#web development company in Pakistan

[superrebelninja]

Web Development Services in Pakistan | Top-Notch IT Empire

Release the capability of your web-based presence with IT Empire’s master web Development services in Pakistan. Investigate the universe of creative web arrangements and experience the change of your business.

In the computerized age, major areas of strength for a presence are a basic part of any effective business. From online business stages to corporate sites and creative web applications, the interest in web development services providers is steadily expanding. Pakistan, with its flourishing IT industry, is rising as a center point for web improvement services. In this blog, we will investigate the web development landscape in Pakistan, with an exceptional spotlight on one of the main names in the business - IT Empire.

The Pakistani IT Landscape

Pakistan's Data Innovation industry has encountered noteworthy development as of late. This improvement is credited to a profoundly gifted and savvy labor force, making it an alluring reevaluating objective. Web Development, specifically, has seen flood popularity, locally as well as from global clients.

IT organizations in Pakistan offer an extensive variety of web improvement administrations, including:

1. Web Design: Making outwardly engaging and easy-to-understand sites.

2. Web Development: Building the center usefulness of sites and web applications.

3. E-Business Development: Planning and creating on the web stores and commercial centers.

4. Mobile Application Development: Making versatile applications for Android and iOS stages.

5. Content The executive's Frameworks (CMS): Carrying out frameworks like WordPress, Drupal, and Joomla.

6. Custom Programming Development: Creating tailor-made programming answers for explicit business needs.

7. Search Motor Enhancement (SEO): Upgrading sites to rank higher in web crawler results.

IT Empire: Shaping Pakistan's Web Development Landscape

Among the flourishing IT organizations in Pakistan, IT Empire stands apart as a top player. Laid out with a guarantee to convey greatness in web improvement administrations, IT Empire has gained notoriety for giving creative and excellent answers to clients around the world.

Services Offered by IT Empire

1. Web Design and Development

IT Empire’s group of experienced originators and engineers works pair to make outwardly shocking and completely practical sites. They give fastidious consideration to client experience, guaranteeing that the sites they create are responsive, connecting with, and simple to explore. The utilization of the most recent web advancements and systems guarantees that clients get state-of-the-art arrangements.

E-Commerce Solutions

Web-based business has seen a huge blast lately, and IT Empire has been at the front line of giving powerful internet business arrangements. Their mastery in creating web commercial centers and online business sites has helped various organizations lay out and grow their internet-based deal channels.

3. Mobile App Development

In this present reality where cell phones have turned into a fundamental piece of our lives, having a portable application for your business is urgent. IT Empire spends significant time creating versatile applications for both Android and iOS stages, offering organizations a method for drawing in with their clients on a more private level.

4. Content Management Systems (CMS)

IT Empire grasps the significance of content administration in the present advanced scene. They give skill in carrying out well-known CMS stages like WordPress, Drupal, and Joomla, empowering organizations to effectively oversee and refresh their site content.

5. Custom Software Solutions

For organizations with special necessities that off-the-rack programming can't address, IT Empire offers custom programming improvement administrations. They work intimately with clients to figure out their particular necessities and make fitted answers to address those issues.

6. Search Engine Optimization (SEO)

IT Empire goes past site improvement by giving exhaustive Search engine optimization administrations. They streamline sites to rank higher in web search tool results, expanding natural traffic and permeability in the packed internet-based space.

IT Empire's Client-Centric Approach

One of the champion elements of IT Empire is its client-driven approach. The organization puts areas of strength in grasping the extraordinary requirements and objectives of its clients. This approach empowers IT Empire to convey web improvement arrangements that are useful as well as lined up with the client's business goals.

IT Empire is known for:

1. Transparent Communication: They keep up with open and straightforward correspondence with clients all through the improvement cycle, keeping them refreshed on project progress.

2. Quality Assurance: A committed quality confirmation group guarantees that the end result is sans blunder and fulfills the greatest guidelines.

3. Timely Delivery: IT Empire is focused on conveying projects inside concurred courses of events, guaranteeing that clients can send off their sites and applications according to plan.

4. Post-Send-off Support: They give post-send-off help and upkeep to resolve any issues and guarantee the drawn-out progress of the tasks.

Why Choose IT Empire for Web Development Services in Pakistan?

1. Expertise and Experience

With long stretches of involvement with the business, IT Empire has sharpened its skill in web improvement. They know about the most recent industry patterns, advancements, and best works, guaranteeing that clients get arrangements that are both state-of-the-art and future-evidence.

2. Cost-Effective Solutions

Pakistan's upper hand lies in its savvy labor force. IT Empire uses this benefit to offer top-notch web advancement administrations at serious costs, making it an appealing decision for organizations, everything being equal.

3. Diverse Portfolio

The IT Empire has a different arrangement of effectively finished projects, going from independent ventures to huge endeavors. This different experience prepares them to deal with activities of different extensions and intricacies.

4. Client Satisfaction

The essential proportion of achievement for IT Empire is client fulfillment. They invest wholeheartedly in their extensive rundown of fulfilled clients, which is a demonstration of their obligation to greatness and the nature of their administrations.

5. Global Reach

While situated in Pakistan, IT Empire serves clients from everywhere in the world. Their global customer base mirrors their capacity to adjust to assorted markets and necessities.

Conclusion

The interest for web improvement administrations in Pakistan has developed altogether, because of the country's talented labor force and serious estimating. IT Empire, with its obligation to greatness, is at the very front of the web improvement scene in Pakistan. Their skill in website architecture, web-based business arrangements, versatile application improvement, content administration frameworks, custom programming improvement, and Search engine optimization administrations positions them as a solid accomplice for organizations hoping to upgrade their internet-based presence.

On the off chance that you are looking for a believed accomplice for web improvement administrations in Pakistan, IT Empire is a name worth considering. With a history of conveying excellent outcomes and a client-driven approach, they are exceptional to enable your computerized future.

Pick IT Empire for your web advancement needs, and experience the change of your business in the computerized world. Lift your internet-based presence and leave on an excursion towards progress with the main web improvement administrations in Pakistan.

[cogitoergofun]

New details are emerging about a breach at National Public Data (NPD), a consumer data broker that recently spilled hundreds of millions of Americans’ Social Security Numbers, addresses, and phone numbers online. KrebsOnSecurity has learned that another NPD data broker which shares access to the same consumer records inadvertently published the passwords to its back-end database in a file that was freely available from its homepage until today.

In April, a cybercriminal named USDoD began selling data stolen from NPD. In July, someone leaked what was taken, including the names, addresses, phone numbers and in some cases email addresses for more than 272 million people (including many who are now deceased).

NPD acknowledged the intrusion on Aug. 12, saying it dates back to a security incident in December 2023. In an interview last week, USDoD blamed the July data leak on another malicious hacker who also had access to the company’s database, which they claimed has been floating around the underground since December 2023.

Following last week’s story on the breadth of the NPD breach, a reader alerted KrebsOnSecurity that a sister NPD property — the background search service recordscheck.net — was hosting an archive that included the usernames and password for the site’s administrator.

A review of that archive, which was available from the Records Check website until just before publication this morning (August 19), shows it includes the source code and plain text usernames and passwords for different components of recordscheck.net, which is visually similar to nationalpublicdata.com and features identical login pages.

The exposed archive, which was named “members.zip,” indicates RecordsCheck users were all initially assigned the same six-character password and instructed to change it, but many did not.

According to the breach tracking service Constella Intelligence, the passwords included in the source code archive are identical to credentials exposed in previous data breaches that involved email accounts belonging to NPD’s founder, an actor and retired sheriff’s deputy from Florida named Salvatore “Sal” Verini.

Reached via email, Mr. Verini said the exposed archive (a .zip file) containing recordscheck.net credentials has been removed from the company’s website, and that the site is slated to cease operations “in the next week or so.”

“Regarding the zip, it has been removed but was an old version of the site with non-working code and passwords,” Verini told KrebsOnSecurity. “Regarding your question, it is an active investigation, in which we cannot comment on at this point. But once we can, we will [be] with you, as we follow your blog. Very informative.”

The leaked recordscheck.net source code indicates the website was created by a web development firm based in Lahore, Pakistan called creationnext.com, which did not return messages seeking comment. CreationNext.com’s homepage features a positive testimonial from Sal Verini.

[digitalmarketingagencypeshawar]

Peshawar Digital Marketing Agency: Crossing the Digital Divide

The thriving capital of Khyber Pakhtunkhwa, Pakistan, Peshawar, has witnessed a notable increase in the presence and influence of digital marketing organisations in the quickly changing digital world. These organisations are leading the way in converting conventional company models into innovative, web-based businesses. Among the platforms they use, Tumblr sticks out as a special and successful tool for digital marketing, providing a variety of chances for brands to engage with their audience in a creative and efficient manner.

Digital Marketing's Ascent in Peshawar Peshawar's digital marketing landscape has expanded rapidly in the last several years. In order to improve their online visibility, local businesses—from classic handicraft stores to cutting-edge tech startups—are increasingly resorting to digital marketing services. Search engine optimisation (SEO), content marketing, social media management, and online advertising are just a few of the services that these firms provide.Digital Marketing Agency In Peshawar offers wide range of digital topics.

Tumblr:

A Missed Opportunity in Online Advertising The social networking and microblogging site Tumblr is frequently eclipsed by industry heavyweights like Facebook, Instagram, and Twitter. But because of its special qualities, it's a useful tool for digital marketers. Rich multimedia material, fully customisable blogs, and a vibrant community are all made possible by Tumblr, and these features can be especially helpful for niche marketing.

What makes Tumblr special?

Creativity and Customisation:

Brands may develop aesthetically pleasing and highly customised blogs with Tumblr thanks to its versatile interface. With this creative freedom, brands may successfully communicate their identity and values.

Text, images, quotations, links, audio, and video are just a few of the types that Tumblr can handle when it comes to rich multimedia material. Because of its adaptability, marketers may employ a variety of content formats to interact with their audience and increase user engagement.

Community Engagement:

The robust and lively communities on Tumblr are well-known. Using these communities, brands may interact with consumers who have similar interests and develop a devoted following. Benefits for SEO: Tumblr blogs have good SEO. A brand's presence on search engines can be increased by having a well-optimised Tumblr page, which will increase organic traffic to the main website.

How Peshawar's Digital Marketing Agencies Use Tumblr Peshawar-based digital marketing companies are starting to realise Tumblr's potential. They are using the platform as follows:

Content Creation:

To cater to the interests of Tumblr's wide user base, agencies provide visually appealing and captivating content. Blog entries, info-graphics, films, and interactive materials fall under this category. Community Building: Agencies assist brands in gaining a devoted and robust following on Tumbler by actively engaging in these communities. By interacting with users via direct messages, re blogs, and comments, they promote a sense of community and fidelity.

Campaign Management:

To reach a wider audience, agencies use promotional posts and targeted advertising to manage and carry out marketing campaigns on Tumblr. To improve campaign performance, they monitor performance data and make necessary adjustments.

Brand Identity:

Agencies assist companies in building a strong online presence on Tumblr by creating personalised themes and unified branding. The uniformity of the brand across all digital platforms strengthens trust and brand recognition.

In summary Peshawar's digital marketing environment is dynamic and changing quickly. The city's digital marketing organisations are skilled at using Tumblr and other platforms to help businesses reach their target audiences and meet their marketing objectives. Because of its distinctive qualities, Tumblr is a useful resource for innovative and community-focused marketing campaigns. The importance of these agencies will only increase as more companies realise the possibilities of digital marketing, spurring success and innovation in Peshawar's business community.

FAQ

1. What is the purpose of using Tumblr for digital marketing for my company? Tumblr has several benefits, like blogs that are incredibly customisable, support for rich multimedia material, and active community involvement. These characteristics might make your company stand out and appeal to a specific type of customer.

How might a Tumblr digital marketing agency benefit my company? On Tumblr, a digital marketing agency can support with content creation, community building, campaign management, and brand identity establishment.

Is Tumblr appropriate for all kinds of companies? Tumblr may help any business trying to interact with specific communities and improve their online profile, but it's especially useful for companies that can use creative and graphic content.

What are the advantages of Tumblr for SEO? Because Tumblr blogs are SEO-friendly, they can raise the visibility of your brand on search engines. Tumblr optimised content can increase organic traffic to your primary website.

What distinguishes Tumblr's community involvement from that of other platforms? Creative expression and a strong feeling of common interests are what fuel Tumblr's community engagement. With regard to particular issues, users frequently establish close-knit communities, which facilitates brand engagement with highly engaged audiences. Businesses in Peshawar can improve their digital marketing tactics, expand their customer base, and succeed more in the digital sphere by knowing and leveraging Tumblr's distinctive qualities.

Q6: How can companies assess whether their efforts in digital marketing are successful? A6: Key performance indicators (KPIs) such website traffic, conversion rates, social media engagement metrics, return on investment (ROI) from advertising campaigns, and search engine rankings can be used by businesses to gauge the effectiveness of their digital marketing initiatives.

Q7: How does content marketing fit into the plans of digital marketers? A7: Content marketing is essential for building a brand's credibility and authority. The target audience is drawn to and engaged by high-quality content, which also generates organic traffic and bolsters other marketing initiatives like SEO and social media marketing.

Q8: Are there any particular trends in digital marketing that Peshawar businesses ought to be aware of? A8: Trends like the growing usage of video content, influencer marketing, mobile optimisation, personalised marketing experiences, and the expanding influence of automation and artificial intelligence in marketing are things that businesses should be aware of.

Q9: How can Peshawar-based digital marketing companies assist with brand development? A9: By developing a strong online presence through consistent branding across several digital channels, interesting content, well-placed advertisements, and proactive social media management, these agencies help to establish brand recognition and loyalty.

Q10: What qualities ought companies to consider before selecting a Peshawar digital marketing agency? A10: Companies should seek out an agency with a track record of accomplishment, experience in the relevant field, a wide range of services, a clear grasp of their objectives, open communication, and a cooperative mindset.

[ibbumarketing]

Ibbu Marketing is a digital marketing company. For the sole purpose of delivering top-notch Web Development, Search Engine Optimization and digital marketing services. Ibbu Marketing is Pakistan's one of the best digital marketing

[pmspvtltd]

PMS Pvt ltd Software house

PMS is the Best Software house in Pakistan PMS (Progressive Multimedia Systems) is the best software house in Pakistan and has been registered with PSEB & PASHA since 2007. We offer our services in web designing, API development, digital marketing, graphic designing, SEO, and ICT solutions. PMS software house specializes in creating CRM systems, web applications, and ERP solutions. We believe in software quality which is essential to deliver the product on time and the required quality with all completed requirements. As a leading software company in Gujranwala, Pakistan our products are fully maintainable for any new functionality or requirement.

[mundagenta]

Knock knock, KaiOS.

The ephemeral taste of innovating nearly obsolete bricks might be reaching its inevitable demise.

Nokia 8110 4G displayed in a kiosk at Mobile World Congress 2018. Image courtesy of Kārlis Dambrāns.

Despite the recent boom of feature phone sales over digital minimalism and dopamine detox trends, the future for KaiOS remains bleak as they fail to be consistent with their promises, thus miserably lagging against established giants in the market.

The good start

KaiOS is a partially open-source operating system developed by the Hong Kong-based company, KaiOS Technologies Inc. It was initially released in October 2017 and was forked from Boot 2 Gecko. Their name is from the Chinese for open – 开 (kāi) which “captures the idea of being inclusive.”

In just one year, they have overtaken Apple’s iOS as the second most popular operating system in India, with Android remaining on top, despite losing their 9% market share. In that same timeframe as well, they managed to sell around 450 million devices worldwide. Furthermore, their platform is compatible to WhatsApp, Twitter, YouTube, Google Maps, and Google Assistant.

To oversimplify things, KaiOS took the Boot 2 Gecko code (based from FirefoxOS) and modified it to run on hardware similar to that of feature phones and added the KaiOS Store. Other than that, they also implemented recent innovations that are becoming today’s standard, like 4G LTE and 5G, GPS, and Wi-Fi. By doing so, they effectively just created a separate phone segment, which some people call as the quasi-smartphones or smart feature phones.

KaiOS specifically chose the hardware present in their devices for an appealing approach to developing markets, like India and Pakistan, to bridge the digital divide and bring cheaper internet access. They removed the touch screen which they consider as the most costly part of the device, and replaced it with a cheaper T9 keypad input. Additionally, their devices only need 256MB to work and are also compatible with cost-efficient Spreadtrum chipsets.

What went wrong

By doing so, they effectively avoided the mistakes that Mozilla made. They chose a target audience first and offered them a product. They made an operating system out of the web but used that as a tool rather than the end goal, the latter being their approach to the digital divide. But not all products are perfect on their own, as their approach is a double-edged sword.

The T9 keypad meant that the apps had to be optimized to work on such inputs. Likewise, dissimilar to FirefoxOS, not all webpages can run on KaiOS devices due to hardware restraints. Such disadvantages make it an appealing short-term solution while their users save up for better entry-level Android devices.

Platform immaturity

The platform is still quite immature, despite five years since its initial launch. Some users claimed that their devices sometimes cannot receive calls, and crashes on related functions constantly. The battery also does not live up to its expectations and provides a ‘disappointing’ performance. Additionally, the calendar’s sync and date functionality is unstable, the alarm clock doesn’t ring from time to time, and the lack of note-taking, file browsing, multitasking, and wide audio format support. Besides, the platform lacked proper app quality control, bug reports, and feedback system, along with a slew of advertisements. Perhaps, the most lambasted functionality of the platform is the T9 input. Users characterized the input as slow and unreliable, thus ineffective for efficient user interface navigation. The predictive text input, which might sound good, is something they’d rather have disabled due to its restraints such as inaccurate suggestions and buggy input.

Some have mentioned that users may be over-estimating KaiOS and pitching it against smartphone platforms. Then on, we can’t deny that a platform still has to be stable and reliable, albeit hardware-restricted. Some went on to compare the system to its older counterparts such as Nokia’s Series 40, Microsoft’s Lumia, Vodafone’s MobiWire, and Blackberry’s Blackberry 10, which the users characterized as more ‘stable.’

Unfortunately, version 2.5.4 onwards faced a downward trend as certain apps were no longer maintained and supported, due to the decrease of development activity. For instance, the optimized Google and YouTube apps have been pulled out from the app store, around the same time as the update. In version 3, WhatsApp support has already been dropped and new app submissions to the store also plummeted. Google Assistant, the primary tool for users to voice type and issue commands (albeit stripped-down in comparison to Android), also dropped KaiOS support last June 30, 2021. Some users reached out to the company regarding this matter, to which they replied that they are developing an in-house voice assistant alternative. Until now, it is nowhere near worldwide coverage, given the limited devices it was shipped upon.

The company and its partners

Even more worse, the problem rests beyond that. The project development of has been consistent enough until the COVID-19 pandemic. According to the company’s blog statement “the growth was still not like how we achieved in the pre-COVID times, but these numbers and new partnerships are going up and in the right direction in this second year of the pandemic.”

In 2022, the project updates has since then plummeted. There weren’t any major announcements across all their social media platforms, even from the company website. Their Github repositories are no exception as well, as they still haven’t received any commits until now. Their only active repo is the gecko-b2g, which serves as the operating system base.

It is not implicit that their users are complaining about the bugs and speculating on the project’s downfall but it seems that they have no proper public relations and customer support as the company fails to actively respond to these messages.

Nokia

Nokia, or should we say, HMD Global has been a primary partner of KaiOS Technologies over the years. They manufactured the higher-end devices of the platform that were considerably the most popular in KaiOS’ lineup, such as the Nokia 6300 4G, Nokia 2780 Flip, and the Nokia 8110 4G.

Regardless, their approach is somehow vague as enthusiasts are confused over what their target audience is supposed to be, and what were they trying in the first place. Their approach started with the reboot of their classic devices, so it’s safe to assume that their target consumers are the ones who are nostalgic over their retro bricks. HMD, for a matter of fact, might have just been the worst example of a KaiOS partner.

Their devices are the most expensive ones of the platform, almost close to the entry-level Android Go smartphones. HMD Global has also been long criticized over the failure to deliver software updates from KaiOS to their devices, as they provide only about a year of support for these. The users also cannot help to complain over the significant bloatware present in such a limited hardware they provide.

Just recently, HMD Global took a step back from this approach and cherished their barebones Series 30 and Series 30+ platforms once again. Their last KaiOS device is the 2780 Flip from November 2022 and was then on followed by a series of Android Go and dumbphones from their C and 1xx series. In a reply to a user inquiry, they reportedly blamed KaiOS as the Google Assistant support for the platform was dropped.

Alcatel and TCL

Alcatel and TCL are also major partners of KaiOS. In fact, TCL Corporation is the largest shareholder of KaiOS Technologies. Both of them are popular for their Go Flip line. Despite the successes of Go Flip 1, 2, 3, and V, they didn’t get to experience the luxury of getting updated to the latest version of the OS, unlike the Go Flip 4. A user reached out to the company, to which they replied that they are still planning to serve these said updates to such devices, although there is still no update to talk of until now. 

Unfortunately, similar to HMD Global, they seem to be diverging away from the platform as recent releases from both manufacturers are focused on midrange to high-end Android devices, as well as the Tab series of TCL.

Jio

The Indian telecommunications company, Reliance Jio Infocomm Limited is the catalyst of KaiOS’ takeover against Apple in the country, all thanks to their aggressive marketing approach. They offered the competitively priced JioPhone for free to their users who are subscribed to their data plans.

Unluckily, even Jio is also straying away from KaiOS. There have been rumors that the JioPhone and the JioPhone 2 have been discontinued, as they are no longer sold. They last received the version 0258 update back on May 22, 2021, and clearly missed version 3.0 by a long shot. On June 24, 2021, Reliance Jio announced the JioPhone Next, a budget Android Go smartphone made in collaboration with Google. Recently this year, they partnered with Karbonn to release the Jio Bharat K1 Karbonn and V2 to provide access to UPI payments, Jio ecosystem, and cheaper 4G to the rural areas of India that remain untapped by recent advancements in technology.

What happened?

Fast forward to August 2023, users speculate that the project has already died out due to lack of activity and stagnation since the release of 3.0. Their company's social media platforms are inactive, except for the usual, seemingly AI-generated content every national holiday across countries. On the other hand, KaiOS Technologies partnered with the cybersecurity firm Trustonic to expand their device affordability efforts in Africa. There have also been infrequent new device releases for the platform, such as the AT&T Cingular Flex in February, Cricket Debut Flex in June, and Logan Technology’s Panita this August. Truth be told, I find this section rather short and lacking. Unfortunately, I could say the same for the company’s recent efforts. Nonetheless, I hope that things eventually get better. As users worldwide expected a reliable feature phone platform, all these issues contributed to a downward trend of interest for KaiOS. It seems that they might end up like FirefoxOS, failing to keep up and desolate in the past. Whether they wake up to innovate again, or continue dormant and inevitably die out is up for them to decide.

For now, one thing’s for sure, if they fail to address these issues, they’ll be no better than the obsolete bricks of the bygone era.

[digimates1]

Digimates

Digimates is a Pakistan-based software company led by Emmad Arshad, providing expert solutions in SEO, Web & App Development, Graphic Design, and Digital Marketing.

We help businesses grow with powerful websites, strong Google rankings, and creative digital strategies.

[dianappstechnologies]

Top 5 Android App Development Companies in Houston

In the 21st century, every business owner in Houston needs a reliable app development company. Houston has been a hub for entrepreneurs and Startups for a long time. Everyone wants to capture the attention of the mobile audience. So if you are one of them and think that finding a good Android app development company in Houston is a task. Then we are here to help you.

Need a mobile app partner in Houston? These 5 companies are leading the pack.

DianApps:

Website: https://dianapps.com/

Founded: 2017

Presence: US, Dubai, Australia, Canada, India ( Gurugram and Jaipur )

Specialities: mobile app development, UI/UX designing, Salesforce development, Digital marketing services, AI/ML, Software Development, IoT, Web development

Google Reviews: 4.7 Ratings ( 88 Reviews )

DianApps is a one-stop solution for all your software needs. The team handles every project with fresh ideas and a strong skill set. Their communication is always clear and transparent. They begin by understanding your needs. Then their expert UI/UX designers create a user-friendly design that perfectly aligns with your brand guidelines. Once the design is finalised, their team of expert developers makes it live. The product undergoes multiple testing processes to check its performance, smoothness, and functionality.

DianApps has rich experience in the mobile app development field and has successfully delivered projects for clients from various sectors. Whether it’s a startup, a growing business or an enterprise-level work, the team is skilled to handle everything. They have won several renowned awards that add to their credibility.

Tekrevol:

Website: https://www.tekrevol.com/

Founded: 2014

Presence: US, Dubai, Kazakhstan, UK

Specialities: Mobile app development, Game development, web development

Google Reviews: 4.7 Ratings ( 26 Reviews )

Tekrevol is a Houston-based company with a strong foothold in the development field. Their team is highly skilled and experienced. Their major projects are related to the gaming sector, but yes, the team has worked on numerous projects related to application development.

Tekrevol is internationally renowned because of its physical presence in many countries. Due to this, they receive many international projects and hence, have experience in building applications that meet international standards.

Goji Labs:

Website: https://gojilabs.com/

Founded: 2014

Presence: US

Specialities: Mobile application development, Web development, UI/UX designing

Google Reviews: 4.9 Ratings ( 51 Reviews )

Founded in 2014, Goji Labs is a U.S.-based firm known for its expertise in app and web development. The UI/UX team is known for their creativity and constantly delivering designs to enhance the overall look and feel of applications. They have worked for all types of clients, whether it is a startup or an enterprise-level company. The team of experienced coders develops apps that match perfectly with the target audience.

Trango Tech:

Website: https://trangotech.com/

Founded: 2003

Presence: USA, UK, Pakistan, Dubai

Specialities: App development, web development, software development, IoT

Google Reviews: 4.9 Ratings ( 8 Reviews )

Tango Tech is a custom software development company and was founded in 2003. Over the years, they’ve built strong expertise in the software development field. The apps developed by them work smoothly on all devices. This proves their passion, determination, and in-depth knowledge about app building. To be honest, the UI/UX part is a bit weak and can be improved. They are located in multiple countries and are easily accessible.

Mercury Development:

Website: https://www.mercdev.com/

Founded: 1999

Presence: US

Specialities: Mobile app development, web development, UI/UX designing

Google Reviews: 4.9 Ratings ( 10 Reviews )

Mercury Development Company is famous for its creative approach. Their UI/UX designers bring a unique vision to each project, helping the company to stand out in this competitive market. The company is entirely based in the US and was registered in 1999. Hence, they have a lot of experience in developing apps that are primarily focused on the US audience.

Conclusion :

If you are looking for a reliable app development company in Houston, then there are many options that you can find with a quick Google search. However, if you want to hand over your project to someone highly professional in this field, then you must go with DianApps. Their structured and detail-oriented project management style helped them to secure 1st position in this list.

Source : https://medium.com/@marketing_96275/top-5-android-app-development-companies-in-houston-bfe86d28fc26

[ashishimg]

What is the Cost of Developing a Fantasy Cricket App Like Dream11?

Introduction:

The creation of fantasy cricket apps has emerged as one of the most profitable business ventures in the rapidly expanding world of digital gaming. Entrepreneurs are curious about the Cost To Build Fantasy Cricket App in 2025 due to the spike in user engagement during cricket leagues such as the IPL, T20 World Cup, and ICC events. This blog covers all the important questions—what, why, when, who, where, and how—as well as actual costs, features, and frequently asked questions to assist you in organizing a profitable fantasy sports business.

🏏 What is a Fantasy Cricket App?

A fantasy cricket app is a website or mobile application that lets users build virtual teams with actual players. Points are awarded according to actual performance during games. Cricket fans' interactions with the game have been completely transformed by well-known apps like Dream11, My11Circle, and MPL.

Through competitions, entry fees, advertisements, and in-app purchases, these platforms not only provide entertainment but also bring in enormous sums of money.

💼 Why Invest in Fantasy Cricket App Development?

The fantasy sports market in India is projected to reach USD 5 Billion by 2027, with fantasy cricket apps accounting for over 75% of user participation. Here’s why it’s a golden investment:

High user engagement during tournaments

Multiple monetization models

Fast-growing sports-tech industry

Increased mobile and internet penetration

Rising demand for real-time, interactive sports platforms

📅 When is the Right Time to Launch a Fantasy Cricket App?

The ideal time to launch your fantasy cricket app is just before major cricket events such as:

IPL (Indian Premier League)

ICC World Cup

Asia Cup

T20 & ODI series

Launching before these tournaments ensures high user acquisition, participation, and visibility.

👥 Who Should You Hire to Build a Fantasy Cricket App?

You need a fantasy cricket app development company with expertise in:

Fantasy sports app UX/UI

Real-time data integration

Scalable backend architecture

Payment gateway integration

Security compliance (GDPR, SSL, etc.)

Companies like IMG Global Infotech, Capermint Technologies, and Appinventiv offer white-label and custom fantasy sports app development services tailored for startups and enterprises.

🌍 Where Can You Launch the App?

India is the largest market, but other cricket-loving countries such as:

Australia

England

South Africa

Pakistan

Bangladesh

UAE

…offer great expansion opportunities. Always ensure you comply with local gambling and gaming laws before launching.

🛠️ How Much Does It Cost to Build a Fantasy Cricket App?

The cost to build a fantasy cricket app in 2025 depends on various factors:

Feature/FactorEstimated Cost (USD)Basic App (Android/iOS)$10,000 – $15,000Advanced Features (AI, ML, AR)$20,000 – $35,000Admin Dashboard$3,000 – $6,000Real-time Analytics Integration$2,000 – $4,000Payment Gateway$1,500 – $3,000UI/UX Design$2,000 – $5,000Maintenance & Updates$500 – $1,500/month

Total Cost Range: $15,000 – $50,000+

The final cost is influenced by app complexity, platform type (iOS, Android, Web), developer location, and required features like:

Live match tracking

Contest creation

Leaderboards

Referral & bonus systems

Push notifications

🎯 Must-Have Features in a Fantasy Cricket App

User Registration & Login

Create & Join Contests

Live Score Updates

Player Stats & Rankings

Wallet & Payment Integration

Referral Program

Admin Panel

Multi-language Support

Fantasy Points System

In-app Notifications

🧠 Pro Tips to Reduce Fantasy App Development Cost

Opt for white-label fantasy cricket app solutions

Start with MVP (Minimum Viable Product)

Use pre-built APIs for live match data

Choose hybrid app development (React Native/Flutter)

Outsource to countries with lower hourly development rates

✅ Conclusion

The price of creating a fantasy cricket app depends on your goals, features, and intended user base. During cricket seasons, investing in a feature-rich, legally compliant, and scalable app can yield a significant return on investment, regardless of whether you are a startup or an established business.

Working with a seasoned fantasy sports app development firm like IMG Global Infotech Pvt Ltd guarantees that you will receive a reliable, effective app that meets user expectations and current market demands.

❓FAQs

Q1. What is the average cost to build a fantasy cricket app? A: The average cost ranges between $15,000 to $50,000 depending on features, platform, and complexity.

Q2. How long does it take to develop a fantasy cricket app? A: Typically, it takes 6 to 12 weeks for a basic app and 4 to 6 months for an advanced version.

Q3. Is it legal to run a fantasy cricket app in India? A: Yes, fantasy sports are legal in India as they are considered a game of skill, but it’s important to comply with state-specific laws.

Q4. Can I launch the same app globally? A: Yes, but you must localize the content and comply with the gaming and gambling regulations of each country.

Q5. How can I monetize my fantasy cricket app? A: Through entry fees, in-app purchases, ad networks, premium features, and affiliate marketing.

Q6. Should I go for custom or white-label fantasy cricket app development? A: If budget is limited, white-label is a quicker and cost-effective option. For unique branding and features, custom development is ideal.

[fahimrafi786]

Best HRMS in Pakistan: Why Manxel Leads the Way in Modern HR Management

Introduction

Pakistan's business environment is undergoing rapid transformation. From tech startups in Karachi to manufacturing hubs in Faisalabad, companies are increasingly recognizing the value of digital solutions to streamline operations. One area experiencing significant digital growth is Human Resource Management.

HRMS (Human Resource Management Systems)—software platforms designed to automate and optimize core HR functions. In Pakistan, where businesses often face challenges like regulatory compliance, resource constraints, and workforce management complexity, an effective HRMS can be a game-changer.

Among the various HRMS options available in the local market, Manxel stands out as one of the best HRMS platforms in Pakistan, offering a modern, localized, and scalable solution tailored to the needs of Pakistani businesses.

What Makes a Great HRMS in Pakistan?

Before diving into Manxel’s strengths, it’s essential to understand the criteria for a great HRMS platform in the Pakistani context:

Compliance with local labor laws (e.g., EOBI, gratuity, provident fund)

Bilingual interfaces (English and Urdu support)

Customizable modules for diverse industries (textiles, tech, healthcare, etc.)

Affordable pricing for small to medium enterprises (SMEs)

Scalable architecture for growing organizations

Cloud and mobile accessibility for hybrid work environments

Manxel: Pakistan’s Top HRMS Platform

Manxel is a next-generation HRMS solution built with a strong understanding of the challenges Pakistani businesses face. Unlike many generic international tools, Manxel is designed locally, for local needs, while still delivering global-standard features and security.

Key Features of Manxel

✅ 1. Local Compliance Built-In

Manxel is fully aligned with Pakistani HR and labor regulations:

EOBI and SESSI integration

Gratuity and provident fund tracking

Tax calculation according to FBR guidelines

Dynamic salary structure setup based on local norms

✅ 2. Payroll Management

Payroll in Pakistan can be complex, especially with variable allowances, bonuses, and compliance. Manxel handles:

Monthly payroll automation

Bonus and increment management

Tax deduction at source (TDS) calculations

Integration with local banks for salary disbursement

✅ 3. Attendance and Biometric Integration

Manxel supports integration with popular biometric devices used across Pakistan. It also offers:

Web-based and mobile attendance tracking

Geo-tagged clock-in/clock-out for remote teams

Flexible shift and overtime management

✅ 4. Recruitment and Applicant Tracking

Streamline hiring with a built-in Applicant Tracking System (ATS):

Post jobs across platforms

Filter candidates with smart search

Track the hiring pipeline

Auto-generate offer letters

✅ 5. Employee Self-Service Portal

Empower employees with easy access to:

Payslips

Leave requests

Attendance logs

Policy documents

This reduces HR workload and improves employee satisfaction.

✅ 6. Performance Management

Ensure a high-performing workforce through:

Goal setting and OKRs

360-degree feedback

Appraisal workflows

Performance dashboards

✅ 7. Learning & Development (L&D)

Manxel supports internal training management, helping Pakistani companies build skilled teams without relying heavily on external programs.

Why Pakistani Companies Prefer Manxel

🇵🇰 Localized Design

Manxel reflects the cultural, regulatory, and operational needs of businesses in Pakistan, unlike foreign HRMS tools that require customization.

💼 Suitable for SMEs and Large Enterprises

Whether you run a 20-person team in Lahore or a 5,000-person operation across multiple cities, Manxel is scalable, affordable, and easy to deploy.

🌐 Cloud-Based and Secure

With cloud deployment, Manxel offers secure remote access, data backups, and high uptime—critical for hybrid and remote work models.

💡 Custom Modules

Manxel offers tailor-made modules for industries like:

Textile & Garments

Healthcare & Hospitals

Tech & Software Houses

Education Institutes

Retail Chains

Customer Testimonials

Ali Raza, HR Manager at a Lahore-based IT firm: "Switching to Manxel cut down our manual HR work by 60%. Payroll, attendance, and employee data are now in one place. Plus, their local support team is very responsive."

Samina Tariq, Director at a Karachi textile mill: "Manxel gave us the ability to run HR operations across our five factories with one dashboard. The compliance features are a major win."

Manxel vs Other HRMS in Pakistan

Feature

Manxel

Generic Foreign HRMS

Traditional Local Software

Local Compliance

✅ Yes

❌ Limited

✅ Yes

Cloud & Mobile Access

✅ Full Support

✅ Yes

❌ Rare

Customization Flexibility

✅ High

❌ Low

✅ Medium

Bilingual Interface

✅ Urdu & English

❌ No

✅ Yes

Cost for SMEs

💰 Affordable

💸 Expensive

💰 Moderate

Support in Pakistan

✅ Local Support

❌ Offshore Support

✅ Yes

Conclusion: Manxel Is the Best HRMS in Pakistan

In a market filled with off-the-shelf software and outdated legacy systems, Manxel stands tall as a homegrown, future-ready HRMS platform for Pakistan’s diverse and growing business landscape. Its robust features, local compliance support, and user-friendly experience make it the top choice for organizations seeking efficient, secure, and scalable HR operations.

Whether you're a startup, SME, or enterprise, Manxel gives you the power to manage your people, simplify HR processes, and focus on what matters most—growing your business.

Interested in Manxel?

Visit https://manxel.com/products/hrms or contact their sales team for a free demo and consultation tailored to your organization’s needs.

[shayannawab]

Falisha Global Recruitment: Bridging Talent Between Pakistan and Turkey

In today’s interconnected world, global mobility has become more accessible than ever. Among the key players enabling this mobility is Falisha Global Recruitment, a growing name in the international recruitment landscape. Specializing in connecting Pakistani talent with employment opportunities in Turkey, Falisha has emerged as a top recruitment agency in Pakistan with a clear mission — to empower skilled professionals and laborers with life-changing job placements abroad.

As demand for foreign workers increases in Turkey, Falisha Global Recruitment steps up as a reliable recruitment agency in Turkey for foreigners, especially for those coming from Pakistan. With strong industry networks and a commitment to ethical hiring practices, Falisha ensures that every placement is a win-win — for both employer and employee.

Why Turkey is an Emerging Job Destination for Pakistanis

Turkey has become a prominent destination for Pakistani workers due to its thriving industries, cultural affinity, and strategic location. From hospitality and construction to engineering and healthcare, Turkey offers a wide range of job opportunities that appeal to both skilled and semi-skilled labor.

The Turkish government's increasing openness to hiring international workers, combined with economic growth and infrastructure development, has created a massive demand for manpower. However, finding the right talent remains a challenge for Turkish companies — that’s where a recruitment agency for Turkey in Pakistan like Falisha steps in.

What Sets Falisha Apart?

1. Specialization in the Turkey–Pakistan Corridor

Unlike many general recruitment firms, Falisha Global Recruitment focuses specifically on the growing employment pipeline between Turkey and Pakistan. This specialized approach enables the agency to understand the unique requirements of Turkish employers and match them with the skills available in Pakistan’s workforce.

2. Compliance and Transparency

Falisha is committed to ethical recruitment standards. Every candidate is recruited under legal frameworks with clear contracts, fair wages, and transparent visa processing. The agency collaborates with licensed foreign partners and abides by both Pakistani and Turkish labor laws, making it a trustworthy choice for job seekers and businesses alike.

3. End-to-End Recruitment Services

As a top recruitment agency in Pakistan, Falisha offers a full spectrum of services, including:

Candidate sourcing and screening

Skills testing and language assessment

Visa processing and documentation

Pre-departure orientation and training

Post-placement support

This 360-degree approach ensures a smooth transition for candidates and satisfaction for employers.

Opportunities Offered by Falisha

Falisha Global Recruitment facilitates job placements in various sectors, including:

Hospitality: Hotels, resorts, and restaurants across Turkey are hiring chefs, housekeepers, front-desk staff, and waiters.

Construction & Engineering: Skilled laborers, electricians, welders, and civil engineers are in high demand.

Healthcare: Nurses, caregivers, and lab technicians are welcomed in Turkish medical facilities.

IT & Technology: Software developers, web designers, and system analysts are also being recruited for Turkey’s growing tech scene.

These opportunities are carefully vetted, ensuring that Pakistani professionals are placed with reputable employers who offer competitive wages and safe working conditions.

Empowering Pakistani Talent for Global Success

One of the key goals of Falisha is to reduce unemployment in Pakistan by opening doors to international job markets. As a recruitment agency for Turkey in Pakistan, the company has already helped hundreds of Pakistani workers secure reliable jobs abroad, enabling them to support their families and uplift their communities.

Falisha also provides career counseling and interview coaching to prepare candidates for international job markets. Whether it’s a skilled technician or a university graduate looking for a breakthrough, Falisha ensures they’re equipped with the right tools for success.

Testimonials from Candidates

“I always wanted to work abroad but didn’t know where to start. Falisha helped me get a job in Istanbul’s hospitality sector. They were professional and transparent throughout the process.” — Mohsin R., Lahore

“My application was handled smoothly, and the pre-departure training helped me adjust quickly in Turkey. Thanks to Falisha, I’m earning a good income and supporting my family back home.” — Saima K., Karachi

These stories reflect Falisha’s dedication to making a real difference in people’s lives.

Partnering with Turkish Employers

Falisha not only serves job seekers but also partners with Turkish companies seeking a reliable workforce. By offering tailored recruitment solutions and timely delivery, Falisha has gained the trust of numerous clients in Istanbul, Ankara, Antalya, and beyond.

For Turkish employers seeking efficient staffing solutions, Falisha stands out as a reliable recruitment agency in Turkey for foreigners. Their understanding of cross-border labor dynamics and access to Pakistan’s vast talent pool makes them a valuable partner in workforce development.

Final Thoughts

In the competitive world of international recruitment, Falisha Global Recruitment shines as a bridge between two vibrant economies — Pakistan and Turkey. Whether you’re a Turkish business looking for hardworking employees or a Pakistani individual aspiring for a better future abroad, Falisha provides the expertise, transparency, and support to make it happen.

As a top recruitment agency in Pakistan, Falisha is more than just a job placement firm — it’s a gateway to global opportunity.

[divinejhonson]

Russia Needs Talent: Pakistani Recruitment Agencies Leading the Way

 In today’s interconnected world, workforce mobility is at an all-time high. One country increasingly attracting skilled and semi-skilled labor is Russia, and Pakistan is rising to meet this demand with competent, ethical, and efficient manpower solutions. At the forefront of this movement stands Falisha Manpower, a renowned name known for facilitating successful international employment journeys. As a Recruitment Agency for Russia in Pakistan, Falisha Manpower has emerged as a reliable bridge between Pakistani workers and Russian employers across industries. Whether you're a construction worker, engineer, technician, healthcare professional, or IT expert, Russia is opening doors to numerous employment opportunities. With economic diversification, infrastructural expansion, and a consistent need for labor, Russian companies are actively seeking foreign workers—and Pakistan’s vast talent pool is increasingly fitting the bill.

Why Russia is a Promising Destination for Pakistani Workers

Russia, as one of the largest countries in the world by area and one of the fastest-reviving economies, is investing heavily in its industrial and infrastructural sectors. This investment has created a growing demand for foreign labor to support the development of:

Energy and oil infrastructure

Transportation networks

Hospitality and tourism services

Agriculture and food processing

IT and digital transformation

Pakistani workers are favored for their hard work, adaptability, and technical skills. However, securing a job abroad—especially in a country like Russia with its specific visa and labor laws requires the right kind of guidance and facilitation. This is where Falisha Manpower, the Top Overseas Employment Manpower Agency In Pakistan, plays a pivotal role.

Who is Falisha Manpower?

Falisha Manpower is not just another recruitment agency. It is a trusted brand that has built its reputation through legal compliance, ethical recruitment, personalized candidate support, and long-term employer partnerships. From job matching to visa processing, from document authentication to post-deployment support, the agency offers comprehensive services to ensure a smooth and successful transition for job seekers.

Falisha Manpower holds official registration with the Government of Pakistan and maintains a track record of verified overseas placements across Europe, the Middle East, and Central Asia.

Why Choose Falisha Manpower for Russia Jobs?

1. Verified Employer Network

Falisha Manpower collaborates only with reputable Russian employers who adhere to legal and ethical labor practices. These companies offer competitive salaries, secure contracts, and necessary accommodations, minimizing the risks of job fraud or exploitation.

2. Compliant Visa & Document Process

Understanding the complexity of work permits and legal documentation for Russia, the agency provides end-to-end visa processing support. This includes:

Visa application and tracking

Employment contract verification

Health and background checks

Translation and document legalization

This level of assistance ensures that workers go abroad without unnecessary stress or delays.

3. Diverse Job Categories Available

Falisha Manpower actively recruits for the following sectors in Russia:

Construction & Engineering: Civil engineers, masons, crane operators, welders

Healthcare: Nurses, general physicians, lab technicians

Hospitality: Chefs, housekeeping staff, restaurant servers

Information Technology: Web developers, system engineers, software QA testers

General Labor: Cleaners, helpers, factory workers

Whether you are a professional or looking for seasonal or entry-level opportunities, there's something for everyone.

Russia’s Labor Market

Russia’s labor market has been increasingly receptive to foreign workers, especially in light of labor shortages in certain sectors. With an aging population and expanding industries, the demand for international labor continues to rise.

Average Monthly Salaries for foreign workers range from $500 to $1500 depending on the job role and experience.

Work Permit Duration is generally for 1–3 years, often with possibilities for extension.

Worker Protections include healthcare benefits, regulated working hours, and legal avenues in case of disputes.

Falisha Manpower ensures that Pakistani workers are placed only in roles that comply with Russian labor law and Pakistani government export standards.

Benefits of Working in Russia Through a Trusted Pakistani Agency

Legal and Safe Travel Process

Avoid visa scams and illegal job offers by going through a licensed agency like Falisha Manpower.

Competitive Salary Packages

Get access to employers who offer market-rate salaries and timely payments.

Free or Subsidized Accommodation

Most jobs include housing, transport, and sometimes meals, reducing your cost of living abroad.

Family Support and Counselling

Falisha provides pre-departure orientations and helps families stay connected with loved ones abroad.

Post-Placement Services

Assistance doesn’t stop once you board the plane. Falisha supports workers throughout their employment, helping resolve any concerns or issues.

How to Apply for a Job in Russia Through Falisha Manpower

Submit Your CV on the agency’s website or in person.

Preliminary Screening by the recruitment team.

Interview and Skill Test, often conducted by Russian employers virtually or in person.

Job Offer and Contract Signing, after selection.

Visa Application and Processing, managed by Falisha’s experienced documentation team.

Pre-Departure Training, to educate you about life, culture, and laws in Russia.

Travel & Arrival Assistance, including airport pickup and employer contact.

What Sets Falisha Manpower Apart from Other Agencies?

There are numerous agencies in Pakistan, but few maintain the professionalism, transparency, and results-driven approach that Falisha Manpower does. Here’s why they are considered a Top Overseas Employment Manpower Agency In Pakistan:

Zero Hidden Charges: All fees and services are disclosed upfront.

High Success Rate: Hundreds of candidates placed in Europe, Gulf, and Russia.

Multilingual Support: Communicate with ease during the entire process.

Government Approved: Licensed under BEOE and other relevant authorities.

Conclusion

With a booming demand for skilled labor, Russia is a golden opportunity for Pakistani job seekers. However, this opportunity must be pursued wisely through legal, verified, and professional channels. Falisha Manpower continues to stand out as a reliable Recruitment Agency for Russia in Pakistan, helping thousands achieve career success abroad. If you're ready to change your life, gain international work experience, and earn a competitive income, now is the time. Let Falisha Manpower guide your journey to Russia with integrity, care, and expertise.

[afghanlogistics01]

Service Provided by a Cargo Company in Afghanistan

Afghanistan’s strategic location in South-Central Asia makes it a crucial gateway between Central Asia, the Middle East, and South Asia. Despite the geographical and infrastructural challenges, the logistics and transportation sector in Afghanistan has seen growth due to the increasing demand for goods movement across borders. A Cargo Company in Afghanistan plays a vital role in this dynamic, offering a wide range of services that cater to both domestic and international clients. Let’s explore the core services typically provided by cargo companies operating in Afghanistan.

1. Freight Forwarding Services

One of the main offerings of a Cargo Company in Afghanistan is freight forwarding. These companies coordinate the shipment of goods from one location to another using various modes of transport — air, road, sea, and sometimes rail. Freight forwarding includes everything from negotiating freight charges and booking cargo space to preparing and processing documentation required for customs clearance.

2. Customs Clearance

Navigating customs regulations in Afghanistan can be challenging without the right expertise. Cargo companies assist clients with proper documentation, classification of goods, duty calculations, and compliance with Afghan customs laws. Efficient customs clearance ensures smooth transit and avoids unnecessary delays or penalties.

3. Warehousing and Storage

A reliable Cargo Company in Afghanistan also provides warehousing solutions. These storage facilities are strategically located near major entry and exit points such as land borders and airports. Companies offer both short-term and long-term storage options with added services like inventory control, packaging, and labeling.

4. Door-to-Door Delivery

Door-to-door service is another essential offering. Clients in Afghanistan, especially in remote areas, benefit from this service as it removes the hassle of arranging last-mile delivery. The cargo company handles every step of the shipment — from pickup at the origin to delivery at the destination, providing convenience and peace of mind.

5. Cross-Border and Transit Trade

Due to Afghanistan’s position as a landlocked country, transit trade is a significant part of logistics operations. A Cargo Company in Afghanistan often facilitates cross-border shipments to neighboring countries like Pakistan, Iran, Turkmenistan, and Uzbekistan. These services include coordination with foreign carriers, transshipment, and documentation required for seamless international trade.

6. Air Cargo Services

For time-sensitive shipments, cargo companies offer air freight services through Kabul and other international airports. Whether its pharmaceuticals, electronics, or urgent documents, air cargo ensures fast and secure delivery. These services are ideal for businesses needing rapid turnaround or dealing with high-value goods.

7. Project Cargo and Heavy Equipment Transportation

Afghanistan frequently hosts infrastructure and development projects requiring the transport of oversized or heavy cargo. A specialized Cargo Company in Afghanistan is equipped to manage such logistics, including route planning, permits, escort arrangements, and special handling equipment.

8. Tracking and Shipment Visibility

Modern cargo companies integrate tracking systems into their logistics processes. Clients can monitor the status of their shipments in real time through web portals or mobile apps. This transparency increases customer trust and allows better planning on the receiving end.

9. Packaging and Crating Services

Proper packaging is critical, especially for fragile or sensitive items. Many cargo companies offer professional packaging and crating solutions using materials that meet international shipping standards. This helps protect goods during transit, particularly over rough terrain or long-distance routes.

10. Consulting and Logistics Planning

A trusted Cargo Company in Afghanistan doesn’t just move goods; it also offers expert advice on logistics planning. Companies assist clients in route optimization, cost reduction, risk management, and compliance with local and international regulations.

Conclusion

The services offered by a Cargo Company in Afghanistan go far beyond simple transportation. From freight forwarding and customs clearance to project cargo and warehousing, these companies provide end-to-end logistics solutions tailored to Afghanistan’s unique environment. Whether you're a local business, an international organization, or an individual, partnering with a capable cargo company ensures that your goods move safely, efficiently, and compliantly within and beyond Afghanistan’s borders.

[glaxitsoftwareagency]

List of Top Website Development Companies in Pakistan 2025

Top Web Development Companies in Pakistan: A Complete Guide

The need for professional web development services grows faster than ever, and Pakistan now stands out as a key place packed with skilled developers. Whether you kick off a new business or give a facelift to an old website, picking the right partner plays a major role in your success. In this blog, we walk through a list of the best web development companies in Pakistan and share useful tips to help you pick out the right one.

Why Choose Pakistani Web Development Companies?

First off, web development companies in Pakistan strike a balance between great quality and affordable prices. Based on Clutch.co, the average hourly charges for developers here fall between $15 and $50, making Pakistan a budget-friendly option without sacrificing quality.

Also, many Pakistani developers work with international clients and handle big global projects. No wonder that around 35% of startups in the Middle East and North America outsource their tech tasks to Pakistan. The country surely makes a splash in the global IT market!

Things to Look Into Before Hiring a Web Development Company

Finding the right company may seem tough, but you can make it easy by following a few simple steps:

Go through the company’s portfolio

Check out client reviews and testimonials

Ask about the tech tools they use

Talk over pricing and delivery timelines

Make sure they offer support after launch

If you skip over these points, you might run into trouble later, and nobody wants that headache!

List Of Top Web Development Companies in Pakistan

Here’s a list we put together after looking at client satisfaction, experience, and creativity:

1. Trangotech

Trangotech is one of the top web development companies in Pakistan. They offer:

Custom website development

Mobile app development

E-commerce solutions

Cloud-based services

Trangotech’s team always goes above and beyond to meet and exceed client expectations with scalable, secure, and reliable solutions.

2. Glaxit

Glaxit makes its mark with fresh and dynamic web solutions. Their services cover:

Website design and development

Mobile app development

SaaS product creation

E-commerce solutions

How Glaxit Works:

Requirement Gathering: Glaxit kicks off every project by digging into your business needs and understanding your goals and target audience.

Front-End & Back-End Development: Their skilled developers bring together the latest technologies to build strong, efficient systems tailored to your needs.

Testing: Before launch, the QA team hunts down bugs through both manual and automated testing and sorts out any issues right away.

Deployment: After solid testing, Glaxit rolls out a flawless final product with full support to ensure everything runs smoothly.

3. Ropstam Solutions

Ropstam Solutions steps up by offering:

Custom web development

Mobile app creation

Blockchain solutions

Quality assurance and testing

They work closely with clients to set up every project for success from the get-go.

4. Ahex Technologies

Ahex Technologies stands strong as a full-stack development company, offering:

Website and software development

Enterprise-grade solutions

CRM and ERP system development

AI-driven integrations

5. WPExperts.io

WPExperts.io leads the way in WordPress-focused development. Their services spread across:

Custom plugin development

WooCommerce store setups

Shopify solutions

API integrations

How to Pick the Right Web Development Company

Still feeling confused? Here’s how you can narrow down your options:

Line up and compare company portfolios

Reach out for project estimates

Figure out their area of expertise (like e-commerce, mobile apps, etc.)

Get a feel for their communication style

The right company won’t just throw together a website they will build up your brand’s future!

Final Words

Pakistan rises up as a top destination for reliable, creative, and affordable web development services. Whether you team up with Trangotech, Glaxit, Ropstam, Ahex Technologies, or WPExperts.io, you tap into unmatched technical skills and professionalism.

With Pakistan’s IT market expected to hit $3.5 billion by 2025, now’s the time to jump in! If you choose wisely, success won’t just come knocking—it will kick the door open!

[abdulahadmoosa]

🚀 Curve Digital Solutions: Empowering Businesses Through Innovative Digital Strategies

In today's digital era, businesses require more than just an online presence — they need a comprehensive digital strategy that drives growth, enhances customer engagement, and streamlines operations. The solution? Enter Curve Digital Solutions — a Karachi-based digital agency committed to transforming ambitious businesses into market leaders.

🌐 About Curve Digital Solutions

Founded in 2022, Curve Digital Solutions has rapidly emerged as a trusted partner for companies seeking to navigate the complexities of the digital world. With a skilled team of designers, developers, marketers, and data engineers, we specialize in crafting customized digital solutions that align with your unique business goals.

💼 Our Core Services

We offer a complete suite of services designed to elevate your brand and optimize your digital operations:

Digital Marketing – SEO, content strategy, email campaigns & social media management to boost your reach.

Web & App Development – Fast, responsive, and user-centric web and mobile apps tailored for your users.

SaaS Product Development – Build scalable, secure, and high-performance SaaS platforms.

Data Engineering – Real-time data streaming, ETL pipelines, and analytics to power intelligent decision-making.

🛠️ Introducing MANXEL HRMS

One of our flagship innovations, MANXEL HRMS, is a cutting-edge Human Resource Management System that helps organizations digitize and automate their entire HR processes.

Key Features:

Employee Lifecycle Management – From onboarding to exit, manage all HR workflows in one place.

Payroll Automation – Timely, error-free payroll processing integrated with tax and compliance.

Attendance Tracking – Biometric & cloud-based time tracking.

Performance Management – KPI-driven appraisals and feedback tools.

Employee Self-Service – Let your employees manage their own records, leaves, and documents.

Discover more: 👉 https://manxel.com/products/hrms

🌍 Our Global Footprint

Headquartered in Karachi, Pakistan, we proudly serve clients across Pakistan, Australia, the UK, USA, India, and Canada. Our multicultural team understands the nuances of global markets and delivers solutions that resonate across industries.

🤝 Let's Collaborate

Whether you're a startup looking to launch your first app or a large enterprise aiming to digitally transform your operations — we’re ready to partner with you.

📞 Contact Us:

🌐 Website: https://curvedigitalsolutions.com

✉️ Email: pr@curvedigitalsolutions.com

☎️ Phone: +92 21 33392484

📍 Address: 7th Floor, Smart Tower, Shahrah-e-Faisal, Karachi

Let’s build the future — one digital solution at a time.

[impaaktmagazine]

Space Industry Supercharged by Indo-Pak Attacks? | IMPAAKT

In the fog of war, while soldiers defend borders and governments negotiate behind closed doors, another frontier quietly expands - outer space. Once a domain dominated by science and exploration, space has become an indispensable instrument of modern warfare. And with every geopolitical flashpoint, the space industry is witnessing a silent, yet profound, business boom with ongoing conflicts like Russia-Ukraine, Israel-Palestine, India-Pakistan, and so on.

War as a Catalyst, Not an Anomaly

For decades, the link between technological innovation and conflict has been well understood. Yet today, the rapid expansion of the commercial space sector during global crises presents a far more complex narrative. Wars no longer just boost traditional defense contractors; they now energize a network of commercial space firms offering earth observation, satellite communication, data analytics, and navigation solutions.

Companies like Maxar, Planet Labs, and Capella Space (now potentially acquired by IonQ) are no longer peripheral players; they have become strategic assets for governments seeking high-resolution imagery, real-time intelligence, and secure communications without waiting for sluggish military procurement cycles.

The Ukraine conflict stands as a defining case study. Commercial satellite providers were thrust into an unprecedented role, offering intelligence that often rivaled, or complemented, traditional military channels. In the process, a new market dynamic emerged, one where conflict did not merely expose vulnerabilities but created new, lucrative business opportunities.

Dual-Use Technologies: The Quiet Transition to Militarization

Many of the commercial space systems that were originally developed for civilian or scientific purposes have seamlessly transitioned into military applications. Earth observation satellites track troop movements. Communications constellations like Starlink become tactical lifelines on contested ground. Navigation services support the precision of weapons systems.

This dual-use nature, while commercially expedient, creates strategic ambiguity. Governments increasingly rely on private actors for mission-critical services, blurring the lines between civilian and military assets. And while this integration enhances resilience and flexibility, it also exposes commercial entities to risks traditionally reserved for military targets.

It begs a critical question: When a commercial satellite provides wartime intelligence, does it remain a civilian object under international law? Or has it, de facto, become a legitimate military target? 

A New Class of Defense Contractors

The traditional defense industrial base, characterized by heavy, monolithic players, is giving way to a broader, more agile ecosystem. Private space companies are no longer content with adjacent opportunities; they are actively competing for direct defense contracts.

Firms like Palantir, SpaceX, and Amazon Web Services are redefining what it means to be a defense contractor in the 21st century. They leverage commercial innovation cycles, scale rapidly, and deliver solutions faster than traditional defense primes.

In return, governments are shifting procurement models to adapt — buying services "off the shelf" rather than commissioning bespoke systems, and favoring modular, scalable architectures over expensive, long-cycle platforms.

Yet, this realignment is not without risks. The reliance on commercial providers, who are answerable primarily to shareholders, not national security imperatives, raises uncomfortable questions about loyalty, resilience, and control during high-intensity conflicts.

Case Study: Middle East Conflicts and the Rise of Commercial Space Capabilities

Over the past decade, persistent instability across the Middle East, particularly in Syria, Iraq, and Yemen, has triggered a surge in demand for commercial satellite imagery and space-enabled intelligence services.

As traditional nation-state intelligence assets became overstretched managing multiple low-intensity conflicts, defense and humanitarian agencies increasingly turned to commercial Earth observation providers for critical situational awareness. Companies like Planet Labs and BlackSky stepped in, offering high-frequency, medium-resolution imagery that enabled monitoring of:

Troop movements and weapons deployments,

Damage assessments after airstrikes,

Refugee movements and border crossings,

Infrastructure disruptions, such as oil facilities and power plants.

Notably, non-governmental organizations (NGOs) and humanitarian relief agencies, entities traditionally outside the military domain, began purchasing satellite imagery to plan operations, monitor war crimes, and deliver aid more effectively. This shift blurred the traditional distinction between military, humanitarian, and commercial space applications.

Moreover, governments began formalizing public-private partnerships to maintain persistent Intelligence, Surveillance, Reconnaissance (ISR) over conflict zones.  For example:

The U.S. National Reconnaissance Office (NRO) initiated contracts with commercial EO providers under its Commercial Systems Program Office to supplement classified reconnaissance during operations in the Middle East.

Saudi Arabia and the UAE started investing in their commercial satellite programs, driven partly by lessons from conflicts like Yemen.

The Middle East experience showed that low-intensity, prolonged conflicts, not just major wars, create enduring commercial opportunities for space companies across intelligence, disaster response, and national security sectors. It also demonstrated how commercial satellite data increasingly shapes public narratives about conflict, placing new political and operational pressures on the space industry.

Ethical and Strategic Blind Spots

The commercialization of space during wartime also introduces profound ethical dilemmas.

Access Inequity: Smaller nations may find themselves priced out of critical services that larger states can afford to monopolize.

Data Sovereignty: When wartime intelligence is gathered and sold by private companies, who truly owns that information?

Escalation Risk: Commercial assets used in war could become targets, increasing the likelihood of conflict spreading into the space domain itself.

Moreover, the rapid militarization of space under the guise of commercial activity risks destabilizing fragile norms of space governance. The absence of clear legal frameworks for dual-use systems and space warfare leaves a dangerous vacuum, one that adversaries will not hesitate to exploit.

Conclusion: The Silent Boom Comes at a Cost

The space industry’s silent boom during global crises is not a temporary trend; it is a structural shift in the way war is fought and won. Space has become both a weapon and a prize, and the companies operating in orbit are, whether they intend it or not, part of the battlefield.

For consultants, policymakers, and strategists, the lesson is clear: the intersection of space commerce and warfare demands urgent attention, thoughtful regulation, and a reassessment of traditional notions of neutrality and civilian infrastructure.

The business of war may drive innovation and economic growth, but it also carries with it the seeds of new, more complex conflicts, ones that will not stop at Earth’s atmosphere.