We are meeting with the owner of this beautiful home built in 1940 on the hill in Historic Augusta to give quotes for painting. Can’t wait to see it up close & in person.
4 notes
·
View notes
Private and business properties are picking decorative Concrete coatings Augusta for custom floors. As opposed to picking dull and exhausting deck choices, proprietors are going to new and imaginative answers for make the ideal completion to their general structure.
0 notes
2020 Black-Owned Gift Guide!
2020 Black-Owned Gift Guide!
It’s that time again! Our SIXTH ANNUAL BLACK-OWNED GIFT GUIDE IS HERE!!!! This Black Friday, try and support a Black-owned business for all your gift-giving needs. For last years gift guide, click here. For the 2018 gift guide, click here. For the 2017 gift guide, click here. For the 2016 gift guide, click here. For the 2015 gift guide, click here.
Similar to previous lists, I kept every individual item listed under $100! Click on the links to be taken to the websites in order to peruse more yourselves: all businesses listed are Black-owned, and many are run by Black women, Black Americans specifically, manufactured here in the United States, and/or sustainably and ethically sourced with philanthropic causes attached to sales! Check them out.
In addition, this year there are THREE NEW CATEGORIES! Check out items for the ‘Goth/Kawaii,’ for your ‘Activist Bae,’ and for the ‘Esoteric’ down below.
[As always, this guide has been split into categories to make it easier to get through, but feel free to mix and match for the person in your life that fits all of (or none of!) these categories!]
For the Homebody:
Lettie Gooch Small Safety Matches, $18
Lettie Gooch Amber & Moss Soy Candle, $20
Lettie Gooch White Concrete White Tea & Ginger Candle, $28
Lettie Gooch Planetarium Throw Blanket, $68
Lettie Gooch Soleil Throw Blanket, $68
Debra Cartwright ‘Bike’ Watercolor Print, $38
Debra Cartwright ‘Aura’ Watercolor Print, $87
Debra Cartwright ‘Astro Millennial Ladies in Quarantine’ Coloring Book, $5
Harlem Candle Company ‘Brownstone’ Luxury Candle, $45
Harlem Candle Company ‘Lenox’ Luxury Room Spray, $30
Harlem Candle Company ‘Langston’ Luxury Room Spray, $30
Jungalow Genie Vase, $89
Jungalow Handwoven Peach Planter, $49
Jungalow Azul Face Pillow by Justina Blakeney X Loloi, $89
Jungalow Soft Mint Pillow, $89
Jungalow Aja Wallpaper in Green by Justina Blakeney, $5 (per sheet)
Jungalow Tigris Wallpaper in Onyx by Justina Blakeney, $5 (per sheet)
Jungalow Cream Looped Wool Rug, $99.00
Jungalow Silvia Teal & Berry Rug by Justina Blakeney X Loloi, $69.00
Jungalow Striped Orange Outdoor Rug, $59.00
Jungalow Reindeer Games Hook Pillow by Justina Blakeney, $60.00
Jungalow Peace Vase by Justina Blakeney, $68.00
Kashmir Viii ‘S is for Soul’ Print, $35-$45
Galerie LA Rooted Incense Holder, $45
Duchess365 358 Art Print, $23.99
Jeff Manning Art ‘Aplomb’ Art Print, $45
Jeff Manning Art ‘Pacific’ Art Print, $30
Kicky Mats ‘Get Naked’ Bath Mat, $30
Kicky Mats ‘Did You Wash Your Hands?’ Doormat, $50
Kicky Mats ‘Go Away, Come Back With Wine’ Doormat, $50
Kicky Mats ‘Did You Call First?’ Doormat, $50
228 Grant Street Candle Co. Tobacco + Patchouli Gold Travel Tin, $11
228 Grant Street Candle Co. Wild Blackberry + Absinthe Amber Jar, $21
228 Grant Street Candle Co. Oakmoss + Amber Apothecary Jar, $32
Shea Makery Strawberry Cheesecake Signature Candle, $40
Shea Makery Cinna-Bowl Signature Candle, $40
The Silver Room Cider and Cedar Leaf Candle, $34
The Silver Room Rose Water & Tea Leaves Diffuser, $28
The Silver Room Minnie Ripperton - Les Fleur Vinyl, $26
Rituals + Ceremony Anonomy Sculptures, $79
Rituals + Ceremony USB Travel Ultrasonic Essential Oil Diffuser, $25
Handcrafted Ceramic Watering Cans, $64
Fill More Waste Less Natural Loofah Sponge, $2.50
Fill More Waste Less Food Huggers, $12. 99
Ment Nelson Backwoods Baptism Print, $50
Ment Nelson Old Sheldon Print, $40
Quarantine Games!
Trading Races, $19.99
Winsults, $25
Cards For All People - Black Card Revoked (First Edition), $17.99
Trap Wars - The Urban Game Night Experience, $22.99
Lyrically Correct 90's & 2000's Hip Hop/R&B Edition, $24.99
Black Wall Street - The Black History Board Game, $49.99
Pull Your Card Music Trivia: Hip Hop Edition, $14.99
Spill It Card Game, $23
'Verified' A Party Game for Social Media Lovers (Original Edition), $19.99
For the Foodie:
Kashmir Viii ‘The Black Power’ Mixtape Coasters, $40
Kashmir Viii ‘Reclaim It’ Mug, $16
Kashmir Viii ‘I Slay.’ Clutch, $45
Galerie LA Peak and Valley Balance Blend, $30
‘The Cooking Gene,’ by Michael W. Twitty, $28.99
‘From Crook to Cook: Platinum Recipes From the Boss Dog’s Kitchen’ by Snoop Dogg, $24.95
Essie Spice Signature Sauce Collection, $42
‘Your Guide to Tasteful Manners’ with Love Cork Screw, $19.95
‘Deliciously Vegan’ Cookbook by The Chic Natural, $28.95
EAT Apron, $30
Midnight Reflections Crowned White Ceramic Mug, $19.99
The Spice Suite Utensils + Oven Mitts, $50
The Spice Suite ‘The Little Black Spice Book’ (E-book), $30
Rituals + Ceremony Circle Mug, $40
Rituals + Ceremony Agate 6pc Plate Set, $24
Blk + Grn Stainless Steel Tea Ball Infuser, $4
Fill More Waste Less Reusable Tea Strainer, $14.99
Good Thoughts Tea Co. Tea Spoon Set, $12
KazvareMadeIt Personalised Alphabet Mug Tile Print, $20.99
KazvareMadeIt Banananana Cushion, $55.80
Addie Rawr ‘Addie's Cocktail Collection’ (Cards & Prints), $3.75
For the Beauty Guru:
Lettie Gooch Blends Perfume: Earth, $30
Lettie Gooch Bloom Perfume Blend No. 586, $48
Galerie LA Hand Sanitizer, $10
Galerie LA Cream Cleanser, $16
Galerie LA Citrine Sea Tropical Exfoliator, $18
Galerie LA Botanica Rose Roller, $14
Galerie LA Botanica Lavender Roller, $14
Galerie LA Aurora Superfood Elixer (Face Serum), $27
Galerie LA Jade Eye Mask, $44
Galerie LA Rose Quartz Facial Roller, $28.00
Shea Makery Scar Healing Serum, $23
Shea Makery Cinnamon Bun Body Butter, $25
Shea Makery Glazed Donut Body Butter, $25
Shea Makery Milk + Honey + Syrup Bubble Bath, $22
Shea Makery Honeycomb Bath Set, $16
The Lip Bar Cheek and Eye Palette, $15
The Lip Bar ‘Goddess’ Lipgloss, $14
The Lip Bar ‘Bawse Lady’ Liquid Matte Lipstick, $13
The Lip Bar ‘4:00 Stuntin' Fast Face Kit,’ $99
The Lip Bar Limited Edition Easy Holiday Glam Collection, $25
The Lip Bar ‘Lip Bar Littles,’ $18.99
The Lip Bar Minimalist Lovers Bundle, $36
Auda B. Beauty Soy Polish Remover, $26
Breukelen Polished ‘Paid and Full,’ $11
Breukelen Polished ‘Get Me Right’ Treatment Set, $25
Beauty Bakerie ‘Milk & Honey’ Highlighting Brush, $18
Beauty Bakerie ‘Coffee and Cocoa’ Bronzer Palette, $38
Beauty Bakerie ‘Black Egg-cellence’ Beauty Sponges, $18
Beauty Bakerie ‘Sugar Cookies’ Palette, $28
Beauty Bakerie ‘The Butter’ Hydrasilk Primer, $24
Mented Mini Brush Trio, $10
Mented Everyday Eyeshadow Palette, $28
Mented Brush Collection, $45
Mented Holiday Faves Trio, $50
Blac Minerals Highlight Bundle, $32
Danessa Myricks Beauty Oil, $30
Danessa Myricks Waterproof Cream Palettes, $36
Danessa Myricks Luxe Cream Palettes ‘The Nudist,’ $44
Pear Nova ‘Holiday Essentials’ Nail Set, $90
Habit Cosmetics Nail Polish in Voodoo, $18
Habit Cosmetics Nail Polish in Midnight Cowboy, $18
Habit Cosmetics Nail Polish in Black Orpheus, $18
Habit Cosmetics Nail Polish in Scarab, $18
Hunny Bunny Cuticle Cream, $4.50
Hunny Bunny Grapefruit Sugar Scrub, $20
Taupe Coat in Good Fortune, $11
More Brands To Try:
People of Color Beauty
Mischo Beauty
Suite Eleven
Brown Butter Beauty
Beija Flor Naturals
Plain Jane Beauty
Ancient Cosmetics
Hue Noir
Lotus Moon Skincare
For the Fashion Conscious:
Merit ‘Fate’ Bucket Hat, $20
Chris Cardi Signature TwistDYE Tee, $33
Lettie Gooch Black Mineral Washed Jacquard Leggings, $68
Lettie Gooch ‘Smiling On The Inside’ Mask, $28
Kashmir Viii Face Masks, $16
Kashmir Viii ‘Around The Way Girl’ Clutch, $45-$60
Galerie LA Hemp Tie Button Down Sage, $90
Galerie LA Gratia Jumpsuit Tumeric, $100
Galerie LA Red Zipper Wallet, $45
Galerie LA Dopp Kitt (Makeup Bag) in Navy, $40
Galerie LA Lunar Star Earrings, $100
Galerie LA Meria Sunglasses Coral Pink, $75
Galerie LA Oda Ring, $45
Galerie LA Sabbath Cocoon Tunic, $85
Tree Fairfax Keychain, $22.50
Tree Fairfax Lois Belt, $45
LoveCortnie Polka Dot Leather Key Chain Clasps, $15
LoveCortnie Small Leather Tassel, $17
LoveCortnie ‘Color Me’ Coin Purse, $30
LoveCortnie Envelope Card Holder (Black & White), $32
Rue 107 ‘Toni’ Bikini in XOXO Print, $98
Rue 107 Signature Pencil Skirt in XOXO Print, $68
Rue 107 Tied Cropped Tank in XOXO Print, $48
Rue 107 Tied Cropped Tank in Vintage Rose Print, $48
Rue 107 Signature Pencil Skirt in Vintage Rose Print, $68
Grant Blvd ‘Sustainable Shit Only’ Fanny Pack, $26
Ebony and Green Mindfulness Earrings, $10
For the Bookworm:
‘Daymares’ by Kenya Moss-Dyme, $12.99
‘Hood Feminism’ by Mikki Kendall, $26
‘The Source of Self-Regard’ by Toni Morrison, $28.95
‘Tar Baby’ by Toni Morrison, $15
‘The Beautiful Ones’ by Prince, $30
‘In Her Hands: The Story of Sculptor Augusta Savage’ by Alan Schroeder, $12.95
‘The Street: A Novel’ by Ann Petry, $15.99
‘Chasing Down a Dream: A Blessings Novel’ by Beverly Jenkins, $14.99
‘Rebel (Women Who Dare)’ by Beverly Jenkins, $5.98
‘Night Song’ by Beverly Jenkins, $8.99
‘Tempest’ by Beverly Jenkins, $5.98
‘Our Black Year: One Family's Quest to Buy Black in America's Racially Divided Economy’ by Maggie Anderson, $17
Rayo and Honey ‘Books Change Your Mind’ Pennant, $75
Jungalow Face Bookend Vase by Justina Blakeney, $98
Midnight Reflections Black Nerd Tote Bag, $18.99
Addie Rawr Book Club Dolls Stickers (Die Cut Stickers), $9.50
For the Kids:
Jungalow Leela Terracotta Rug by Justina Blakeney X Loloi, $89.00
Jungalow Pink Looped Wool Rug, $99.00
Galerie LA Kids Face Mask, $25
Duchess365 237 Canvas Print, $98.99
Duchess365 231 Tote Bag, $24.99
Duchess365 279 Art Print, $23.99
Duchess365 241 Framed Art Print, $47.99
Shea Makery PB & J Soap, $10
Shea Makery ‘Save A Life’ Mini Assorted Hand Soaps (Set of 12), $5
Little Leaders: Bold Women in Black History, $16.99
‘Clean Getaway’ by Nic Stone, $16.99
‘Bee Fearless: Dream Like a Kid’ by Mikaela Ulmer, $16.19
ABC Me Flashcards, $20
IkdKids Rag Doll, $40
KaAn’s ‘Living The Dream’ Denim Jacket, $40
Yinibini Baby Badminton Playing Octopus Tee, $23
Yinibini Baby Fox Pullover Sweatshirt Jogger Set, $41
Yinibini Baby ROAR Lion Hooded Pullover, $45
Yinibini Narwhal Toy, $28
For the Masculine:
ALWD Signature DC PROPER Sweatshirt, $40
Chris Cardi ‘Bastards’ Tee, $30.03
Merit Flannel Shirt (Green), $65
Kashmir Viii ‘Everybody Eats, B,’ Tee, $45
Kashmir Viii ‘The Knockout’ Tee, $45
Galerie LA ‘Mister’ T-Shirt, $45
Jeff Manning Art ‘Overflow’ Art Print, $30
Jeff Manning Art ‘The Golden Age’ Art Print, $45
Jeff Manning Art ‘Overflowed Emotions’ Art Print, $50
Levi Fisher Beard Bundle, $39.99
Scotch Porter Face Care Collection, $28.99
Scotch Porter Journal, $9.99
Shea Makery Beard Oil, $15
Enbois Matte Lava Rock Bracelet, $40
Enbois Benji Matte Sunglasses, $45
Enbois Bracelets Collection - Cocoa, $50
The Silver Room Tourer Backpack, $95
Urban Profile Black Panther Shirt, $24.99
Solo Noir Starter Kit, $28.99
Bevel Shave Starter Bundle, $89.95
Bevel Skin Starter Set, $61.95
For the Tech Savvy:
Enbois iPhone Case, $12
Enbois Power Bank, $15
Enbois Grip Socket, $4
Chic Geeks Brown Faux Crocodile iPad Case, $75
Chic Geeks Brown Snakeskin iPad Case, $75
Chic Geeks Emerald Faux Crocodile iPhone Case, $50
Chic Geeks Grey Marble MacBook Case, $80
Chic Geeks Black Faux Crocodile iPad Case, $75
Khristian A. Howell Cava Melon Sleek and Chic Phone Case, $39.99
Khristian A. Howell Cava Black Sleek and Chic Phone Case, $39.99
NSPRE ‘Inferno’ Bluetooth Sunglasses, $71.99
NSPRE Micro SD Card (128GB), $21.98
NSPRE ‘The Ombres’ Bluetooth Audio Sunglasses, $59.99
NSPRE ‘The Solars’ Bluetooth BlueTech Glasses, $59.99
For the Goth/Kawaii:
VickiBeWicked Vinyl Sticker Heart Drippy Mushroom, Laptop Decal, $4
VickiBeWicked Rainbow Unicorn, Black Girl Magic Laptop Sleeve, $30.99
VickiBeWicked AfroGirls Masked Up Laptop Sleeve, $30.99
VickiBeWicked Pastel Horn Face Resin Keychain, $12.99
VickiBeWicked Red and White Splatter Skull Dangle Earrings, $7.50
Kashmir Viii ‘The KeKe’ Print, $35-$60
Adorned by Chi ‘Goth Club Presidenct’ Unisex Raglan T-Shirt, $34.99
Adorned by Chi ‘Pro Black’ Unisex Raglan T-Shirt, $34.99
Adorned by Chi ‘Pretty Girls Like Anime’ T-Shirt, $32.99
Adorned by Chi ‘Awkward’ Iron-On Patch, $11.99
Adorned by Chi ‘I Need My Space’ Hard Enamel Pin, $12.99
The Colour Polka Dot iPhone XS ‘Creepy Cute’ Rainbow Phone Case, $40
The Colour Polka Dot ‘Creepy Cute’ Spoopy Ornaments, $12
The Colour Polka Dot ‘Kawaii Cute’ Face Mask Case, $16
Embrii Shop Blush Pink Laptop Sleeve, $36
Gothic Lamb Anti Social Goth Club Tee, $28
Gothic Lamb ‘FedUp’ Tee, $24
Gothic Lamb ‘Make America Goth Again’ Tee, $28
Gothic Lamb ‘Melanin Manson’ Tee, $24
For the Esoteric:
Behati Life Third Eye Vision And Prophetic Dreams Intention Oil, $22
Behati Life New Moon Bath Soak Herbal Mix, $22
Behati Life Lunar Goddess Moon Magick Intention Oil, $22
Lettie Gooch Ecuadorian Palo Santo Quartz Crystal Bundle, $18
Jungalow Chaya Wallpaper in Amethyst by Justina Blakeney, $5
The Silver Room White Sage Bundle, $6
Grandma Baby's Black Gold Lenormand Tarot Deck, $44
Pretty Spirits ‘The Truth’ Decks, $50
The Afro Tarot, $88
The Hoodoo Tarot: 78-Card Deck and Book for Rootworkers by Tayannah Lee McQuillar, $18.66
‘Rootwork: Using the Folk Magick of Black America for Love, Money and Success’ by Tayannah Lee McQuillar, $11.99
Rituals + Ceremony Palo Santo Pack, $7
Rituals + Ceremony Empowered Vibes Ceramic Incense Holder, $10
Rituals + Ceremony Adinkra Intention Candles, $23
Rituals + Ceremony Cleanse and Protect Ritual Kit, $34
Rituals + Ceremony Crystal Candles, $22
Rituals + Ceremony Crystal Bliss: Attract Love, Feed Your Spirit, Manifest Your Dreams Book, $14.99
Ebony and Green Raw Clear Quartz Earrings, $15
For Your Activist Bae:
Kashmir Viii ‘Kash’s Bacon Shack’ Clutch, $45
Kashmir Viii ‘Copy and Paste’ Tee, $45
Kasmir Viii ‘We Did It First’ Stickers, $5.25-$20
Kashmir Viii ‘Reclaim It’ Clock, $45
Kashmir Viii ‘The Black Family’ Tee, $45
Jeff Manning Art ‘MLK’ Art Print, $35
Jeff Manning Art ‘We Shall Prevail’ Art Print, $45
‘The Spook Who Sat By The Door’ by Sam Greenlee, $21.99
‘The Black Panthers Speak,’ $20
The Black Power Mixtape: 1967-1975, $22.95
A Beautiful Ghetto by Devin Allen, $26.95
‘Are Prisons Obsolete?’ by Angela Davis, $15.95
Angela Davis T-Shirt, $25
Legendary Rootz ‘Black Girls Are The Purest Form of Art’ Tee, $25
Alex Carter ‘BLACK BUSINESS OWNERSHIP’ Tee, $50
Rayo and Honey ‘Much To Be Done & Undone’ Pennant, $75
Rayo and Honey ‘Black Lives Matter’ Pennant, $75
Rayo and Honey ‘Joy Is An Act Of Resistance’ Tote Bag, $65
‘They Carried Us: The Social Impact of Philadelphia’s Black Women Leaders’ by Allener M. Baker-Rogers & Fasaha M. Traylor, $ 28.99
Midnight Reflections Black Radical Woman Tank, $25.00
The Colour Polka Dot ‘Fuck Racism’ Resin Heart Keychain, $8
Rituals + Ceremony Be The Change Scented Candle, $24
Grant Blvd ‘Disrupter’ Tee, $30
Grant Blvd ‘End Cash Bail’ Hoodie, $54
Cards, Notebooks and Wrapping Paper + Holiday Ornaments:
VickiBeWicked ‘Skull Santa’ and Candy Cane Greeting Cards, $2
Harlem Candle Company Set of 10 Vintage Nightclub Greeting Cards, $30
Kashmir Viii ‘Nina En Printemps’ (Nina Simone) Notebook, $14
Kashmir Viii ‘Boo Yow!’ Notebook, $14
Midnight Reflections Wrapping Paper 3-pack, $26.97
Midnight Reflections Claus Ceramic Ornaments, $15.99
Midnight Reflections Emoji Black Santa Christmas Stockings, $24.99
Bylianarae Note Cards, $15
KazvareMadeIt Rap Lines Inspirational Coloring Book, $18.20
KazvareMadeIt Lemonade Notebook, $18.20
KazvareMadeIt Fried Egg Wallpaper, $4.88
KazvareMadeIt Diamond Retro Wrapping Paper, $4.88
Khristian A. Howell ‘Speak To Me’ Wallpaper, $12 (sample pack)
Khristian A. Howell ‘Palm Springs’ Gift Wrap, $8.99
Khristian A. Howell ‘Sonar’ Gift Wrap, $8.99
Khristian A. Howell ‘Twinkle’ Gift Wrap, $8.99
Khristian A. Howell ‘Ansley Park’ Gift Wrap, $8.99
Khristian A. Howell ‘Rosy’ Holiday Gift Wrap, $8.99
Khristian A. Howell ‘Long Weekend’ Gift Wrap, $8.99
Khristian A. Howell ‘Bonjour’ Card Set (10 pk), $18
GreenTop Gifts ‘Clarence Claus’ HOHOHO Gift Wrap, $7.50
GreenTop Gifts ‘Clarence Claus’ Do Not Open Gift Wrap, $7.50
GreenTop Gifts ‘Clarence Claus’ Candy Canes and Trees Gift Wrap, $7.50
Addie Rawr 2021 Planners (Preorder), $30
Addie Rawr The Great Gratitude Journal, $20
Addie Rawr The Great Gratitude Journal, $20
206 notes
·
View notes
No One Really Dies In Derry
From The Bradley Gang chapter of Tales From Neibolt
The lightning pulses across the gray October sky as Arthur, decked out in his spectacles he seldom wore, leans under the hood of the broken down LaSalle. George and Al stand beside him, restless eyes switching between the car's innards and the moonless cloudy night sky, with the storm just beginning to gather momentum. George has a small flashlight raised just above Arthur's head, highlighting the smoking engine.
George's wife Kitty remains inside the vehicle, fingering her compact mirror, trying in vain to powder her nose in the less than adequate lighting.
Parked just behind the LaSalle was a Chevrolet, with Joe's arm hanging out the driver window, cigar smoke clouding from his thin lips, elbow rested along the door. His brother Cal sat in the passenger seat, leaning on his hand, looking thoroughly bored with the situation. In the backseat are Marie and Patrick, with Marie leaning against his thick brown coat.
"Think we can get it going again?" George queries as he nervously casts his gaze around them, his timorous visage briefly made visible in the crack of light that splits across the sky. Marie nuzzles closer to Patrick, tucking her head down as thunder rolls above them. Patrick pulls her closer, stroking her brown curls.
"The engine's blown..." Al offers, ducking down to inspect closer.
"Aye. Seen better days, I'm sure," Arthur slams the hood down and wipes his hands with a stained white handkerchief from his pants pocket. "This ain't goin' nowhere, lads."
"Shit," George straightens as he switches off the flashlight. "What we gonna do?"
"Dunno." comes Al's simple reply.
They were safe, far away from the Lafayette city limits. After dumping the body of the banker they'd kidnapped in a swamp after collecting the thirty thousand in ransom money, they were on Route 2 in direction to a town called Derry after a brief stop in Augusta. Arthur, however, had his sights set on Bangor. When the LaSalle broke down just short of them reaching the Derry welcome sign along the shadows of the trees on the outskirts of the town.
A hush falls over the group as Al saunters out onto the middle of the road, sniffling and kicking a pebble aside. That's when he sees, in the far off distance, a pair of headlights appearing almost out of nowhere. He rushes to the driver's side of the LaSalle and reaches for his Colt .38 revolver-small and discreet, so as to be presented at the first sign of trouble.
He stands and waits as George tosses the flashlight in through the back window of the LaSalle and stands alongside Al, arms folded, not nearly as alert as his big brother.
Inside the Chevrolet, Patrick rests his hand on his Luger laying on the seat beside Marie that he'd stolen off the body of a Lafayette officer.
Meanwhile, Joe and Cal also ready their weapons, with Joe craning his neck out the window to view the car drawing closer.
Arthur casually strolls to the passenger side, eyeing his own much larger Remington 22. Al preferred a sneak up and get them approach. Arthur preferred things more direct. If whoever this was coming up the road was going to give them trouble, they would be dealt with accordingly before they even knew what hit them.
The car, a Ford Roadster, quietly comes closer, eerily serene, the headlights taking on a more orange tint as it draws near. It comes to a stop alongside the Chevrolet, the silhouette of a driver, a man with hat, is barely visible.
As he shuts the engine off, he sits a moment, George tightens his grip on his revolver as Arthur keeps watch on his Remington. Then the man leans over to the passenger side, rolling down the window.
"You needing some help there?" a gravelly voice drifts out of the Ford, a hint of a lisp making the 's' sound more like 'shum.' Al snatches up the flashlight and strolls over, shining it in the man's face and is a little taken aback by what he sees.
Scars. Thin pale scars, ever so faint, threading up the man's creamy cheeks, beginning at the corners of his mouth and ending just under the rim of his Homburg hat.
"You needing some help?" the scarred man repeats. "I've fixed a car or two here and there. I could take a look-see."
"Yeah, yeah...sure." Al replies, studying the man's features, with his square jaw and intense round eyes.
This guy looks like he knows where some bodies are buried.
Al tenses as the driver side door pops open and the man emerges, revealing an incredibly tall frame in a sleek gray suit. Certainly taller than all of the men in their group.
In fact, he was a good foot taller than Al.
No matter. If this fellow pulled any funny business, they outnumbered him.
"Here," the man saunters over to the LaSalle, popping open the hood. He reaches his long arms in and begins tampering with the wires. Not long after there's a loud 'pop' sound and the engine roars back to life, taking a few minutes to struggle before running smoothly. Arthur gives a pleased nod of his head.
"Thanks mate!" He gives the man an enthusiastic pat on the back as Al looks relieved, exchanging glances with George.
"What's your name , my good sir?" George inquires.
"Robert. Robert Gray. Although folks 'round here call me Bob."
The man shuts the hood and returns to his car, before he removes his hat to give his scalp a quick scratch, revealing a shock of auburn.
"You folks needing a place to stay for the night? Something tells me you'd rather not be in a motel. Gotta place just a mile up the road. Nice and cozy," he gazes at Kitty and Marie. "The ladies can clean up. Sit by the fire, get warm. Maybe a hot meal."
Arthur looks at both George and Al, who in turn glance to Joe and Cal, with Patrick keeping his eyes on the strange man, sizing him up.
Something not right with that fella.
"I'm pretty knackered," Arthur whispers as he tilts closer to Al and George. "And if this chap thinks he's gonna pull something, we'll handle it. At any rate, we'd have a place to lay low. If he oversteps, we'll teach him a lesson."
"Looks like somebody already did." Al retorts before turning on his heel to face the man. "Alright. One night. We'll be outta your hair come morning."
"Great!" the man replies, grinning as he retreats back inside the Roadster. Patrick is watching the man from behind the foggy glass of the backseat window, brows knotting together as the man begins to drive ahead. Arthur, Al and George retreat back into the LaSalle and follow, with the Chevrolet right behind.
Patrick taps Joe on the shoulder. He grunts in response. "What's it now, Caudy?"
"That guy, he don't look right to me. Got a feelin' in my gut," Patrick says, keeping his dark eyes fixed ahead on the Roadster. "He's bad news, I can feel it."
"And if you're right, we'll put a bullet in his melon. No big deal. Guy seems kinda dopey to me anyhow," Joe says breezily as he chucks his cigar out the window. "Not really a threat. Doubt he's ever fired a gun in his life."
Patrick is not convinced. "You saw his face. He looks like a blind man tried to take a whack at him," he glances at Marie. "And I don't like how he was lookin' at her."
Joe chortles softly to himself. Doubt she'd mind it.
At this, point, both he and Cal had secret trysts with her behind Patrick's back. He suspected she'd also been fooling around with Arthur too. An assumption born out of her comment about his "sexy" Irish accent.
Funny, Patrick was suspicious of total strangers, but not the men he'd grown to call friends.
Maybe it's because he'd never had any before. His paranoia was off-putting but also what made him so kill crazy. Handsome to look at, but underneath was a volcano. Always ready to erupt at the slightest provocation.
Not tonight. Joe would see to that.
"Don't go pulling any of that shit. We don't wanna be drawing attention to ourselves here. Not in this hick place. You know these small towns. Everyone knows everyone. Just keep quiet. We don't need a repeat of Toledo."
Patrick had gone ballistic on a gas attendant he'd thought muttered some smart-ass comment under his breath. They'd sped out of there after Patrick splattered the man's brains along the smooth concrete with a single clean bullet to the temple.
Patrick sits back, roughly pulling Marie to him as Joe glances at the street sign; 29 Neibolt.
The Roadster parks in front of a large Victorian house. With the LaSalle and Chevrolet lining up right behind.
"Whoa," Cal mumbles as he peers around his brother to glimpse the place. "Seems this fella might have some serious dough."
"Looks like a dump to me." Joe replies, shutting off the engine and swinging open the door. He was not a man who was easily impressed and he'd robbed much more grander mansions than this in Danville.
"Kinda gammy looking." Arthur mutters to himself as he slides out the LaSalle.
Patrick steps out, followed by Marie, who looks dazzled, her hazel eyes wide and her ruby red lips breaking out in a smile. It was the style of house that had always struck her fancy.
"This place is gorgeous. Just look at that architecture! It's a palace!" she exclaims as she rushes ahead, making her way to the front porch, past sunflowers sprouting from the grassy front yard. Robert reaches down and plucks one, handing it to Marie.
"Sunflowers symbolize healing and good luck." he elucidates as she tucks it behind her ear. Patrick stands glaring as Joe touches his shoulder.
"Don't. It's harmless." he growls.
"Thank you. That's really very sweet, sir." Marie touches the flower.
"Sweets to the sweet, I say." Robert replies.
Patrick shakes Joe's hand off before he stalks towards the porch as everyone begins to pile into the home. As elegant inside as out, with a lovely red Victorian chaise lounge, matching camelback sofa and parlor chairs, each one sitting across from each other in front of the fireplace. The mantel boldly read 'Good Cheer, Good Friends.'
George smiles and playfully swats Robert's arm. "We're good friends now, eh, Bob?"
And friends help each other.
Too bad we don't have the means to clean this place out. The furniture would make a buck or two.
Robert merely smirks. A slow, deliberate smile as he looks at George. "Sure thing there. Why don't you all have a seat. I'll be right back."
"That's what my ex-wife said." Arthur quips as he collapses on a parlor chair, sprawling his legs out. It takes him a moment to notice; there's a fire now crackling inside. He stares at it, puzzlement blinking across his mien.
Huh, when did he do that? It wasn't going when we arrived and he didn't go near it...
No matter. Just enjoy it.
Kitty approaches the mantel, running her long shiny nails along little figurines of clowns, each made of delicate painted porcelain, juggling, balancing and one holding a bundle of red balloons.
"These are beautiful figurines." she says, tucking a tendril of sandy blonde behind her ear, bringing her blue irises closer to examine the fine details.
"Take one. Just throw it in your purse. Might as well." George blurts out. Kitty whirls around.
"We're his guests. He was kind enough to let us in here-"
"Come now, lass. Let's not pretend this bloke is an average citizen. You saw his face." Arthur offers, stretching his arms and folding his hands behind his skull, giving her an amused expression. "Looks to me like he may have been in a wee bit of trouble. He was probably acting the maggot and someone decided enough was enough. Could be a right eejit."
"Yeah," Al cradles his chin in his left fingers, massaging the dark stubble. "There's something...I gotta feeling he wouldn't rat us off. There's no way he wouldn't of recognized me, at least."
He's hiding something himself. Al could always sense them. His fellow ' bad seeds.' The people who ran in the gutters. The lowlifes. He could always pick them out.
The wanted posters were scattered across the midwest, plastered along buildings, hanging in post offices and police stations baring Al's face; wanted for bank robbery kidnapping and murder, with a reward of five-thousand dollars offered. He'd taken up with his old childhood friends the Conklin brothers Joe and Cal, who were small time, with but a few petty theft arrests between them. Patrick had killed a cop in Lafayette during their last raid and prior to that had just a few arrests for assault. He was a friend of Joe and Cal from their early gang days and they'd reconnected with him when Joe briefly did time for robbery, knocking off a small liquor store in Bloomington. He and Patrick had shared a cell.
As for Arthur Malloy, also known as 'Creeping Jesus' because he was nearsighted, he'd fled Ireland after killing a man he claimed insulted his dead sister who'd just passed away from tuberculosis. ("Kicked 'em square in the plums, then put a bullet in his brains, I did.")They'd met when Arthur was attempting to knock off the same liquor store as them and offered his LaSalle that he'd stolen as a getaway.
Patrick's girlfriend Marie Hauser had inadvertently joined the gang, initially trying to persuade him to leave, but soon became an active member. But her role was mostly cooking and washing linens, hence her much-despised nickname, "The washerwoman."
George's wife Kitty Donahue was another matter. She entered the gang enthusiastically and without hesitation, but Al has never so much as seen a gun in her hands. Not one for shooting, she'd say.
Patrick sits on the camelback, with Marie beside him, still happily fingering the sunflower. He glances up as Robert emerges, hat and coat discarded and hair combed back. He points towards the kitchen.
"This way," he says, gliding down the stairs. "Let's eat. Got some stew heating on the stove. Some wine on the table."
Arthur pauses as they all stand, the edges of his brows coming together in rumination.
When did he get that going?
Shaking the thoughts from his mind, he continues on with the others, with Kitty quickly swiping one of the figurines from the mantel and tucking it into her purse. The one with the balloons.
They all settle around the large rectangular mahogany-carved table with Robert dumping a hefty spoonful of a rather unappetizing red slop into each bowl. Patrick suddenly rises.
"Where's your bathroom?" he queries curtly.
Robert points. "Third door on the right."
Patrick darkly glances at Marie, then Robert before exiting. The murmuring of the group's voices fade as he stomps up the stairs, making his displeasure with the situation known. Of course, his real intention was to inspect this place. Make sure no one was hiding anywhere. He makes his way along the house's arteries, looking in various rooms, until he hears a door loudly creak. This makes him halt, glancing over his shoulder
The door to a room across from him is ajar, the lights inside faint, but enough to showcase what's inside.
Clown dolls.
Patrick charily begins to edge towards it, his boots stepping lightly as he sneaks up. He knew that man was strange. Something off about him. This could be an ambush. Nobody is this gracious. Not in his life experience. Everyone is always wanting something from you.
"Ah-ha!" he shouts, throwing open the door all the way and leaping in. He stands a moment, surveying the area with the clown dolls of all shapes and sizes along the wooden floor. Framed along the walls; more clowns of the sad crying variety.
"Jesus..." Patrick strolls over to the windows-also baring clowns-the circus-themed stained glass were partly obscured by thin brown cloths layered thick with dust.
Heh,heh.
Patrick spins around.
Who was that?
He reaches inside his coat and grips his Luger. "Hey, who's there?"
It had sounded like a man's voice inside the room with him, but before he could comprehend where a possible attacker could be hiding in here, he sees that the heads of the creepy dolls are now all turned towards him. Watching.
Whoosh.
The cloths covering the windows plunge to the floor and Patrick flinches as he turns to face the sound.
Hee!
Patrick does another turn around to face the clowns. That one sounded like a child. Specifically a girl coming from somewhere within the clutter of the room.
In that moment, Patrick feels something he hadn't felt in ages, since he was a boy running from his father's belt; fear. A powerful, overwhelming sense that he needed to leave this room now. The instinct to protect himself had kicked in.
He dashes towards the door, coming to a skidding stop before it slams shut. His breathing heavy, his heart hammering against the cavity of his chest.
Back in the kitchen, Patrick storms in, returning to his seat, sweat pearled along his large forehead. Marie touches his trembling hand.
"You alright?"
"Yeah, fine," he breathes, wild pupils directly on Robert. "Got a thing for clowns there, Bob?"
Robert slowly chews, staring back, before loudly swallowing. "Yes, sir. You could say that...I see you found my collection. "
"And it's a lovely one. I saw your figurines." Kitty interjects.
"Pretty fuckin' weird to me. A grown man..." Patrick grumbles. "What you hidin' in here?"
Robert sniffles, nibbling on his food. "Nothing, I assure you, Mr. Caudy-"
"Oh bullshit! What are you hidin'! What's in that room you freak!?" Patrick shouts as he stands, with Marie trying to subdue him and Joe mouthing curse words, when Kitty shrieking at the top of her lungs shatters the tension.
All eyes are drawn to her as she stares gaping at her spoon. "It's a finger!" she screams, holding it out for George to take a look. Upon inspecting it, he chuckles.
"It's a carrot honey." he pushes the vegetable slathered in red sauce around on the spoon.
"I swear, for a moment it looked just like a finger! A child's finger." Kitty pants, her palm clasped to her chest.
Patrick sinks back down to his chair, not taking his eyes off Robert, who chuckles.
"No fingers. Just an old family recipe, you could say."
"And what of your family Mr. Gray? Do you have a wife? Kids?" Marie chirps, trying to calmly rub Patrick's forearm. Robert considers a moment.
"No wife. No kids."
"Had to think about it huh?" Patrick cuts in. Joe gives him a swift kick to the shin under the table. Patrick glowers.
Unfazed, Robert continues, "I live alone. Just myself. Seems I've been alone for an eternity." he chortles that last line, as he sips his wine.
"I'd die from the loneliness." Marie replies.
"Nah, no one really dies in Derry." Robert says, to which an awkward silence falls over the table.
After a few beats of quiet. "So, uh, swinging bachelor huh?" George grins. "I kind of envy you..."
At this, Kitty scowls, gently, playfully swatting his arm. Al then stands, pushing his chair out. "Well, we best be getting to bed. We got an early start tomorrow." he announces.
Robert shows them to their rooms, pulling blankets from the closets for makeshift beds on the floors of the bedrooms to accommodate all of them, with Arthur opting to sleep downstairs on the camelback. Patrick keeps Marie locked in his sights as Robert bids them goodnight, shutting off the lights.
The house falls dark, with no sound, not even the thunder could be heard. Just deathly cold silence. As each member of the Bradley gang dozes off.
Patrick, having fallen asleep with troubled thoughts, realizing the man knew his surname when he'd not offered it, is soon awakened by a pair of hands on him. Small hands, shaking him violently.
"The Hell?" he mutters, wiping the sleepiness from his eyes as he looks up. Nothing there. He sits up, glancing at a slumbering Marie as he is pulled, almost hypnotically, to that odd clown room again. Almost as if waiting for him, the door swings open. Hearing the beckoning of a little girl's voice, not very audible before, but crystal clear now.
"Molly..." he whispers as he sees a miniature coffin now on display between the stained glass windows, the clown dolls forming a pathway as he approaches.. The door quietly shuts behind him as the coffin lid creaks open. He glances down at his hands, seeing he is now smaller, childlike, around twelve. The age he was when Molly drowned.
In her coffin, her eyes are closed, her face sweet. Her skin a pale blue and her brown ringlets held by pink ribbons. Sniffling, Patrick leans in to kiss her cheek. "I'm so sorry I couldn't save you." he whimpers through stinging tears. As he hangs his head, Molly's eyes burst open and she draws in a sharp breath.
"Ah!" Patrick stumbles backwards as Molly bolts upwards scowling, mouth sneering in contempt.
"Sorry for what? Hitting me in the head with that rock and accidentally knocking me into the river or running off like a coward? You didn't even try to save me, you fucking wimp."
She steps out of the coffin and leaps to the ground as Patrick watches her features distort, growing more white, her lips redder. She spreads her arms out, grinning maniacally, her angelic voice now raspy and insidious.
"Beautiful fear." she grins as she runs at him, roaring as she displays quill-like teeth, growing taller, her brown locks turning orange, her frilly pink dress becoming a gray-white. The clown dolls hiss with laughter as Patrick is backed against the door, which suddenly opens and Marie is there, screaming as the Molly creature, now a lanky tall clown with a striped face, comes at them. Patrick, now an adult man again, staggers up, terror gripping every inch of his being as he slams the door, yanking Molly away.
In the next room, George, Al and Kitty are awakened by the screams, as Kitty flips on the bedside lamp, standing just before them is the banker, covered in blackened mud and slime, his jaw dangling as he reaches his dislocated right limb out towards them. A deep otherworldly moan emitting from his misshapen mouth.
"Oh my God! Oh my God!" Kitty screams hysterically as George and Al reach for their guns, finding they are unable to fire.
"What the Hell! My gun is jammed up!" Al yells as they scramble for the door. Thankfully the banker zombie was nowhere near their escape route and they dash out, meeting Marie and Patrick, both holding each other. The lights above them flicker off and on, with a hideous high-pitched giggle echoing through the walls as Joe and Cal burst from their room, both looking pale.
As if they'd seen a ghost.
"That gas station worker Patrick iced? He's in our fucking room! Looking like he crawled straight outta his grave!" Cal yells.
Just then, they hear Arthur shouting. They all make their way downstairs, where Arthur is in the kitchen, his scrawny frame cowering against the wall, yelling as he points at a large boiling pot on the stove.
"I woke up and heard someone in the kitchen then I-I saw..." he stutters as he points a shaky finger at the pot. George steps over and gags at what he sees.
A head. Too disintegrated to tell the gender or age, boiling in blood. The sight and smell of rotting flesh sends George gagging and choking as he falls backwards, covering his mouth.
"Jesus fuck!"
"What is it?" Kitty demands.
"Never mind." George coughs.
Huddled together, they run towards the front door, The lights still flashing, the ugly laugh still reverberating. They all jump into their cars and by the grace of God, the LaSalle starts, engine blaring as they speed away. Some only barely clothed, with Marie wrapped in Patrick's coat that she often slept in to keep warm.
As dawn bleeds through the sky and the gang take refuge in a nearby farmhouse, the extra clothes and guns in the trunks of the cars coming in handy, The women take a calming trip to Freese's with Patrick in tow while the rest of the men went to Machen's Sporting Goods to order some more supplies. Lal, the owner, recognized Al immediately, despite the fake name he'd given; Richard D. Rader, and informed some of his buddies that he was expecting Al Bradley at two in the afternoon the day after tomorrow and just as the LaSalle and Chevrolet came into view on Main Street, the gang of Derry residents, armed to the teeth, opened fire.
As the shoot-out ensues, Biff Marlow, one of the gunmen, spies a scar-faced man in a gray suit with a sunflower tucked in the left breast pocket firing a Remington along with them. In fact, all the gunmen had spotted this complete stranger. They all figured he was an outsider wanting to join the party. Afterwards, as the bodies of the notorious Bradley Gang were on display in the bullet-ridden Chevrolet and LaSalle, Marlow watches as the man strolls away, whistling, one hand cradling the Remington on his shoulder, the other in his pocket.
Marlow could never be certain, and it bothered him for years after. Something he related to his drinking buddies while reminiscing about the killings. He could have sworn that, despite the bright sunlight, the stranger didn't cast any shadow.
No shadow at all.
43 notes
·
View notes
Best Brick and Concrete Removal Service and Cost in Wichita KS |Wichita Household Services
more information is at : https://wichitahouseholdservices.com/brick-and-concrete-removal-service-near-me/
Brick and Concrete Removal Service near Wichita KS: Are you looking for the Best Brick and Concrete Removal Service near Wichita KS? Wichita Household Services, We have been taking care of both residential and commercial clients and providing them with the best results possible. We take this line of work seriously and it shows in the superior quality results that we are able to provide for each of our clients. Cost? Free estimates! Send us a message or call us today. Best Brick and Concrete Removal Service around Wichita KS. We serve Wichita KS and other areas. Get a Free Quote Now!
BEST BRICK AND CONCRETE REMOVAL SERVICE IN WICHITA KS
WICHITA BRICK AND CONCRETE REMOVAL
BRICK AND CONCRETE REMOVAL
Brick and Concrete Removal Service near Wichita KS: We have been taking care of both residential and commercial clients and providing them with the best results possible. We take this line of work seriously and it shows in the superior quality results that we are able to provide for each of our clients. Our main goal is to provide each and every client with the finest in workmanship and customer service.
When we have completed our work, we will leave you with work that you can live with, and love, for years, if not decades, to come. Our quality craftsmanship will withstand the tests of time and enhance the architectural aspects of your residential or commercial building. Wichita KS is known for many things, one of those being the infamous skyline and cityscape made up of stunning buildings; there is no reason your own building can't be included in the list of stunning buildings. Give us a call today and let us help you by taking care of whatever masonry services that you may need, with skill and precision.
Our goal is to start and finish a quality service with no down time or delays. Our supervisors prepare the site with the engineers and architects before the work commences.
Commercial & Residential
● Concrete
● Sidewalks
● Floors
● Basement Floors
● Sidewalk Vaults
● Drywells
● Handicap Ramps
Brick& Stone
● Brick Steps
● Concrete Patios
● Bluestone Patios and Steps
● Stone Steps
● Hardscapes
Brick Replacement/Removal Process:
Brick and Concrete Removal Service near Wichita KS: While taking care of the adjoining bricks which are well-shaped and undamaged, the broken bricks are removed from the area. New matching bricks are installed using Masonry Mortar Cement. We put our maximum efforts to match the new bricks’ color with the old bricks as well as with the building / house décor. If in case 100% match of colors becomes impossible, then we use the most closely possible match and get it approved and accepted by the Project Manager / Owner before Brick Installation / Brick Replacement Work takes place.
In case the site manager / owner requires, a single or two coats of Clear Water Sealer are applied.
WHAT ELSE WOULD YOU WANT!!! Our services are available at very affordable prices. You only have to give us a call and get a Free of Cost Estimate. Not only this, we’ll not even charge you for consultation or site visit. Isn’t that Great?
Brick Repair & Replacement Specialists
Brick and Concrete Removal Service near Wichita KS: At Wichita Household Services Contractors, we take this line of work seriously because it can help prevent dangerous circumstances, such as having a wall collapse. Repairing and replacing bricks is also an essential step in preserving historic aspects of the architecture here in Wichita KS. Plus, it is simply of the utmost importance to be able to be there for the needs of our customers and provide them with the quality of work that they need, want and should be able to expect. Being able to repair or replace bricks saves you the time and money required to rebuild.
We will work with you and conduct an assessment of the current condition of the brick in order to determine if repairs will be enough. If the damage is too severe or it would be more cost-effective to just replace the brick, then we can move on to that phase. We will always provide you with the honest feedback you deserve. Our goal is to build long term working relationships with our clients and the only way to do this is through quality of work and integrity of service.
COST
How much does it cost to remove concrete?
Brick and Concrete Removal Service near Wichita KS: Made of a mixture of Portland cement, aggregate, and water, concrete slabs, floors, and foundations are built to last. Over time, however, they may settle, crack, or develop holes that can’t be fixed any longer. When this happens, the best thing to do is to remove the old concrete and pour some fresh. Whether you need a new garage floor, a new driveway, or you’re getting rid of an old in-ground pool, the method of concrete removal is generally the same.
The size and location of the concrete you are removing is the single biggest factor driving the cost of the job. The larger the amount of concrete, the more expensive the job will be. Final costs will also be impacted by whether or not the concrete can be recycled, and whether you will need to pay disposal fees. On average, removing unreinforced concrete in a two-car driveway costs $1,500-$2,500.
Types
The mixture of concrete you’re removing can vary slightly from job to job. There are two basic types of concrete, however, which are generally used for driveways, sidewalks, foundations, and other areas in and around your property:
● Reinforced concrete uses steel rebars 1 set into the concrete to strengthen it. This type of concrete often needs to be lifted up in larger pieces, often by machine such as a hydraulic lifter, simply because it’s more difficult to break up. This type of concrete is also less likely to be recycled, resulting in higher disposal fees, because a small patio can weigh up to 5,000 pounds. A 200 square foot patio will run around $600 plus removal fees, which can add as much as $2,000 to your total costs for a total of $2,600.
● Unreinforced concrete is easier to remove, as well as lighter and easier to dispose of. 1.5-inches of concrete weighs roughly 18 pounds per square foot, and costs roughly $400 to remove using jack hammers and a hydraulic lift. If the material can be recycled, disposal fees are usually minimal, but if disposal is necessary, it can cost another $500 to $600 in fees.
Labor
Brick and Concrete Removal Service near Wichita KS: The vast majority of concrete removal services will price per job. The most common jobs include:
● Removing a patio at roughly $400 to $600, assuming 200 square feet of unreinforced concrete, this job will take roughly two to three hours. Reinforced concrete removal will cost $600 to $800, and take roughly three to four hours.
● Removing a 2 car driveway at roughly $1,500 to $2,500, assuming the concrete is unreinforced, this job will take 4 to 6 hours. Reinforced concrete will cost $2,500 to $3,500 and will take roughly six to eight hours.
● Removing a foundation at roughly $2,000 to $5,000, assuming the concrete is unreinforced, this job will take roughly eight to 10 hours. Reinforced concrete removal costs start at $5,000 and can take up to 14 hours.
FREQUENTLY ASKED QUESTIONS
Is all the concrete the same?
No, there are many different mixes which involve aggregate, cement and additives. Cement content is measured by the bags of Portland cement. A 5 bag mix has less cement than a 7 bag mix. To protect your investment, Glen Galis uses the highest quality mix for designs with durability and long lasting beauty.
How will concrete and materials be transported when trucks or machinery cannot access project area?
Wheelbarrows or motorized buggies (the size of a riding mower) will be used. Most fit through standard fence gate openings and leave little or no damage to your yard. Plywood will be placed on drive areas.
Will you backfill when finished?
Yes, we will backfill the project area when the forming material is taken off. In some cases we are able to reuse the dug out materials and in others we will use black dirt. We will ensure minimal (if any) distrupution to your existing surroundings.
Do you get the permits if required?
Yes, we can assist you or secure the required permits ourselves for your project.
What is the difference between cement and concrete?
Although the terms cement and concrete often are used interchangeably, cement is actually an ingredient of concrete. Concrete is basically a mixture of aggregates and paste. The aggregates are sand and gravel or crushed stone; the paste is water and Portland cement. So, there is no such thing as a cement sidewalk, or a cement mixer; the proper terms are concrete sidewalk and concrete mixer.
Can chips or cracks be repaired?
Yes they can. The staff of Glen Galis Concrete Inc. are fully trained in all aspects of concrete repair.
CALL FOR US:
● Brick and Concrete Removal Service Near Wichita KS
● Brick Waste Disposal
● Free Concrete Disposal
● Brick Removal
● How To Dispose Of Brick And Concrete
● Brick Disposal Wichita KS
● Concrete Disposal
● Concrete Disposal Cost
● Where To Dump Old Bricks
● Free Concrete Disposal Near Wichita KS
● How To Dispose Of Brick And Concrete
● Dispose Of Bricks For Free
● Brick Waste Disposal
● Concrete Disposal Cost
● Free Brick Disposal
● Concrete Waste Removal
● Brick Disposal Wichita KS
BEST BRICK AND CONCRETE REMOVAL SERVICE IN WICHITA KS
WICHITA HOUSEHOLD SERVICES
REQUEST MORE INFORMATION. CONTACT US NOW!
CONTACT US:
Wichita Household Services
We Offer Cleaning Junk Removal Movers Handyman Services
Call: (316) 448-3558
SERVICE AREA:
55 Cities within 30 miles of Wichita, KS:
Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS
ZIP CODES:
67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – BelAire or Wichita | 67221 – McConnell AFB | 67226 – BelAire or Wichita | 67543 – Haven
#Wichita
#junkremoval
#handyman
#householdservice
#movers
#cleaning
0 notes
Best Tile Flooring Refinishing Company Wichita KS | Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/tile-flooring-refinishing-near-me/
Looking for Tile Flooring Refinishing Service near Wichita KS? Handyman Services Of Wichita is the premier Tile Flooring Refinishing Service in the Wichita KS.Floor refinishing is an inexpensive way of bringing back the original look to your old floors.Best Tile Flooring Refinishing Service in Wichita KS. Cost? Free estimates! Call now or Send a quick message for an estimate.
REQUEST A FREE QUOTE NOW
TILE FLOORING REFINISHING SERVICE IN WICHITA KS
The Tile Flooring Refinishing will At Handyman Services Of Wichita, our experienced flooring experts can provide the best Tile Flooring Refinishing in Wichita KS at a very reasonable price.We take pride in offering the best Tile Flooring Refinishing.Our Handyman Services Of Wichita experts take pride in providing the best service in the Wichita KS area.
Tile refinishing
Tile refinishing transforms the appearance of old bathroom wall tiles without any of the mess and disruption associated with ripping them out and retiling. In addition to minimal downtime and inconvenience, tile refinishing is also cheaper and has the advantage of preventing grout mould at Wichita KS.
What is Tile Refinishing?
Tile refinishing is a technique for repairing and refinishing tiles using proprietary refinishing materials designed for bathroom wet areas. The appearance and durability of tile refinishing depends largely on thorough preparation and skilled application.
The cheapest quote might save a few dollars upfront, but may never look as good or last as long.
The procedure in Handyman Services Of Wichita followed by bathroom refinishing contractors who have been trained in the correct application of Worldwide Refinishing Systems can be summarized as follows:
1. Fix all loose tiles.
2. Clean out and re-grout where necessary to give smooth, well-profiled grout lines. Fill and sand any other holes and chips in the tile system.
3. Remove plumbing fittings in contact with the areas to be resurfaced.
4. Complete a surface prepping process on the tile surface to maximise bond strength and long term adhesion.
5. Mask all other surfaces to protect from overspray.
6. Apply bonding agent to the tile system, followed by up to 4 coats of the Classic Surface refinishing system.
7. Clear away and apply heat cure.
Ceramic Tile Refinishing
Ceramic Tile Refinishing is an Affordable, Durable and Beautiful Alternative to Removal and Replacement of Tile Countertops, Vanities and Walls.
Ceramic Tile Refinishing -- Do you understand the difference between ceramic tile refinishing and painting ceramic tile?
Ceramic tile refinishing is a process that involves specialized equipment, primers, bonding agents, top coats and clear finishes. The differences between painting vs. refinishing tile are durability, surface gloss and how long the new surface will last.
Ceramic tiles that are painted with simple spray enamels or with rolled-on epoxy will not look as good as professionally refinished tile. They will also not last as long as professionally refinished tile, nor feel like real tile.
Ceramic Tile Refinishing -- Can you reglaze tile?
Ceramic tile refinishing is the only practical way to reproduce the look of original tile in Handyman Services Of Wichita. The beautiful glaze you see in ceramic tile is baked on in kilns at temperatures ranging from 900F to 2500F. The term tile reglazing is a misnomer as it is impractical to remove ceramic tile that has been installed and ship it back to the factory for re-firing in a kiln.
Refinishing is a much better option to replacing ceramic tile. It is not only more practical, but also less expensive than new tile and you avoid the mess of removal and replacement.
Ceramic Tile Refinishing -- What is the process?
Ceramic tile refinishing by Handyman Services Of Wichita is a detailed and involved process.
First the tile countertop or tile bathroom wall is cleaned using a two-step process to remove dirt, oils, grease and soap residue. Once the surface is clean, any chips are filled in and the grout receives a thin, new coat to make sure the grout lines are filled and even.
Our Handyman Services Of Wichita Natural Accents stone look finish is our most popular tile-refinishing product. With dozens of beautiful colors to choose from, you’ll have the look and feel you’ve dreamed of. The unique Natural Accents process can be applied right over your dated and worn laminate, tile, cultured marble, and even fiberglass surfaces.
Ceramic Tile Refinishing -- Will it save me money?
Ceramic tile refinishing can be used on tile countertops, bathtub tile surrounds and tile walls saving you up to 50% over the cost of replacement. The results, especially if you choose Handyman Services Of Wichita Natural Accents stone finish, can be dramatic and is an affordable alternative to pricey Fand other solid surfaces.
Consider Natural Accents for your kitchen countertops, bathroom vanities and ceramic tile. Natural Accents multi-color stone look offers a high-end makeover for any decor – modern, traditional, country or casual – without the mess, time and expense of removal and replacement. The specks and flecks of different colors deliver a depth and character that you have to see to believe. The results are beyond impressive.
Ceramic Tile Refinishing -- Is it durable?
Ceramic tile refinishing using Handyman Services Of Wichita Natural Accents process involves a unique seven-step spray application to give you the most durable refinished surface possible...delivering a finish that is as long lasting as it is beautiful.
Natural Accents is seamless, non-porous, heat resistant and scratch resistant. In the unlikely event that the finish is damaged, it can easily be repaired – unlike stone and man made solid surfaces.
Ceramic Tile Refinishing – What should you consider before refinishing ceramic tile?
Ceramic tile refinishing can be used on most any tile surface, but you should consider how the surface is going to be used and how much wear and tear it will receive. Ceramic tile in a shower or surrounding a bathtub that will be subject to moisture can definitely be refinished. Ceramic tile on kitchen countertops and bathroom vanities are also excellent candidates for refinishing. Bathroom floors can be refinished but it is not advisable to refinish tile entryways where abrasive grit can damage the floors.
Call us for :
• Refinishing Tile Floors Ideas
• Ceramic Tile Refinishing Cost
• Resurfacing Tile Floor With Concrete
• Tile Refinishing Companies
• Porcelain Tile Refinishing
• Painting Floor Tiles Before And After
• Ceramic Floor Tile Refinishing
• Tile Reglazing Colors
BEST TILE FLOORING REFINISHING SERVICE IN WICHITA KS
HANDYMAN SERVICES OF WICHITA
REQUEST MORE INFORMATION. CONTACT US!
CONTACT US:
Handyman Services Of Wichita
Best commercial residential handyman maintenance professionals in Wichita KS
(316) 448-3974 HANDYMAN
(316) 500-7551 CLEANING
(316) 448-5733 JUNK REMOVAL
Location: Wichita KS
Timing: 7 AM – 11 PM
Websites:
handymanserviceswichitakansas.com
bestcleaningserviceswichita.com/
junkremovalhaulerwichita.org/
Service area:
55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS
ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven
#Wichita
#kanas
#handyman
#commercialhandyman
#residencialhandyman
#moving
#junkremoval
#cleaning
0 notes
To achieve strength, longevity and beauty- use Concrete coatings Augusta! Are you looking for the best decorative concrete services? Then you can reach out to B & B Decorative Concrete. They are experienced enough to give a much-needed makeover to old concrete and make it appear anew, afresh again.
0 notes
We’re bidding the stripping, re staining & clear coating of this front door & side lights of a home in the beautiful River Island subdivision of Evans GA. This is our forté & we restore front doors better than any other.
0 notes
Premier Warehouse Office Cleaning Services and Cost in Wichita KS Wichita Cleaning Company
More information is at: http://bestcleaningserviceswichita.com/warehouse-office-cleaning-services-near-me/
Need Warehouse Office Cleaning Services near Wichita KS: In warehousing environments, floor cleaning can be a particular problem. Dirt that has been trodden in or brought in on the wheels of vehicles, rubber from warehouse vehicle wheels, oils, and greases. Add into the mix a little water and accidents are almost inevitable. For thorough removal of the grime, call Wichita Cleaning Company warehouse office cleaning services team. Cost? Free estimates! Call today or schedule online Warehouse Office Cleaning Services quickly!
REQUEST FREE ESTIMATES
WAREHOUSE OFFICE CLEANING SERVICES
We have the technical know-how, over 25 years of experience chemical cleaning and the most sophisticated equipment for warehouse office cleaning services including all industrial nonslip flooring, sealed concrete, painted concrete, epoxy resin, polyurethane and mezzanine floors. Our expertise minimizes the cleaning time and maximizes the effectiveness of your warehouse cleaning programme.
You may be tempted to send out your own maintenance staff to do the job, however, hiring an industrial cleaning company is the choice of astute managers. We have a range of fast-curing floor repair products so we can repair your warehouse floor if required.
We have developed a wide range of superbly effective warehouse cleaning chemicals and techniques including:
• high-temperature low pressure superheated steam cleaning which fast drying to minimize disruption during cleaning.
• low-pressure water vortex cleaning
• floor scrubbing service
• soda blasting for perfect surface preparation prior to warehouse floor re-coating or to remove spilled paint, bitumen and other coatings
• deep cleaning and commercial cleaning of industrial flooring
• a range of degreasers and other cleaning detergents such as drain cleaning chemicals with a low environmental impact
Wichita Cleaning Company highly trained and experienced cleaning technicians use cutting-edge methods, equipment, and commercial chemicals to keep your warehouse clean, thus you benefit from improved safety and productivity. Wichita Cleaning Company is the Premier warehouse office cleaning services provider. And is the name you can trust with warehouse office cleaning services.
The page is all about
• Commercial warehouse cleaning services
Warehouse office cleaning services
Warehouse cleaning concerns are not just underfoot. Airborne dust and dirt accumulate up in the dead spaces of your warehouse. At Wichita Cleaning Company we have a variety of industrial hoists that enable safe high-level warehouse cleaning to be affected. We take care of the health and safety issues - one less thing for you to worry about.
Don’t worry about prices, contact Wichita Cleaning Company today for top-rated warehouse office cleaning services.
PREMIER WAREHOUSE OFFICE CLEANING COMPANY IN WICHITA
WICHITA CLEANING COMPANY
REQUEST MORE INFORMATION NOW.
CONTACT US:
Wichita Cleaning Company
Best commercial residential cleaning company in Wichita KS
(316) 500-7551 CLEANING
(316) 448-3974 HANDYMAN SERVICES OF WICHITA
(316) 448-5733 WICHITA HAULING JUNK & MOVING
Location: Wichita KS
Monday-Sunday 7 am- 11 pm
bestcleaningserviceswichita.com/
handymanserviceswichitakansas.com/
junkremovalhaulerwichita.org/
Service area;
55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS
ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven
#cleaning
#moving
#movers
#junkremoval
#handymanservice
#hauling
#Wichita
#kanas
0 notes
Responsible For A Decorative Concrete Floors Of Augusta Ga Budget? 12 Top Notch Ways To Spend Your Money
While this wasn't a large job (the foyer and reception region to get a new art gallery), the proprietor required an extremely dramatic and stunning floor. "Artwork over the floor," was the way in which DeCillis described it.
Decorative coatings and overlays supply good Added benefits but at a comfortable value. Naturally, specific components will impact whole costs but these will be less costly and monotonous than other conventional materials.
Skim Coat overlays are designed to resurface harmed exterior concrete. This creates a completely new canvas ideal for acid or h2o based concrete stains.
The entryway to a house is spiced up employing concrete stains, dyes, stencils and engraving. Get this look utilizing golden wheat chemical stain from Kemiko, and darkish walnut stain from Scofield.
Built of high strength polypropylene, the dim grey UNIPANEL forms The premise for the cable management floor. Even with its gentle weight (5 lbs.), the 40mm UNIPANEL includes a Design and style Load Rating of 1,three hundred lbs. Every single UNIPANEL has sixty four mini pedestals on the underside, which distributes the load with the floor earlier mentioned more evenly than if supported at just the 4 corners.
In depth floor mend can include as many as $2 for each square foot. As soon as repairs are completed, In the event the contractor deems it essential to resurface the concrete to deal with the mend perform, be expecting to pay for yet another $2 to $3 for each sq. foot for resurfacing.
The limit on enhancing basic concrete floors happen to be lifted. Residential and professional floor proprietors now Possess a good selection of colors and models to satisfy their wants and wants.
Understand that your floors are only as crucial to us as These are to you personally. We're going to make an effort & treatment that may be needed to you should definitely & your toes wander away happy.
Epoxy Flooring – It is a variety of coating that works effectively on garage and basement floors. Epoxy is mixed and afterwards utilized with a concrete floor, with the choice to make it far more decorative with a few paint chips.
The growing trend toward luxe concrete flooring gives lots of solutions in seamless, contemporary finishes. Find from a novel variety of decorative epoxy,
Simple to setup and inexpensive, concrete floors are a fantastic option for homeowners who want beautiful flooring that needs very little maintenance and lasts a life span. From the sleek and shiny surface of purely natural gray concrete to heat earth tones as well as the Daring hues of stains, polished concrete floors enhance a variety decors and architectural kinds. This cost information information the cost to polish concrete floors and what it takes to complete The work.
My knowledge with hard floors (we lived with numerous in France) is that they worked out rather well for the youngsters. They’re easy to take care of and you'll soften the area with region rugs. I really like the flexibleness of place rugs — they appeal to the designer in me who likes to switch items up and check out new layouts and color strategies inside of a space.
Concrete floor tiles insert the natural stone glance of concrete to any home Using the separation of sq. tiling. This is a terrific way to insert texture and designs on your flooring. With concrete flooring diy tiles you can preserve the color constant or use various colored stained floor tiles to make a checkerboard like sample.
With our Most important target decorative companies, the businesses you’ll discover right here can customize your concrete in many approaches.
0 notes
6 Life-Changing Products That’ll Modernize Your Garage
imaginima/iStock
The garage used to be the most neglected part of the home, typically serving as storage for vehicles, holiday decorations, and buyer’s remorse purchases. But more and more, people are recognizing that a well-appointed garage can help you stay organized and increase your property’s resale value.
So what does a fully equipped garage look like? It depends on what you keep in there; but for most people, that means smart storage solutions and ample space for your car. But you can go even further if you want to take the efficiency of your garage to the next level. That means bringing in additional gadgets and amenities that will help modernize your garage beyond recognition.
If you’re thinking about revamping your garage in the new year, here are the expert-approved items you should consider—and most are less than $120!
1. Guided laser parking system
Park your car in the right spot every time.
MAXSA
If you have a tight garage, it might be wise to rely on technology to help you park it right. A guided laser parking guide ($39.95, Maxsa Innovations) can prevent those scrapes, dents, and dings caused by misjudging how much space you have. And the best part is, you don’t even need wiring. You can use either double-sided tape or screws to mount the unit to your ceiling.
“They’re fairly easy to install and are typically battery-operated,” says Elizabeth Leanza, a real estate agent at Exit Realty King & Associates in Spring Hill, TN. “And in the year 2020, something like tennis balls hanging from ropes just doesn’t produce the same cool factor that these lasers do.”
2. New garage floor
A new garage floor doesn’t have to cost you an arm and a leg.
Rust-Oleum
You can breathe new life into your garage with a floor kit like the Rust-Oleum EpoxyShield ($117, Home Depot). It is easy to mix and apply (with foam rollers), adheres to concrete, and is waterproof. Plus, you can complete this DIY project in a weekend—you can walk on it in 10 hours, and drive your car on it in 24 hours.
Jonathan Faccone, founder of Halo Homebuyers in Bridgewater, NJ, buys and resells homes and says a garage floor revamp is a must in his house renovation projects.
“I typically paint all garages with a fresh coat of paint and then paint the concrete slab with epoxy coating,” he says, noting that he has also done this with his own garage. This is an easy way to tidy up and modernize your garage.
3. Metal pegboard
Pegboard organizer
Wall Control
“One of the coolest items any garage should have is a pegboard or slat board for your tools,” says Nathaniel Hovsepian at the Expert Home Buyers in North Augusta, SC. “These help save space and make finding your tools supereasy. They look really slick as well.”
But not all pegboards are built the same. Look for a metal pegboard like this one from Wall Control ($95, Amazon) to effectively hold all your tools. It can be mounted directly onto Sheetrock or studs and comes in a variety of colors, including black, blue, orange, green, yellow, white, and metallic. You can also choose different colors for the shelves and trays.
4. Steel workbench
Rolling cabinet workbench
Seville Classics
A rolling cabinet workbench ($899, Seville Classics) can upgrade your garage and safely store your items out of view.
“Having a place where you can easily fix, revamp, and ‘do it yourself’ will make home improvement projects easier and safer,” says Matt Williams, CEO of Pro.com, a general contracting company in Seattle. “This is where you can also store your safety gear like gloves and protective goggles for all tasks.”
5. Retractable electrical cord reel
Say goodbye to knots in your extension cord.
The Home Depot
If your extension cords are a hot mess, a retractable cord system ($69, The Home Depot) can help you get them sorted. This cord system has three outlets and a built-in, resettable 13-amp circuit breaker. The no-tangle mechanism allows you to pull the cord from any direction.
“I have had more tools in the garage that any homeowner should be allowed to have, but the best and most helpful item has been the retractable electrical cord reel,” says Eric Jeanette, owner of Dream Home Financing. “No more having to pull extension cords all over the garage. It’s installed on the ceiling, and after you’re done using your cord, with just a slight tug, it rolls the cord back up.”
6. Hydraulic lifts
Got space? Give your cars a lift.
Amazon
Are you short on horizontal space in your garage? Sure you can park vehicles in the driveway or on the street, but that offers no protection from the elements.
“The trend I’m seeing right now among a lot of my clients is that they need more parking space,” says Yawar Charlie, a director of the estates division at Aaron Kirman Group, Compass in Los Angeles. “They’re getting creative by installing hydraulic lifts, so a two-car garage becomes a four-car garage.”
Deborah Bacarella, a real estate agent at Re/Max Advantage Plus in Boca Raton, FL, says hydraulic lifts are really popular among her luxury buyers who want extra space for their car collections. The APlusLift ($2,235 Amazon) is a heavy-duty storage car lift with an 8,000-pound capacity, and it lifts vehicles in only 40 seconds.
The post 6 Life-Changing Products That’ll Modernize Your Garage appeared first on Real Estate News & Insights | realtor.com®.
0 notes
Concrete Driveway Asheville
Contents
Concrete dome building kits
Services offered. asphalt
Refinishing. concrete refinishing
Driveway crack filler
Asheville. granite counter tops
EnnisArt installs designer colors and protective treatments for concrete floors, finished basements, radiant heated slabs, garages, patios, and … The original concrete floor in the basement of a new home in West Asheville built by … Driveways
Jan 24, 2019 … Asheville asphalt driveways are incredibly durable and won’t … labor costs to install asphaltic concrete driveways in Asheville, North Carolina.
Block Paving Block Paving. Block paving is a common site throughout the UK, from the footpaths on the High Street to many domestic driveways. block pavers provide
We specialize in coating, staining of concrete driveways, all types of flooring and garages home and businesses .
About once a month, a speeding or distracted driver leaves a present in West Asheville resident Elaine Poovey’s front … Some people complained that the concrete structures were unsightly. But …
Concrete Contractors in Candler, NC. See BBB … Contractors. Quality Concrete Contractors logo … http://www.asheville-concrete-driveway.com/ · (828) 620- …
34′ dome home 1,075 sq.ft. two bedroom/two bath utilizing 34 Sigma 11 with 22 Gamma 1 Garage floor plan. Domes built from American Ingenuity (Ai) concrete dome building kits.
Driveway Sealing Harrisburg Pa The men offered to coat the driveway and when the work was completed, the resident was handed a bill for $2,350, police said. The home
APAC-Asheville in … to pave a homeowner’s driveway, according to Operations Manager Brad Caldwell. Based in Atlanta, Ga., Oldcastle Materials is the leading vertically integrated supplier of …
Even now, these narrow, curvy and decomposing roads require extreme caution to avoid pedestrians, animals and blind driveways … May, Asheville To the citizens of Woodfin who shake your heads in …
search titles only has image posted today bundle duplicates include nearby areas asheville, NC (ash); augusta, GA (aug); boone, NC (bnc); brunswick, GA (bwk …
services offered. asphalt Sealing. Basement Waterproofing. Bathroom Remodeling – Full. Concrete Flooring refinishing. concrete refinishing. Show more …
Residential Paving Companies … provides asphalt paving and consulting services in the United States. It offers asphalt, warm-mix asphalt, thin asphalt overlay, roller pave roller-compacted concrete, concrete, roads/highways,
Dumpster Rentals. Big Red Box provides a hassle-free process to rent roll-off dumpsters (or roll-off containers) at the most affordable rates. We make sure not …
Driveway Pavement Repair Learn how to repair Asphalt driveways or blacktop driveway repair with Sakrete. We offer various products for best driveway crack filler, and blacktop repair. EZ
search titles only has image posted today bundle duplicates include nearby areas akron / canton (cak); ann arbor, MI (aaa); asheville, NC (ash); athens, GA (ahn …
To downtown asheville. granite counter tops in kitchen, upgraded light fixtures, oak hardwood floors in kitchen,hallway,dining room. 27 x24 double car garage in basement/concrete driveway. City …
R & L Paving provides residential & commercial paving grading snow removal asphalt sealant gravel striping patching to driveways & parking lots. Asheville …
One commission member insisted that the 32-foot-wide access driveway be reduced … erect it somewhere outside of Asheville. Apparently that angered the city: They sent me a demolition permit but …
I can remember the first time my father taught me to shoot a rifle, how he had me sit on the concrete driveway and use my knee for a rest … an hour east to Asheville. It was the first week of March, …
Blacktop Driveway Company Paving Tiles The paver, paver everywhere policy of the UT Administration has come under judicial scanner, with the Punjab and haryana high court taking cognizance
via Check This Out
More Resources
0 notes
We’re in the process of knocking out another Popeyes for Westwood Contractors, Inc.. This one is at the Cumberland Mall. We have another one at Lenox Square to paint next weekend. We’re using Coronado paints from Marketplace Paints. There’s not a lot to paint in one of these but it’s an honest days work.
2 notes
·
View notes