoogle · 3 years ago

Text

Text encoding android

TEXT ENCODING ANDROID HOW TO

TEXT ENCODING ANDROID INSTALL

TEXT ENCODING ANDROID UPDATE

TEXT ENCODING ANDROID ANDROID

TEXT ENCODING ANDROID CODE

Public class MainActivity extends Activity implements OnClickListener else if (a1 = 10 & val. NET object types to a JSON string, and vice versa, supporting UTF-8 text encoding. JSON example can be created by object and array. The wire size is much larger than it needs to be, and may not be compatible with other JSON code.

TEXT ENCODING ANDROID CODE

To implement the UI of the activity invoke the following code inside the activity_main.xml file.У меня есть один textview, один edittext и одна кнопка в моем приложении.

TEXT ENCODING ANDROID ANDROID

The main layout and one, which includes only a TextView and as varied as we go on discuss the various contexts. How can I validate EditText input in Android - This example demonstrate about How can I validate EditText input in Android.Step 1 Create a new project in A.Step 2: Working with the activity_main.xml file

TEXT ENCODING ANDROID HOW TO

Refer to Android | How to Create/Start a New Project in Android Studio? to know how To Create an empty activity Android Studio project.

Create an empty activity Android Studio Project.

Have a look at the following list and image to get an idea of the overall discussion. For example, if the important part of the information is to be highlighted then the substring that contains, it is to be italicized or it has to be made bold, one more scenario is where if the information in TextView contains a hyperlink that directs to a particular web URL then it has to be spanned with hyperlink and has to be underlined. This TextView widget in android can be dynamized in various contexts. This plays a very important role in the UI experience and depends on how the information is displayed to the user. TextView in Android is one of the basic and important UI elements. Open the converted file in the app of your choice. Supports virtually all charsets through ICU4J, such as GB18030, BIG5, etc.

How to Convert Kotlin Code to Java Code in Android Studio? The Text Encoding Language Converter can convert the text file back to the language you want Auto-detect the language and encoding that your text file is in.

Firebase Authentication with Phone Number OTP in Android.

External Storage in Android with Example.

Image Slider in Android using ViewPager.

TEXT ENCODING ANDROID INSTALL

How to Fix “Failed to install the following Android SDK packages as some licenses have not been accepted” Error in Android Studio?.

How to Create and Add Data to SQLite Database in Android?.

How to Push Notification in Android using Firebase Cloud Messaging?.

Fix "Unable to locate adb within SDK" in Android Studio.

Broadcast Receiver in Android With Example.

How to change the color of Action Bar in an Android App?.

When you enter a string in the given input box, the tool will start automatically encoding it.

How to Install and Set up Android Studio on Windows? All you have to do is enter the simple text in the input box, and the text will be automatically encoded.

How to Change the Color of Status Bar in an Android App?.

Content Providers in Android with Example The Text Encoding Language Converter can convert the text file back to the language you want Auto-detect the language and encoding that your text file is in Supports virtually all charsets.

This would explain why you got a rectangular box as the handset is not able to decipher the encoding.

TEXT ENCODING ANDROID UPDATE

How to Update Gradle in Android Studio? 5 SMS, generally, uses the 7-bit GSM encoding standard, however a quick cursory glance with google-fu yielded this answer posted on StackOverflow which seems to say that Apple uses UTF-16 (Unicode encoding).How to Add and Customize Back Button of Action Bar in Android?.Android Projects - From Basic to Advanced Level.MVVM (Model View ViewModel) Architecture Pattern in Android.How to Change the Background Color of Button in Android using ColorStateList?.ISRO CS Syllabus for Scientist/Engineer Exam.ISRO CS Original Papers and Official Keys.GATE CS Original Papers and Official Keys.

#Text encoding android

0 notes

globalteachonline · 3 years ago

Text

What you'll learn Implementing Material Design Feature at the end of this course will be a piece of cake for studentsThe concept of this awesome feature provided for Android App Development will be crystal clear.Material design is a comprehensive guide for visual, motion, and interaction design across platforms and devices. This course talks about all the important material design specifications, colors, design guidelines, and also using material widgets along with material themes and concepts. Curious about Android Material Design? This is the your final stop where you will get information regarding material design specifications and the related widgets being used with material design themes. The best part of this course is that you will learn to make several complete android demo apps from scratch - two major apps and several small apps - based on material design guidelines. Enhance your application user interface designing skills by implementing all new materialistic features introduced in Android Lollipop 5.0. Styling of Android Application is very important and one of the most critical feature in designing the app. To make this difficult task easy, I have come up with this course of Android Material Design, which begins with the basics of the material design and proceeds with covering some really complicated and most interesting stuffs like Android Material Design Animation. We will also dive into the material design support library and implement it in our demo applications. The topics we will be covering includes: 1. Material Design Themes and Colors Color PaletteMaterial Design ThemesMaintaining Backward CompatibilityExploring Tinting of Widgets 2. Material Design Toolbar Popup Menu or Overflow MenuContextual MenuToolbar Theme Customisation 3. Basic components of Android Material Design Floating Action ButtonSnackbarCoordinator Layout 4. Android Material Design Animation Ripple Effect: Touch FeedbackSlide Activity TransitionShared Element TransitionExplode Activity TransitionFade TransitionActivity Transition Overlaps 5. EditText with Floating Label Implementing Floating HintsValidation of TextFieldsValidation Error Resolution 6. AppbarLayout and CollapsingToolbarLayout Using AppBarLayout with Scroll FlagsHow to collapse Image along with CollapsingToolbarLayoutExploring various pin modes 7. RecyclerView and CardView Implementing RecyclerView in various orientationsUsing CardView to create list itemsAdding and Deleting an Item from RecyclerViewRecyclerView AnimationGrid, Staggered Grid Implementations 8. Navigation Drawer using NavigationView Inflate menu items in the Navigation Drawer using NavigationViewAdding dividers between the menu itemsGrouping the menu items under one category By the end of this series, you will be mastering the implementation of this features in your android app.Who this course is for:Students should have basic knowledge of Android Application Development. What are the basic components of an Android Application and the basic Hello World Program.

0 notes

jacob-cs · 5 years ago

Text

kotlin android 개발 날씨앱 만들기 과정 요약

original source : https://www.youtube.com/playlist?list=PLEPZdzLLJH94Jk_Jz-cTUXYFoObPBH7KB

시애틀에 있는 수염난 안경낀 백인 청년 설명

data binding을 위해서 gradle에서 해야할 작업

data binding의 장점

3rd party image loading library들 이 강의에서는 coil을 사용

toolbar를 app bar로 사용하면서 navigation component를 사용하는 경우

tool bar를 app bar로 사용하는 경우 약간의 material 느낌을 주기위해 AppBarLayout를 이용한 경우

coil를 사용해 image loading한경우

json converting을 위해 moshi를 사용한 경우

retrofit

민감한 data를 외부에 놓고 사용하는 방법

외부에서 전달되는 json data의 키와는 다른 field명을 쓰고 싶을때

외부와 data 통신시에 보안을 위해 usesCleartextTraffic을 사용한다.

1강

0:01 - Week 0 Review

1:22 - Syllabus Review

2:40 - Class Announcements

6:14 - Why Learn App Development?

9:26 - Challenges of App Development

15:34 - Types of Mobile Development

22:36 - Why Android Development?

27:42 - Setting Up Our Android Development Environment

28:34 - Installing Android Studio

36:12 - Creating Your First Android Studio Project

39:17 - Creating An Android Emulator

41:52 - Installing Your First Android App

45:14 - Sharing An Android Studio Project to GitHub

50:06 - Building An Android APK

- What are the unique benefits and challenges of Android app development?

- What are some different ways of building mobile apps?

- What makes Android the most popular mobile operating system?

- What is Android Studio?

- What is the Android Emulator?

- What is Kotlin?

- How do you create a new Android project?

- How do you share code from Android Studio to GitHub?

- How do you add a README to your GitHub repo?

2강

0:36 - Outline

1:57 - Android Framework Components

14:07 - What is generated when you create a new Android Studio project?

40:26 - Working with Android Activities

41:20 - Android Activity lifecycle

50:12 - Using the Android Studio debugger // How to set a breakpoint in Android Studio?

59:38 - Creating Interactive User Interfaces

1:01:46 - What is FrameLayout?

1:05:09 - What is LinearLayout?

1:08:34 - What is RelativeLayout?

1:14:22 - What is ConstraintLayout?

1:28:09 - Responding To User Interaction

1:29:00 - ConstraintLayout simple tutorial

1:29:37 - How to create a new Vector Asset in Android Studio?

1:38:46 - How to respond to a Button click in Android

1:40:04 - Android Button setOnClickHandler

1:45:40 - Receiving user input using an EditText

1:54:00 - Customize Material Design theme in Android Studio

- What are the Android app components?

- What is an Android Activity?

- What is generated when we create a new Android Studio project?

- What is the Android Activity lifecycle?

- What is the difference between an Android ViewGroup and a View?

- What is a FrameLayout? LinearLayout? Relative Layout? ConstraintLayout?

- How to build a simple UI using ConstraintLayout?

- How do define an Android click listener?

- How to show a Toast message in an Android Activity?

- How to enable Android developer options?

- How to use an EditText to receive user input?

3강

- How to display dynamic content in an app?

- How to display large collections of data?

- How to architect your app to provide data to your Activity?

- What is MVVM?

- What is LiveData?

- How to model data with Kotlin data classes?

- How to create a RecyclerView Adapter?

- How to bind data using a RecyclerView ViewHolder?

- How to define an onClickHandler for your RecyclerView?

- How to format String resources?

0:25 - Outline

2:17 - Project Demo

3:56 - Displaying Dynamic Data

5:05 - Dynamic view containers // ScrollView, ListView, ViewPager

6:57 - RecyclerView

7:50 - Why RecyclerView?

16:47 - Defining A Data Model

20:00 - Modeling data with Kotlin data classes

24:25 - What is LiveData?

28:08 - Implementing A RecyclerView

29:23 - Creating a data class to model daily weather forecasts

31:50 - Creating a data repository

32:04 - Using LiveData to expose data from a repository

49:54 - Adding a RecyclerView to your layout xml file

52:37 - How to use Logcat to understand why your app crashed

54:58 - Add RecyclerView dependency to your build.gradle file

57:52 - How to add margin to your RecyclerView using ConstraintLayout design view?

1:01:57 - How to implement a RecyclerView Adapter using Kotlin?

1:30:38 - Add touch feedback to RecyclerView list items

1:40:00 - How to format String resources?

4강

- How to create a new Android Activity?

- How to use an Intent to open a new Activity when a button is clicked?

- How to display an options Menu

- How to respond to a Menu item click?

- How to display an AlertDialog?

- How to save a value using SharedPreferences?

5강

- How to create a new Fragment

- How to migrate UI/logic from an Activity to a Fragment

- How to communicate between a Fragment and an Activity

- How to add a FloatingActionButton to your UI

6강

- What is the Android Navigation Architecture Component?

- What problems is it trying to solve?

- How to create a navigation graph?

- How to add new destinations and actions to your navigation graph?

- How to navigate to a new Fragment using the NavController?

- How to update your AppBar based on navigation changes?

- How to implement a BottomNavigationView?

7강

- How to load data from a remote api using Retrofit; an HTTP client library for Android/JVM?

- How to listen to changes in SharedPreferences values?

- How to load and display remote images using the Coil image loading library

#kotlin #android #weather

0 notes

vlemonn · 8 years ago

Video

In this video we are going to implement a custom ListView for our Electronic Shop android app. Our custom ListView contains an ImageView for displaying product image, two TextView for product name and product price, Two ImageButton for increment and decrements the quantity of the product to purchase and finally an EditText to display product quantity selected by end user.

For Complete Source Code and Code to copy please visit below blog Post.

Blog Post: https://vlemonn.com/Blog/Android/Android-Custom-ListView-with-ImageView-EditText-and-Button

If you want to download complete project download button is the bottom of the article.

Key Points 1. ListView 2. Adapter 3. getView function 4. What is convertView 4. Click listener

Note: If source code is not updated please let us know.

Support Us: PayPal: https://www.paypal.me/vlemonn Patreon: https://www.patreon.com/vlemonn

Useful URL: Our Website: https://vlemonn.com Blog Post: https://vlemonn.com/Blog/Android/Android-Custom-ListView-with-ImageView-EditText-and-Button Facebook: https://www.facebook.com/vLemonn Twitter: https://www.facebook.com/vLemonn Google Plus: https://plus.google.com/112993831877465971811

#Android #Android Tutorial #ListView #Click Listener #Custom ListView #Android Free Tutorial #Free Tutorial #Tutorial #free #vlemonn #Mayank Sanghvi

1 note · View note

t-baba · 8 years ago

Photo

Simplify Android App Development With Anko

Designed by JetBrains, the organization behind Kotlin, Anko is an open-source library that can radically change the way you create Android apps. It leverages Kotlin's syntax to offer a large collection of helper functions that help you reduce the verbosity of your code while also improving its performance.

Anko doubles as a DSL, short for domain-specific language, for creating Android layouts. In other words, it can act as a type-safe, dynamic, and more reusable alternative to layout XML files, which, as you might already know, tend to get unwieldy for large apps.

In this tutorial, I'll help you get started with Anko by showing you how to use some of its most popular features.

1. Project Setup

To be able to use the core features of Anko in your Android Studio project, all you need to do is add the following implementation dependency in the app module's build.gradle file:

implementation 'org.jetbrains.anko:anko:0.10.1'

If you want Anko to work with widgets from Android's support libraries, however, you'll need the following additional dependencies:

implementation 'org.jetbrains.anko:anko-appcompat-v7:0.10.1' implementation 'org.jetbrains.anko:anko-design:0.10.1' implementation 'org.jetbrains.anko:anko-recyclerview-v7:0.10.1' implementation 'org.jetbrains.anko:anko-cardview-v7:0.10.1'

2. Creating Layouts

The Anko DSL has helper functions for almost every widget that's offered by the Android SDK and the Android support libraries. Using them, you can create your layouts programmatically. The names of the functions match the names of the widgets, but they start with a lowercase letter. For example, to create a TextView widget, you use Anko's textView() function. Similarly, to create a FloatingActionButton widget, you can use the floatingActionButton() function.

Inside the functions, you'll have access to all the properties and event listeners of the associated widgets. For instance, you can change the text size of a TextView widget by updating the value of the textSize property inside the textView() function. Similarly, you can add an on-click event listener to it using the onClick method.

To help you better understand how to use the DSL, here's a sample layout for a browser app, containing an EditText widget and a WebView widget placed inside a LinearLayout widget whose orientation is VERTICAL:

linearLayout { orientation = LinearLayout.VERTICAL var myWebView:WebView? = null editText { inputType = InputType.TYPE_TEXT_VARIATION_URI imeOptions = EditorInfo.IME_ACTION_GO onEditorAction { _, _, _ -> myWebView?.loadUrl(text.toString()) } } myWebView = webView { webViewClient = WebViewClient() } }

Code written in the Anko DSL is very readable and intuitive, but it does take some getting used to, especially if you are already an experienced Android developer. You no longer have to assign identifiers to your widgets—or use the findViewById() method to reference them—because unlike XML-based layouts, Anko's DSL-based layouts can encapsulate your app's business logic. For instance, you can see that the EditText widget defined above has an OnEditorAction event listener that directly calls the loadUrl() method of the WebView widget to load the URL the user typed in.

Furthermore, you don't have to call the setContentView() method anymore because Anko calls it automatically inside your Activity class's onCreate() method.

The DSL includes several shortcuts you can use to make your layouts more concise. For example, you can directly pass strings to its functions to assign labels to widgets. Often, you can also avoid explicitly setting layout parameters such as widths and heights because it handles them automatically. The following sample code shows you how to create a layout containing two TextView widgets in a highly concise manner:

verticalLayout { textView("One") textView("Two") }

For comparison, here's what the above layout would look like if it were created conventionally:

<?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://ift.tt/nIICcg" android:layout_width="match_parent" android:layout_height="match_parent" android:orientation="vertical"> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="One"/> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Two"/> </LinearLayout>

Lastly, it's worth mentioning that layouts created using the Anko DSL tend to load faster than regular layouts because there's no XML parsing required.

3. Creating Dialogs

If you think using the AlertDialog.Builder class to create dialogs is a lot of work, you're definitely not alone. For example, here's how you would normally create a simple dialog that displays a title, a message, and an "OK" button:

AlertDialog.Builder(this@MyActivity) .setTitle("My Dialog") .setMessage("This is a test message") .setPositiveButton("OK", null) .create() .show()

With Anko, however, creating the above dialog simply involves a call to the alert() function, which accepts the dialog's title and message as its arguments.

alert("This is a test message", "My Dialog") { yesButton { } }.show()

Note that you don't have to pass a context to the alert() function. It infers the context automatically.

Anko has similar intuitively named functions to help you quickly create toasts and snackbars too. The following code shows you how to create both short and long duration toasts:

toast("This is a short toast") longToast("And this is a long toast")

4. Creating Intents

Whenever you need to start a new activity in your app, you must create an intent. Additionally, if you want to send data to the activity, you must include it in the intent as one or more extras.

With Anko's startActivity() function, you can usually perform both tasks in just one line of code. For example, the following code shows you how to launch an activity named MyActivity and pass two extras, a string extra named "PERSON" and an integer extra named "AGE", to it:

startActivity<MyActivity>("PERSON" to "Bob", "AGE" to 25)

Anko also has helper functions for several common intent-based tasks. For instance, you can use its browse() function to open a URL in the device's default browser app. Similarly, you can use the email() function to open the default email app and compose an email.

// Open browser browse("https://tutsplus.com") // Open default E-mail app email("[email protected]", "Hello", "This is a test email")

5. Using SQLite Databases

Even though every Android app can create and use SQLite databases with no additional dependencies, many developers choose third-party databases like Realm. Why? Well, maybe it's because Android's SQLite API is extremely verbose, low-level, and requires a good understanding of SQL. Fortunately, Anko has SQLite helper functions to address all those problems.

Let's say we have a simple SQLite database created using the following code:

val myDB = openOrCreateDatabase("test.db", Context.MODE_PRIVATE, null)

With Anko, you can now add a table to the above database simply by using the createTable() function, which expects the name of the table along with one more or tuples specifying the names and data types of its columns. The following sample code creates a table named PERSON having four columns, one of which serves as a primary key:

myDB.createTable("PERSON", true, "NAME" to TEXT, "AGE" to INTEGER, "NET_WORTH" to REAL, "ID" to INTEGER + PRIMARY_KEY)

What's more, to insert rows into the table, you no longer have to depend on the ContentValues() class. You can directly call the insert() function on the database, specify the name of the table you want to add the row to, and then pass the column values to it in the form of tuples.

// Add a row myDB.insert("PERSON", "NAME" to "Bob Martin", "AGE" to 25, "NET_WORTH" to 2500.50, "ID" to 100) // Add another row myDB.insert("PERSON", "NAME" to "Jane Flores", "AGE" to 32, "NET_WORTH" to 21500.80, "ID" to 101)

Lastly, to query the database, you can use the select() function, optionally followed by a chain of intuitively named functions such as whereSimple(), orderBy(), and groupBy(). For example, to list the names and ages of all persons in the above table whose net worth is greater than 10000, you can use the following code:

myDB.select("PERSON", "NAME", "AGE") .whereSimple("NET_WORTH > ?", "10000.0").exec { // More code here }

The result of the above query will be, as you might expect, a Cursor object. Converting it into a List containing actual column values of all the rows is slightly more complicated because it involves creating an object that implements the RowParser interface and passing it to the parseList() function.

The RowParser interface has just one method, the parseRow() method, inside which you'll have access to the column values of a row. How you use the values is of course up to you. For now, let's just concatenate them and print them. The following code shows you how to do so:

parseList(object: RowParser<String>{ override fun parseRow(columns: Array<Any?>): String { // Concatenate the values of the first and second columns, // which happen to be NAME and AGE return "${columns[0]} (${columns[1]} years old)" } }).forEach { println(it) // print the concatenated values } // Result is: // Jane Flores (32 years old)

Note that you don't always have to create a RowParser object manually. If the results of your query contain just one column, you are free to use one of Anko's many built-in parsers.

The names of the built-in parsers are based on the data types of the columns. For example, if the data type is TEXT, you can use a StringParser. Or if the data type is INTEGER, you can use an IntParser. The following code shows you how to use a StringParser to simply list the names of all persons in our database:

myDB.select("PERSON", "NAME").exec { parseList(StringParser).forEach { println(it) } } // Result is: // Bob Martin // Jane Flores

Conclusion

In this tutorial, you learned how to use Anko's DSL and helper functions to simplify Android application development. You also saw how Anko simplifies SQLite-related operations. I hope you now realize how well-thought-out and useful the library is.

In my opinion, if you are competent in Kotlin already, there's really no reason why you shouldn't use Anko to further improve your efficiency and development experience. To learn more about it, do refer to its official wiki.

And while you're here, check out some of our other posts about Kotlin and Android app development!

Android SDK

Java vs. Kotlin: Should You Be Using Kotlin for Android Development?

Jessica Thornsby

Android SDK

Introduction to Android Architecture Components

Tin Megali

Android SDK

Get Started With RxJava 2 for Android

Jessica Thornsby

Kotlin

Kotlin From Scratch: More Fun With Functions

Chike Mgbemena

by Ashraff Hathibelagal via Envato Tuts+ Code http://ift.tt/2jL70UU

#CSS3 #HTML5 Branding #HTML5 Weekly #HTMLl5 demos #Javascript #Javascript Branding #Javascript Weekly

1 note · View note

netleafinfosoft · 6 years ago

Text

Implementing a Custom Request Using Volley Library

Why we use Volley Library?

Volley is an HTTP library that makes networking for Android apps easier and most importantly, faster. Volley is available on GitHub.

Volley offers the following benefits:

Automatic scheduling of network requests.

Multiple concurrent network connections.

Transparent disk and memory response caching with standard HTTP cache coherence.

Support for request prioritization.

Cancellation request API. You can cancel a single request, or you can set blocks or scopes of requests to cancel.

Ease of customization, for example, for retry and back off.

Strong ordering that makes it easy to correctly populate your UI with data fetched asynchronously from the network.

Debugging and tracing tools

Things You Need to Do:

Extend the Request<T>class, where <T> represents the type of parsed response the request expects. So if your parsed response is a string, for example, create your custom request by extending Request<String>.

Add Gson library compile dependency to your app-level build.gradle

Create a model class as per response.

Add custom request to request queue of volley

Create the Model Response class :

public class ServiceResponse { String data;

public String getData() { return data; }

public void setData(String data) { this.data = data; } public int getType() { return type; } public void setType(int type) { this.type = type; } int type; }

Create CustomRequest class :

public class VolleyCustomRequest extends Request<Object>{ Map<String, String> params; protected int reequesttype; String postdata; int postdatv=1; protected Response.Listener mListener; public VolleyCustomRequest(String url, Response.ErrorListener listener) { super(url, listener); } public VolleyCustomRequest(int method, String url, Response.Listener listener1, @Nullable Response.ErrorListener listener, String postdata, int reequesttype) { super(Method.POST, url, listener); this.reequesttype=reequesttype; this.mListener=listener1; this.postdata=postdata; this.postdatv=2;

} public VolleyCustomRequest(int method, String url, Response.Listener listener1, @Nullable Response.ErrorListener listener, int reequesttype) { super(Method.GET, url, listener); this.reequesttype=reequesttype; this.mListener=listener1; } public VolleyCustomRequest(int m, String url, Response.Listener listener1, Response.ErrorListener listener, Map<String, String> params, int requestType) { super(Method.POST, url,listener); this.reequesttype=requestType; this.mListener=listener1; this.params=params; }

@Override protected Response<Object> parseNetworkResponse(NetworkResponse response) { String jsonData=new String(response.data); ServiceResponce s=new ServiceResponce(); s.setData(jsonData); s.setType(reequesttype); Response<Object> resp = Response.success((Object) (s), HttpHeaderParser.parseCacheHeaders(response)); return resp; }

@Override protected VolleyError parseNetworkError(VolleyError volleyError) {

ServiceResponse s=new ServiceResponse(); s.setData(volleyError.getLocalizedMessage()); s.setType(reequesttype); return super.parseNetworkError(volleyError); }

@Override protected void deliverResponse(Object response) { mListener.onResponse(response);

}

@Override public Map<String, String> getHeaders() throws AuthFailureError { Map<String,String> params = new HashMap<>(); params.put(“Content-Type”,”application/x-www-form-urlencoded”); return params; } @Override protected Map<String, String> getParams() throws AuthFailureError { return params; } @Override

public byte[] getBody() throws AuthFailureError { return postdata.getBytes(); }

}

Let’s use volley custom request in your app :

public class YourActivity extends AppCompatActivity implements Response.Listener,Response.ErrorListener { EditText et_email; TextView back,submit; LoadingDialog loadingDialog;

@Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.forgotpassword_layout); init(); } public void init() { HashMap<String, String> amp = new HashMap<>(); amp.put(“user_id”,et_email.getText().toString()); loadingDialog = new LoadingDialog(ForgotPasswordActivity.this); loadingDialog.showDialog(); VolleyCustomRequest request = new VolleyCustomRequest(Request.Method.POST, “your url”, this, this, amp, 3); RequestQueue queue = Volley.newRequestQueue(ForgotPasswordActivity.this); queue.add(request); }

@Override public void onErrorResponse(VolleyError error) { loadingDialog.stop(); Snackbar.with(this,null) .type(Type.ERROR) .message(“Some Problem Occure”) .duration(Duration.SHORT) .fillParent(true) .textAlign(Align.LEFT) .show(); }

@Override public void onResponse(Object response) { loadingDialog.stop(); ServiceResponce serviceResponce=(ServiceResponce)response;

if(serviceResponce.getType()==3)

{

try {

// here you get service response JSONObject jsonObject = new JSONObject(serviceResponce.getData()); String message=jsonObject.getString(“message”); Toast.makeText(getApplicationContext(),message,Toast.LENGTH_LONG).show(); Snackbar.with(this,null) .type(Type.SUCCESS) .message(message) .duration(Duration.SHORT) .fillParent(true) .textAlign(Align.LEFT) .show(); } catch (Exception e) {

}

#android app #top app development companies #mobile app development #android app development service #android app development service gurgaon

0 notes

windows98tips · 6 years ago

Text

Twitter Live Streaming - Sample Code

Social media is the key ingredient of applications and integrating the social media platform with mobile applications the key of success for your mobile applications. The large social networks could not fit to one single mobile application increasing the opportunity for all mobile developers to create more interesting and creative small apps for mobile devices with this social platforms. Twitter is one of the popular social networking platform. The update on twitter is very fast as tweets are small in size. Twitter introduced the live streaming APIs to get the updates in real time from twitter live streaming service. You can integrate the twitter live streaming in your android application as described in this post. Create a default activity project in eclipse for android and create the following layout for your application in activity_main.xml. Now replace the default activity class code by the following code import java.io.BufferedReader; import java.io.InputStream; import java.io.InputStreamReader; import java.net.URI; import java.util.ArrayList; import java.util.HashMap; import java.util.List; import org.apache.http.HttpResponse; import org.apache.http.auth.AuthScope; import org.apache.http.auth.UsernamePasswordCredentials; import org.apache.http.client.methods.HttpGet; import org.apache.http.impl.client.DefaultHttpClient; import org.json.JSONObject; import android.os.AsyncTask; import android.os.Bundle; import android.app.Activity; import android.content.Context; import android.util.Log; import android.view.Menu; import android.view.View; import android.widget.EditText; import android.widget.ListView; import android.widget.SimpleAdapter; import android.widget.Toast; public class MainActivity extends Activity implements View.OnClickListener { private List mTweets = new ArrayList(); private SimpleAdapter mAdapter; private boolean m_Running = false; private String m_SearchKeyWord = ""; final int MAXLIST = 10; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); //create a list view and bind with simple adapter mAdapter = new SimpleAdapter(this, mTweets, android.R.layout.simple_list_item_2, new String {"Tweet", "From"}, new int {android.R.id.text1, android.R.id.text2}); ListView lv = (ListView)findViewById(R.id.TweetsList); lv.setAdapter(mAdapter); //create a list view and bind with simple adapter } public class StreamTask extends AsyncTask { protected Boolean doInBackground(Context... arg0) { try { DefaultHttpClient client = new DefaultHttpClient(); String userName = "XXXXXXX"; String password = "XXXXXXX"; UsernamePasswordCredentials creds = new UsernamePasswordCredentials(userName, password); client.getCredentialsProvider().setCredentials( new AuthScope(AuthScope.ANY_HOST, AuthScope.ANY_PORT), creds); HttpGet request = new HttpGet(); String m_SearchKeyWord = null; request.setURI(new URI("https://stream.twitter.com/1/statuses/filter.json?track=" + m_SearchKeyWord)); HttpResponse response = client.execute(request); InputStream in = response.getEntity().getContent(); BufferedReader reader = new BufferedReader( new InputStreamReader(in) ); handleTweets(reader); in.close(); } catch (Exception e) { Log.e("SampleTwitter", "doInBackground_" + e.toString()); } return true; } private void handleTweets( BufferedReader reader ) { try { String line = ""; do { line = reader.readLine(); JSONObject tweet = new JSONObject(line); HashMap tweetMap = new HashMap(); if (tweet.has("text")) { Log.i("SampleTwitter","Tweet : " + tweet.getString("text")); tweetMap.put("Tweet", tweet.getString("text")); tweetMap.put("From", tweet.getJSONObject("user") .getString("screen_name")); Log.i("SampleTwitter","From : " + tweet.getJSONObject("user") .getString("screen_name")); mTweets.add(0, tweetMap); if (mTweets.size() > MAXLIST) { mTweets.remove(mTweets.size() - 1); } publishProgress(true); } } while (m_Running && line.length() > 0); } catch (Exception e) { Log.e("SampleTwitter", "handleTweets_" + e.toString()); } } protected void onProgressUpdate(Boolean... values) { super.onProgressUpdate(values); mAdapter.notifyDataSetChanged(); Log.d("SampleTwitter", "Im in onProgressUpdate()"); } } public void stopTweets(View view ) { m_Running = false; for(int idx=mTweets.size()-1;idx>=0;idx--) mTweets.remove(idx); if(mTweets.size() ==1) mTweets.remove(0); mAdapter.notifyDataSetChanged(); } public void startTweets(View view) { if( m_Running == false ) { EditText edt = (EditText)findViewById(R.id.SearchText); m_SearchKeyWord = edt.getText().toString(); if( m_SearchKeyWord.length() > 0 ) { StreamTask st = new StreamTask(); st.execute(); m_Running = true; } else { Toast.makeText(this, "Please enter the search keyword", Toast.LENGTH_SHORT).show(); } } else { Toast.makeText(this, "Already Running", Toast.LENGTH_SHORT).show(); } } @Override public boolean onCreateOptionsMenu(Menu menu) { getMenuInflater().inflate(R.menu.activity_main, menu); return true; } @Override public void onClick(View arg0) { // TODO Auto-generated method stub } } This sample is getting the twitter updates from real time stream API and showing that in a list view. you need to change the username and password values in doInBackGround() method to connect to the twitter. The following is URL on which we can send a https request to get the tweets update in real time based on the tag value or search keyword.

0 notes

probelalkhan · 8 years ago

Text

New Post has been published on Simplified Coding

New Post has been published on https://www.simplifiedcoding.net/search-functionality-recyclerview/

Search Functionality in RecyclerView using EditText

In this post we will learn adding Search Functionality in RecyclerView. If a list contain many items then giving a search option is really necessary for making it user friendly. So lets see how to add Search Functionality in RecyclerView.

Contents

1 Creating a RecyclerView

1.1 Creating new Project

1.2 Adding RecyclerView and CardView

1.3 Creating Layouts

1.4 Creating RecyclerView Adapter

2 Implementing Search Functionality in RecyclerView

Creating a RecyclerView

Creating new Project

The very first thing we need is the RecyclerView itself. Only then we can add the search. So lets create a new Android Studio Project.

Adding RecyclerView and CardView

Once you have created a new Android Studio Project add RecyclerView and CardView to it. If you don’t know adding RecyclerView and CardView you can refer to the previous RecyclerView Tutorial.

Creating Layouts

Now once you have added the project come inside activity_main.xml and create a RecyclerView. The code for my activity_main.xml is below.

<?xml version="1.0" encoding="utf-8"?> <android.support.constraint.ConstraintLayout xmlns:android="http://schemas.android.com/apk/res/android" xmlns:app="http://schemas.android.com/apk/res-auto" xmlns:tools="http://schemas.android.com/tools" android:layout_width="match_parent" android:layout_height="match_parent" tools:context="net.simplifiedlearning.recyclerviewsearch.MainActivity"> <EditText android:id="@+id/editTextSearch" android:layout_width="0dp" android:layout_height="wrap_content" android:hint="Enter search term" tools:layout_constraintTop_creator="1" tools:layout_constraintRight_creator="1" android:layout_marginStart="8dp" android:layout_marginEnd="8dp" app:layout_constraintRight_toRightOf="parent" android:layout_marginTop="16dp" tools:layout_constraintLeft_creator="1" app:layout_constraintLeft_toLeftOf="parent" app:layout_constraintTop_toTopOf="parent" android:layout_marginLeft="8dp" android:layout_marginRight="8dp" /> <android.support.v7.widget.RecyclerView android:id="@+id/recyclerView" android:layout_width="0dp" android:layout_height="0dp" tools:layout_constraintTop_creator="1" tools:layout_constraintRight_creator="1" tools:layout_constraintBottom_creator="1" android:layout_marginStart="8dp" app:layout_constraintBottom_toBottomOf="parent" android:layout_marginEnd="8dp" app:layout_constraintRight_toRightOf="parent" android:layout_marginTop="8dp" app:layout_constraintTop_toBottomOf="@+id/editTextSearch" tools:layout_constraintLeft_creator="1" android:layout_marginBottom="8dp" app:layout_constraintLeft_toLeftOf="parent" android:layout_marginLeft="8dp" android:layout_marginRight="8dp" app:layout_constraintHorizontal_bias="0.0" app:layout_constraintVertical_bias="1.0"> </android.support.v7.widget.RecyclerView> </android.support.constraint.ConstraintLayout>

The above code will produce the following layout.

(adsbygoogle = window.adsbygoogle || []).push();

As you can see have a RecyclerView and an EditText. When we type something on EditText the RecyclerView will get filtered.

Now we will create a layout for our List Item. So create a new Layout Resource file named list_layout.xml and write the following xml code.

<?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="match_parent" android:layout_height="wrap_content" android:orientation="vertical"> <android.support.v7.widget.CardView android:layout_marginTop="5dp" android:layout_marginBottom="5dp" android:layout_width="match_parent" android:layout_height="wrap_content"> <TextView android:id="@+id/textViewName" android:padding="15dp" android:textAppearance="@style/Base.TextAppearance.AppCompat.Large" android:layout_width="match_parent" android:layout_height="wrap_content" /> </android.support.v7.widget.CardView> </LinearLayout>

Creating RecyclerView Adapter

Now we will create Adapter for our RecyclerView. So create a class named CustomAdapter and write the following code.

package net.simplifiedlearning.recyclerviewsearch; import android.support.v7.widget.RecyclerView; import android.view.LayoutInflater; import android.view.View; import android.view.ViewGroup; import android.widget.TextView; import java.util.ArrayList; /** * Created by Belal on 6/6/2017. */ public class CustomAdapter extends RecyclerView.Adapter<CustomAdapter.ViewHolder> private ArrayList<String> names; public CustomAdapter(ArrayList<String> names) this.names = names; @Override public ViewHolder onCreateViewHolder(ViewGroup parent, int viewType) View v = LayoutInflater.from(parent.getContext()) .inflate(R.layout.list_layout, parent, false); return new ViewHolder(v); @Override public void onBindViewHolder(ViewHolder holder, int position) holder.textViewName.setText(names.get(position)); @Override public int getItemCount() return names.size(); class ViewHolder extends RecyclerView.ViewHolder TextView textViewName; ViewHolder(View itemView) super(itemView); textViewName = (TextView) itemView.findViewById(R.id.textViewName);

Now come to MainActivity.java and write the following code.

package net.simplifiedlearning.recyclerviewsearch; import android.support.v7.app.AppCompatActivity; import android.os.Bundle; import android.support.v7.widget.LinearLayoutManager; import android.support.v7.widget.RecyclerView; import android.text.Editable; import android.text.TextWatcher; import android.widget.EditText; import java.util.ArrayList; public class MainActivity extends AppCompatActivity RecyclerView recyclerView; EditText editTextSearch; ArrayList<String> names; CustomAdapter adapter; @Override protected void onCreate(Bundle savedInstanceState) super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); names = new ArrayList<>(); names.add("Ramiz"); names.add("Belal"); names.add("Azad"); names.add("Manish"); names.add("Sunny"); names.add("Shahid"); names.add("Deepak"); names.add("Deepika"); names.add("Sumit"); names.add("Mehtab"); names.add("Vivek"); recyclerView = (RecyclerView) findViewById(R.id.recyclerView); editTextSearch = (EditText) findViewById(R.id.editTextSearch); recyclerView.setHasFixedSize(true); recyclerView.setLayoutManager(new LinearLayoutManager(this)); adapter = new CustomAdapter(names); recyclerView.setAdapter(adapter);

Now run the application and you will see your RecyclerView.

As you can see we have the RecyclerView. Now we will implement Search Functionality in RecyclerView.

Implementing Search Functionality in RecyclerView

Come to MainActivity.java and add a TextChangedListener as shown below. You have to do this inside onCreate().

//adding a TextChangedListener //to call a method whenever there is some change on the EditText editTextSearch.addTextChangedListener(new TextWatcher() @Override public void beforeTextChanged(CharSequence charSequence, int i, int i1, int i2) @Override public void onTextChanged(CharSequence charSequence, int i, int i1, int i2) @Override public void afterTextChanged(Editable editable) //after the change calling the method and passing the search input filter(editable.toString()); );

Now we need to create the method filter().

private void filter(String text) //new array list that will hold the filtered data ArrayList<String> filterdNames = new ArrayList<>(); //looping through existing elements for (String s : names) //if the existing elements contains the search input if (s.toLowerCase().contains(text.toLowerCase())) //adding the element to filtered list filterdNames.add(s); //calling a method of the adapter class and passing the filtered list adapter.filterList(filterdNames);

Lastly we need to create the method filter inside CustomAdapter class. So come inside CustomerAdapter.java and define the following method.

//This method will filter the list //here we are passing the filtered data //and assigning it to the list with notifydatasetchanged method public void filterList(ArrayList<String> filterdNames) this.names = filterdNames; notifyDataSetChanged();

Now run the application and try searching.

Bingo! It is working absolutely fine.

So we have the Search Functionality in RecyclerView. Thats all for this tutorial. If you are having any confusions or queries then lets have a discussion on comment section. Also don’t forget to SHARE the post if you found it useful. Thank You 🙂

#recyclerview filter #search functionality in recyclerview #search in recylcerview

0 notes

rafi1228 · 5 years ago

Link

Kotlin Android App Development with Android Q by building real apps. Beginner to advanced + Kotlin for Android

What you’ll learn

You will learn how to install tools

You will learn Kotlin for Android

You will learn how to develop Android apps

You will learn how to Implement 4 real apps

You will learn how to use database in your apps

You will learn how to publish your apps on Google Play

1- Installing and Setting Up Tools

Introcucing tools (IDE + Android SDK + Emulator + JDK)

How to download and install required tools

Creating a new Android Studio project

How to change the font of code editor

What is an activity

What is androidmanifest file

Developing your first Android app

Attributes panel

Code completion list

Displaying a toast

Running your app on an emulator

Examining different parts of an emulator

Send sms and phone calls between two emulators

Enabling directional pad

Cloud-based testing

Installing Google USB driver

Enabling developr options

Connecting a real device to the Android Studio

2- Kotlin _ Say Hello to Basics

Int data type

Declaring and initializing variables

Single line comment

var vs val

print() function

Floating point data type

Boolean data type

String data type

Type inference system

Naming conventions (Camel Case)

Data member and function member

dec() function

compareTo() function

Intellisence

Argument

replace(string) function

replace(char) function

char data type

toInt() function

toIntOrNull() function

NumberFormatException

toFloatOrNull() function

What is Null?

Kotlin Nullable types

Arithmetic operators

Operator precedence

Assignment operators

readLine() function

3- App ( Tip Calculator ) + Android Basic Views

TextView

Seekbar

EditText

Button

Set constraints for views

Resolving the “Hardcoded strings” warning

Converting text to number

Working with seekbar’s listeners (setOnSeekBarChangeListener)

Concatenating strings, variables and expressions with the + operator

Concatenating strings, variables and expressions with String Templates

4- Kotlin _ Control Flow

If expression

If Else expression

Relational operators

Gutter area

Debugging the apps by using breakpoints

Transfer of control

How to check if a numbers is even or odd

Logcat tab

Toast messages

Statement vs Expression

lift out assignment

Any data type

When expression with arg

When vs If

When expression without arg

Combining concitions in a when expression

An app that determines if a number is prime number

How to hold a range of values (double dotted and in operators)

Using the when expression with ranges

Logical AND operator

Useful Android Studio shortcut keys

Defining range variables

5- Kotlin _ Functions

Simple functions

Functions with Parameters

Functions with return type

Function signature

Parameter vs Argument

Userful Android Studio shortcut keys

Multi line comment

6- Kotlin _ Immutable and Mutable Collections + Loops

Defining and initializing the Arrays

Using the arrays

Manipulating the array elements

Any data type

ArrayIndexOutOfBound exception

Data types and performance

How to define an array type explicitly

The second way of declaring and initializing an array

Iterating over arrays by using the for loop

Destructuring declaration

Iterate through a Range

How to get the numbers of an array elements

withIndex() function

Until keyword

listOf() function

mutableListOf() funciton

Array vs Collection

mutable vs immutable

7- Kotlin _ Classes + Enums + Exception Handling

Declaring classes

How to create objects

Constructors

Iterating through an array of objects

Vertical selection

Property and method

Class header

Primary constructor

Declaring properties from the primary constructor

Class diagram

How Enums make things easier

Happy path

Try Catch block

Multiple catch blocks

Finally block

8- App ( English Stories ) + Activities + List View + Singleton Pattern

Displaing data into a Listview

ListView click listener

How to creating a new Activity

Passing data between activities

Scrolling toolbar

How to set the start up Activity

FAB (Floating Action Button)

Snakbar

Singleton pattern

Private visibility modifier

Public visibility modifier

Overriding the functions

String controls characters

9- App ( My Notes ) + SQLite Database + Activity Life Cycle + Action Bar + Alert Dialog

Set the Margin attribute for views

Designing SQLite databases for Android apps (Fields, Records, Tables, …)

Extending classes

SQLiteOpenHelperClass

TODO() functions

NullPointerException

Check null values

Safe call operator

Not null assertion operator

Using readble connetions to read data from database

Using writable connections to write data to database

OnDestroy() funciton

Performance tune-up while working ith databases

Variables’ scope

Up button

<Meta Data> tag

How to add menu to Action Bar

Working with Asset studio

Refactoring resource names

XML namespaces

match-constraint attribute

Hint attribute

Setting EditText text attribute

Changing the EditText focus programatically

How to check if an EditText is empty

Inserting new records into the database

Up button vs Back button

Activity life cycle

Navigating clipboard items

Refactoring functions

How to close an Activity programatically

Alert Dialog

Updating and Deleting records from database

10- App ( Best Quotes ) + Recycler View +Card View + Intents + Guidelines + Unicode Characters

How to insert default values into the database

Designing layouts by using a Card View

Linear Layout

Image View

Layout Margin attribute

Writing a customized Adapter for Recycler View

Recycler View vs List View

Inner classes

findViewByID() function

Arranging and managing Recycler View items by using LayoutManager

Using the customized Adapter View

Passing functions in Kotlin as parameters

Guidelines in constraint layout

On item click listener for RecyclerView

Creating DB in memory

Explicit intent and Implicit intent

Ripple effect

Share data with other apps

11- App ( Animating a Spaceship + Best Quotes ) + Animation in Android + Splash Screen

Alpha animation

Translate animation

Rotate animation

Scale animation

Companion objects

Creating Splash Screens by using Lottie library

Using third-party libraries

Assets folder

Application context vs the this keyword

noHistory attribute

12- Publishing Your App

Parallex effect

Safe zone

Legacy icons

Adaptive icons

Debug key vs Release key

Signing the APK

Requirements

No, tools are free

The concepts start from scratch

All you need is a computer

You even don’t need an Android device. Because in this course, you’ll learn how to create emulators.

Description

* In this course, you will learn how to write Android apps from scratch.

* No prerequisite is required.

* The obvious point about this course is that it is exercise-based to make sure you will understand and use the course materials correctly.

* Also, we will use the latest version of Android Studio, because it has many changes in recent mouths.

Who this course is for:

Everyone who thinks about an Android application idea and eagers to turn it into a business

College students

Those who wants to learn the newest programming language (Kotlin)

Android developers that want to update their knowledge about Android SDK

Created by Dev Hive Last updated 7/2019 English English

Size: 6.08 GB

Download Now

https://ift.tt/2jSX0cN.

The post Android Q App Development with Kotlin: Beginner to Advanced appeared first on Free Course Lab.

#IFTTT #Blogger

0 notes

android-arsenal · 7 years ago

Text

Currency-Edittext

A Custom EditText implementation that allows formatting of currency-based numeric inputs.

from The Android Arsenal http://bit.ly/2QHY1yx

#AndroidArsenal #AndroidDev #Android #Development

0 notes

jeeteshsurana · 6 years ago

Link

EditText Cursor and Scroll Bar Color Change like IOS in android studio

EditText Cursor and Scroll Bar Color Change like IOS

_____________________________________________

scrollview_thumb.xml [blank area]

_____________________________________________

<?xml version="1.0" encoding="utf-8"?>

</shape>

_____________________________________________

scroll_color.xml [fill area]

_____________________________________________

<?xml version="1.0" encoding="utf-8"?>

<shape android:shape="rectangle"

xmlns:android="http://bit.ly/nIICcg">

<gradient

android:angle="45"

android:centerColor="@android:color/white"

android:endColor="@android:color/white"

android:startColor="@android:color/white" />

</shape>

_____________________________________________

implementation

_____________________________________________

<androidx.appcompat.widget.AppCompatEditText

style="@style/EdtCreatePost"

android:hint="@string/write_a_caption"

android:maxHeight="289dp"

android:minHeight="289dp"

android:scrollbarThumbVertical="@drawable/scroll_color"

android:scrollbarTrackVertical="@drawable/scrollview_thumb"

android:paddingEnd="@dimen/dp_16"

android:layout_marginEnd="@dimen/dp_4"

android:fadeScrollbars="false"

android:paddingStart="@dimen/dp_16"

android:textCursorDrawable="@color/ttu_sunfloweryellow"

android:background="@android:color/transparent" />

_____________________________________________

style.xml

_____________________________________________

<item name="android:layout_width">match_parent</item>

<item name="android:layout_height">wrap_content</item>

<item name="android:textColor">@android:color/white</item>

<item name="android:textColorHint">@android:color/white</item>

<item name="android:textSize">@dimen/sp_14</item>

<item name="android:gravity">top|start</item>

<item name="android:inputType">textMultiLine</item>

<item name="android:scrollbars">vertical</item>

<item name="android:scrollbarSize">@dimen/dp_4</item>

<item name="android:scrollbarStyle">outsideOverlay</item>

</style>

#News Updates #EditText Cursor and Scroll Bar Color Change like IOS in android studio

0 notes