Tumgik
#water filtration systems Rock Hill
lasenbyphoenix · 6 months
Text
Tumblr media
Unshakable Faith (2023)
Episode 34 Breakdown
Ji Danyang gets his team to check their equipment but the vibrations havent caused any errors, and Officer Tongbin goes to check on the cooper mine.
Inside the sealed cabin Nurse Bai opens a secret compartment left by Assistant Welder Rui and pull out a tool and a small bottle of phosphorus powder and uses it to start a fire in a side chamber. The cabin team have to use water to douse it but the air quality is compromised. He Xiwan convinces Ji Danyang to not abort the experiment and they increase the air filtration and wait. 
Tumblr media
Fake Li Qiuchen spies on Expert Chief Chu's hospital room but it's guarded and the windows are covered. Expert Chief Chu is recuperating elsewhere and Factory Chief Han visits to advise him of the cabin fire.
Officer Hongmei and Police Captain Chen look into possible causes for the fire and Ji Danyang gives the cabin team the good news that the air filtration system has worked and the air levels are back to normal.
Fake Li Qiuchen spies on Expert Cheif Chu's room again and notices the IV bottles the nurse is carrying hasn't changed. He figures he's been moved and discharges himself from the hospital.
Tumblr media
The testing of Expert Chief Chu's medicine reveals a rare virus mixed in, and when asked Nurse Leader Ge advises the police that Nurse Shanshan was in charge of his medicine.
Another vibration rocks the cave, and Ji Danyang and Officer Hongmei check the cavern behind the sealed cabin, finding a miasma of dust that's coming through the cave walls. The digger team has reached the concrete wall of the air raid shelter and set up their next explosives. The police team does a fully manned search of the back hill and Liu Simao watches as they find a trail in the grass leading to the cave. The police enter and arrest the digging team, extinguishing the lit fuse just in time to stop the next explosion.
Tumblr media
The digging team confess to being recruited by Electrician Liu Simao and they search his house and find evidence that links him to Lai Guangrun and the molotov cocktail attempt on Officer Hongmei.
With 4 days left in the experiment, Nurse Bai loosens the bolts around a mercury pipe and then hides the tool in Nurse Shanshan's pocket. The mercury leak is detected in the cabin and the team is evacuated into the transition chamber, but He Xiwan stays behind to try and clean up the spill, refusing to withdraw even when Ji Danyang orders her to. Officer Hongmei enters the cabin to drag her out and replaces her while the emergency clean up crew is preparing. Once the clean up crew gives the all clear, Officer Hongmei is send to the hospital and He Xiwan insists on finishing the experiment. An investigation finds the loosened bolts and the police call for Nurse Shanshan to exit the chamber for questioning and they find the tool in her pocket but she protests that she doesn't know where it came from.
Tumblr media
Dr Bai attends to Officer Hongmei in the hospital, and Police Captain Chen deliberately lets it slip that it was sabotage. As he leaves, Dr Bai runs into Nurse Leader Ge and learns that Nurse Bai is now in the sealed cabin.
With only a few days left and everyone exhausted, Ji Danyang gives a speech of encouragement to the cabin and laboratory teams.
Officer Ding searches for the tailor shop that Liu Simao used and sees Dr Bai enter Seamstress Miao's shop. Dr Bai closes the doors and confronts the seamstress about their sabotage endangering Nurse Bai.
Tumblr media
.....................................................
Good for the hospital and nurses to keep up with the guise of Cheif Chu still being onsite, but why was no one noticing that fake Li was skuking around the same corrider all the time?? Surely they could have had a covert guard on him while he was there.
They've identified Electrician Liu Simao as a spy, now they've just got to find him.
Tumblr media
Blaming Shanshan for Chief Chu's medicine! And hiding the tool in her pocket!?!? The only reason Shanshan is in the cabin is to be a scapegoat?? You bitch! Shanshan is in tears and Tongbin isn't looking much better.
Thats it. I'm not giving Nurse Bai any more grace, she's irredeemable now. Enjoy prison.
Tumblr media
I find it curious that when the police team has to interrogate a friend, the officer closest to them is involved in the investigation. When they questioned Nurse Bai at various times Officer Hongmei was always present, same for when they questioned Dr Bai. When Ji Danyang was facing the fallout of the miscalculation he was questioned by both Hongmei and Captain Chen. And when Shanshan is questioned here, Tongbin is one of her interrogators. It would seem rational to have them interrogated by someone else as to not have a conflict of interest (like Hongmei was accused of when she led the tampered medicine investigation), but at the same time the officer who knows them the best would be able to see more flaws in their story? Would a suspect be more truthful in front of a friend, or more likely to hide their shame in front of a friend? I'd love to know the in-universe reason. Maybe it also demands the police team to be transparent with their own feelings and biases.
Tumblr media
Dr Bai looks to be out for blood, but with Officer Ding right on his heels I can't imagine he'll walk off without being questioned. And how's he going to feel when he learns that Nurse Bai is a willing participant in the sabotage and not being coerced like the seamstress told him? That's going to break his heart especially if he learns about the Nanshen Training class.
4 eps to go!
3 notes · View notes
Text
C & C Plumbing: Accommodating Your Plumbing Needs To Perfection
C & C Plumbing: Accommodating Your Plumbing Needs To Perfection
Plumbing is one of the most essential needs of any household. It is such an issue that is going to resurface from time to time. Moreover, handing over the plumbing requirements of your home to just about anybody can prove to insanely unprofitable. You might not receive quality products or get ripped-off for the services you receive. However, if you happen to stay in San Juan Capistrano, Aliso Viejo, Dana Point, Lake Forest, Laguna Niguel, Laguna Hills, Laguna Beach, Laguna Woods, Mission Viejo, Coto De Caza, Rancho Santa Margarita, Ladera Ranch, Trabuco Canyon, Newport Beach, Monarch Beach, Capistrano Beach, Coto De Caza, Corona Del Mar, Rancho Mission Viejo, San Clemente, Trabuco Highlands, Las Flores, Newport Coast, Irvine, Irvine Spectrum Center, Crystal Cove, Turtle Rock, Turtle Ridge, San Juan Capistrano, Foothill Ranch, Quail Hill or Pelican Hill, CA, and are suffering from the dilemmas of which plumbing company to hire; look no further than C & C Plumbing.
Extraordinary Services and Reputation
Various plumbing and repair needs might arise in your household. These may include gas-line repair, re-piping, leak detection and solution coverage, water filtration, repair of burst pipes, fixture services, sewer camera inspection, water heaters, tankless water heaters, renovation of kitchens or bathrooms or drain clogs. C & C Plumbing provides comprehensive solutions and services for such needs with the help of expert technicians and certified plumbers. Very motivated about their client satisfaction. C & C Plumbing has over 500 5-star reviews on Yelp. Number 1 in the nation for plumbing companies; a feat quite elusive for their immediate competitors.
Contact now
Servicing, San Juan Capistrano, Aliso Viejo,  Dana Point, Lake Forest, Laguna Niguel, Laguna Hills, Laguna Beach, Laguna Woods, Mission Viejo, Coto De Caza, Rancho Santa Margarita, Ladera Ranch, Trabuco Canyon, Newport Beach, Monarch Beach, Capistrano Beach, Coto De Caza, Corona Del Mar, Rancho Mission Viejo, San Clemente, Trabuco Highlands, Las Flores, Newport Coast, Irvine, Irvine Spectrum Center, Crystal Cove, Turtle Rock, Turtle Ridge, San Juan Capistrano, Foothill Ranch, Quail Hill or Pelican Hill, CA you can contact C & C Plumbing through their website https://www.candcplumbingoc.com/ email them at [email protected]  or call at (949) 395-5551. Open Monday - Saturday 7am to 7pm, and from 7am-4pm on Sundays. They are sure to provide you with extraordinary plumbing services and will fulfill your needs of having a proper working plumbing system in your home.
CC plumbing provides high quality plumbing services in various prime locations of San Juan Capistrano, Aliso Viejo, Dana Point, Lake Forest, Laguna Niguel, Laguna Hills, Laguna Beach. The company excels in sewer inspection, water heaters installations and various bathroom and kitchen repair and renovation services. For more information visit: candcplumbingoc.com
1 note · View note
Link
Affordable Refrigerator Removal Service and Price in Wichita KS | Wichita Household Services more information is at :https://wichitahouseholdservices.com/refrigerator-removal-service-near-me/
Are you searching for refrigerator removal service in Wichita?  When you upgraded your refrigerator with the latest model, then it arises the need of removing the older one so that space can be made for the new one. Wichita Household Services is an efficient company that provides the Cheap services for removing refrigerator from your place. Cheap refrigerator removal service of Wichita! Cost? Free estimates. Call us now or book online quickly!
REQUEST FREE ESTIMATES!
REFRIGERATOR REMOVAL SERVICE
Have you recently upgraded to a new high-tech refrigerator, complete with temperature sensors, a water filtration system, and energy saver technology? That’s fantastic, but what did you do with the old fridge? If it’s not still sitting in your basement, you’ll know that refrigerator disposal is a hefty task for anyone. Not only are refrigerators one of the heaviest types of appliances, they also need to be disposed of in the proper manner or they can release chemicals that are harmful to the environment.
They’re incredibly heavy, awkward to maneuver, and take a small team of people to move. Not to mention the fact that they can’t just simply be thrown out. Even if you manage to get it to the curb, many areas don’t offer refrigerator pick up as part of their garbage disposal services.In fact, if you decide to do the task all by yourself, then it will take you the whole day to complete it. It will also consume your precious time and energy besides putting you at risk of succumbing to injuries.
JUNK REMOVAL SERVICES WICHITA
Appliance Removal Service near me Wichita Box Spring Removal Service near me Wichita Construction Waste Removal near me Wichita Couch Removal Service near me Wichita Deck Removal Service near me Wichita Foreclosure Cleanouts near me Wichita Freezer Removal Service near me Wichita Furniture Removal Service near me Wichita Garage Cleanout Service Cost Wichita Garbage Removal Wichita Hauling Service Cost Wichita Hot Tub Removal Cost Wichita House Cleanout Service Cost Wichita Junk Removal Service Cost Wichita Mattress Removal Service Cost Wichita Refrigerator Removal Service Cost Wichita Sofa Removal Service Cost Wichita Television Disposal near me Trash Removal Service near me Tv Removal Service near me Washer Dryer Removal Service Cost Wichita Yard Waste Removal Service Cost Wichita
The good news is that you don’t have to put yourself through all this hustle! Wichita Household Services is an efficient, safe and eco-friendly refrigerator removal service to make the whole process easy for you. We offer refrigerator removal service to all our customers in Wichita, Wichita. All that you need to do is give us call and we will get to you within the shortest time possible!Our experienced refrigerator removal team will have the manpower to haul off that old fridge without damaging any of your home on the way out. We’ll do all the heavy lifting - no need to carry items out to the curb. We clearly understand the needs of our customers. When you hire us, we promise that we won’t let you down. We will give you quality service that you are looking for and within a short period of time.
Finally, we’ll make sure that the refrigerator is disposed of at a proper recycling facility so that it doesn’t do any harm to our ecosystem. Our staff are well trained and they know how to safely handle and dispose refrigerator wastes. Regardless of how challenging the task is, our able staff will find a solution to the problem. We have managed to offer our services in this competitive industry for this long period of time because to us, there is no task that is too big.
WICHITA HOUSEHOLD SERVICES OFFERS THE FOLLOWING REFRIGERATOR REMOVAL SERVICE FOR OUR VALUED CUSTOMERS
● Our professional and insured refrigerator disposal team will show up at your home or office; we call 15 minutes before we arrive on site and we’ll give you a free estimate based on how much room your items take up in our truck. You point and we haul your old fridge into our junk removal trucks, with no hidden fees.
SOME OF THE COMMERCIAL ENVIRONMENTS WE SERVE ● Home and Residential ● Business and Office ● Property Clean outs ● Commercial and other
PAGE IS ABOUT ● Refrigerator removal near me ● Refrigerator removal cost ● refrigertor removal services companies
CHEAP REFRIGERATOR REMOVAL SERVICECOMPANY OF WICHITA
WICHITA HOUSEHOLD SERVICES
REQUEST FREE INFORMATION NOW. CLICK HERE! CONTACT US: Wichita Household Services We Offer Cleaning Junk Removal Movers Handyman Services Call: (316) 448-3558 SERVICE AREA: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – BelAire or Wichita | 67221 – McConnell AFB | 67226 – BelAire or Wichita | 67543 – Haven #Wichita #junkremoval #handyman #householdservice #movers #cleaning
0 notes
comfortsystems12 · 3 years
Text
Comfort Systems Heating And Cooling Services
At Comfort Systems of York County, LLC, our objective is basic: we need you to work and live in the best solace and accommodation conceivable. That is the reason we offer thorough comprehensive air conditioning, heating, indoor air quality, water treatment system, and commercial HVAC services all through the York County, SC region. Regardless of what it is that you need to make your home or business property more agreeable and helpful, you can depend on our experts to take care of business right. From indoor air quality system installations to heating repairs and air conditioning replacements, we genuinely do everything. In the event that you have any inquiries concerning the administrations that we have to bring to the table, or regarding why you should plan administration with a colleague starts with, call us today. We are glad to address any inquiries you may have.
Tumblr media
Our list of HVAC services include:
1. Air Conditioning Installation, Repair & Replacement
Don’t bother investing in a great air conditioner if you are not planning on scheduling a professional air conditioning installation. You can guarantee that this is the case quite simply. Just pick up your phone and schedule your air conditioning installation, replacement, repair, and maintenance services with a member of our team. No matter how you may choose to cool your home, we’ll ensure that you are able to do so in an effective and efficient manner.
2. Heating Systems | Heating Installation | Heating Contractors
No matter what type of heating system you may decide to use in your home, one fact remains constant: you need a professional heating installation. For quality heating systems and heating installation in York County, we are the best company to call. Our heating contractors Rock Hill, SC have decades of experience.
3. Indoor Air Quality
Are you looking to improve the quality of the air that you breathe inside your home? Our indoor air quality services are comprehensive. We use high-quality humidifiers, dehumidifiers, air purifiers, UV air purifiers, and air filtration systems,  among others. Don’t hesitate to get in touch with our team today.
4. Water Treatment Systems
Every homeowner should make water quality a priority. It is vital that the water you use to bathe, cook, and drink is safe. With one of our water treatment systems, we can ensure that you have reliable clean water. Our expertise is in water treatment system design.
Benefits Of Our Proper Heating And Cooling System
Many people use cooling and heating systems to keep their homes comfortable in all kinds of weather. It costs 43% on average to heat or cools your home. Good heating and cooling systems are beneficial as they help you cope with the weather and provide a comfortable environment. But there are many benefits that most people don't know about. These are the benefits of cooling and heating systems:
1. Energy Efficient
It is undisputed that energy costs are one of the largest expenses in a home. If they are not managed properly, they can make your life more difficult or easier. If they aren't right for your home, heating and cooling systems can cause energy bills to rise. You should replace an old heating and cooling system with one that is more modern.
2. Air Leaks
Leakages are a major problem in any cooling or heating system. New cooling and heating systems are more efficient and prevent unhealthy air from entering your home. They also ensure that your home maintains the desired temperature. Advanced filters make it possible to improve the air quality in your home by installing newer cooling and heating systems.
3. Efficiently Maintains The Temperature
Older cooling and heating systems took a long time to cool or warm the environment due to the use of old ducts. Proper heating and cooling systems will keep the temperature at the desired levels in no time.
4. Less Maintenance Required
Modern cooling and heating systems are more efficient and require less maintenance. Filters and ducts are made in such a way that they last longer.
These are just a few of the many benefits of high-quality cooling and heating systems. These systems will make your life much easier and will reduce your energy bills. Comfort Systems LLC is the right place to go if you're looking for cooling and heating systems. To get a quote, you can also visit Comfort Systems LLC's website. You can also reach us to get a free quote if you're not sure how big your heating and cooling system should be. A new, properly installed heating and cooling system will benefit your home in the long term and save you money in the short term.
0 notes
wichitahandyman · 4 years
Link
Outstanding Tankless Water Heater Installation Service and Cost in Wichita KS | Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/tankless-water-heater-installation-service-near-me/
Tankless Water Heater Installation Service Wichita: Are you searching for tankless water heater installation service in Wichita KS? Handyman Services Of Wichita offers the customized same day facility for tankless water heater installation at the best price throughout the regions of Wichita, KS .Best tankless water heater installation service  of Wichita! Free estimates. Feel Free to Call us now or book online quickly!
REQUEST FREE ESTIMATES!
TANKLESS WATER HEATER INSTALLATION SERVICE WICHITA
Tankless Water Heater Installation Service Wichita: Our tankless water heater installers are handpicked, licensed and insured, and have been background checked before conducting a free consultation.
If you are constantly running out of hot water, the underlying problem is most likely a poor plumbing system, bad weather or old technology. Conventional water heaters typically rely on tanks of pre-warmed water that are quickly emptied when used too often. One of the benefits of using a tankless water heater is that the water is heated instantly once it passes through its specific heating mechanism, warming only the water that is actually being used. There are many benefits when switching to a tankless water heater system, including: unlimited hot water (it won’t run out after too much use), taking up less space than a conventional tank, energy efficient, long-lasting, eliminated risk of water damage via a rupture or tank failure, less risky than traditional water heaters with precision temperature control, cleaner and safer water for consumption and lower electric bills.
Why choose Tankless Water Heater Installation? Tankless water heaters have lower operating costs, use less space, and can reduce energy consumption by as much as 30 to 40 percent. It can also provide hot water on demand at a precise temperature.
Reduce your gas bill in Wichita area by installing a tankless water heater! The highly trained technicians of Handyman Services Of Wichita are specialized in commercial and residential tankless water heaters, water heater parts, filtration systems, and plumbing services. We are licensed, bonded, insured, and are always available to answer your questions, offer a free estimate, or dispatch our technicians for easy and affordable emergency service: Tankless Water Heater Installation Service Wichita
HANDYMAN SERVICES OF WICHITA OFFERS THE FOLLOWING TANKLESS WATER HEATER INSTALLATION  SERVICE FOR OUR VALUED CUSTOMERS ● We offer same-day tankless water heater installation if you call us before noon and with same-day delivery.
SOME OF THE ENVIRONMENTS WE SERVE ● Home and Residential ● Business and Office ● Commercial and other
PAGE IS ABOUT ● Tankless water heater installation service checklist ● Tankless water heater installation services ● Tankless water heater installation service tips ● Tankless water heater installation companies near me ● Tankless water heater installation service cost ● Tankless Water Heater Installation Service Wichita
BEST TANKLESS WATER HEATER INSTALLATION SERVICE COMPANY OF WICHITA
HANDYMAN SERVICES OF WICHITA
REQUEST FREE INFORMATION NOW. CLICK HERE!
CONTACT US: Handyman Services Of Wichita Best commercial residential handyman maintenance professionals in Wichita KS (316) 448-3974 HANDYMAN (316) 500-7551 CLEANING (316) 448-5733 JUNK REMOVAL Location: Wichita KS Timing: 7 AM – 11 PM Websites: handymanserviceswichitakansas.com bestcleaningserviceswichita.com/ junkremovalhaulerwichita.org/ Service area: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven
0 notes
Link
Affordable Refrigerator Removal Service and Price in Wichita KS | Wichita Hauling Junk & Moving
More information is at: https://junkremovalhaulerwichita.org/refrigerator-removal-service-near-me/
Are you searching for refrigerator removal service in Wichita KS?  When you upgraded your refrigerator with the latest model, then it arises the need of removing the older one so that space can be made for the new one. Wichita Hauling Junk & Moving is an efficient company that provides the Cheap services for removing refrigerator from your place. Cheap refrigerator removal service of Wichita KS! Cost? Free estimates. Call us now or book online quickly!
REQUEST FREE ESTIMATES!
REFRIGERATOR REMOVAL SERVICE
Have you recently upgraded to a new high-tech refrigerator, complete with temperature sensors, a water filtration system, and energy saver technology? That’s fantastic, but what did you do with the old fridge? If it’s not still sitting in your basement, you’ll know that refrigerator disposal is a hefty task for anyone. Not only are refrigerators one of the heaviest types of appliances, they also need to be disposed of in the proper manner or they can release chemicals that are harmful to the environment.
They’re incredibly heavy, awkward to maneuver, and take a small team of people to move. Not to mention the fact that they can’t just simply be thrown out. Even if you manage to get it to the curb, many areas don’t offer refrigerator pick up as part of their garbage disposal services.In fact, if you decide to do the task all by yourself, then it will take you the whole day to complete it. It will also consume your precious time and energy besides putting you at risk of succumbing to injuries.
JUNK REMOVAL SERVICES WICHITA KS
Appliance Removal Service near me Wichita KS Box Spring Removal Service near me Wichita KS Construction Waste Removal near me Wichita KS Couch Removal Service near me Wichita KS Deck Removal Service near me Wichita KS Foreclosure Cleanouts near me Wichita KS Freezer Removal Service near me Wichita KS Furniture Removal Service near me Wichita KS Garage Cleanout Service Cost Wichita KS Garbage Removal Wichita KS Hauling Service Cost Wichita KS Hot Tub Removal Cost Wichita KS House Cleanout Service Cost Wichita KS Junk Removal Service Cost Wichita KS Mattress Removal Service Cost Wichita KS Refrigerator Removal Service Cost Wichita KS Sofa Removal Service Cost Wichita KS Television Disposal near me Trash Removal Service near me Tv Removal Service near me Washer Dryer Removal Service Cost Wichita KS Yard Waste Removal Service Cost Wichita KS
The good news is that you don’t have to put yourself through all this hustle! Wichita Hauling Junk & Moving is an efficient, safe and eco-friendly refrigerator removal service to make the whole process easy for you. We offer refrigerator removal service to all our customers in Wichita KS. All that you need to do is give us call and we will get to you within the shortest time possible! Our experienced refrigerator removal team will have the manpower to haul off that old fridge without damaging any of your home on the way out. We’ll do all the heavy lifting - no need to carry items out to the curb. We clearly understand the needs of our customers. When you hire us, we promise that we won’t let you down. We will give you quality service that you are looking for and within a short period of time.
Finally, we’ll make sure that the refrigerator is disposed of at a proper recycling facility so that it doesn’t do any harm to our ecosystem. Our staff are well trained and they know how to safely handle and dispose refrigerator wastes. Regardless of how challenging the task is, our able staff will find a solution to the problem. We have managed to offer our services in this competitive industry for this long period of time because to us, there is no task that is too big.
WICHITA HAULING JUNK & MOVING OFFERS THE FOLLOWING REFRIGERATOR REMOVAL SERVICE FOR OUR VALUED CUSTOMERS
● Our professional and insured refrigerator disposal team will show up at your home or office; we call 15 minutes before we arrive on site and we’ll give you a free estimate based on how much room your items take up in our truck. You point and we haul your old fridge into our junk removal trucks, with no hidden fees.
SOME OF THE COMMERCIAL ENVIRONMENTS WE SERVE ● Home and Residential ● Business and Office ● Property Clean outs ● Commercial and other
PAGE IS ABOUT ● Refrigerator removal near me ● Refrigerator removal cost ● refrigertor removal services companies
CHEAP REFRIGERATOR REMOVAL SERVICECOMPANY OF WICHITA KS
WICHITA HAULING JUNK & MOVING
REQUEST FREE INFORMATION NOW.
CONTACT: Wichita Hauling Junk & Moving CALL (316) 448-3558 CLEANING CALL (316) 448-5733 JUNK REMOVAL & MOVING CALL (316) 448-3974 HANDYMAN Best Junk Removal Hauling Company in Wichita, KS Open Monday to Sunday 7:00 am – 11:00 pm Located in Wichita, KS 67211 WEB: www.junkremovalhaulerwichita.org
SERVICE AREA:
55 Cities within 30 miles of Wichita, KS:  Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS
ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 - Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 - Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 - Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 - Rose Hill | 67135 – Sedgwick | 67147 - Valley Center | 67149 – Viola | 672xx – Wichita | 67204 - Park City or Wichita | 67219 - Park City or Wichita | 67220 - Bel Aire or Wichita | 67221 - McConnell AFB | 67226 - Bel Aire or Wichita | 67543 - Haven
0 notes
thecoroutfitters · 7 years
Link
Written by Guest Contributor on The Prepper Journal.
Editors Note: A guest post from VGH to The Prepper Journal. As always, if you have information for Preppers that you would like to share and possibly receive a $25 cash award as well as be entered into the Prepper Writing Contest with a chance to win one of three Amazon Gift Cards  with the top prize being a $300 card to purchase your own prepping supplies, enter today!
When the Holidays are looming, this item is searched for with a great deal of anxiety. Not thought about the whole year long, suddenly it becomes seriously important. What is it? Cheesecloth. Poor cheesecloth, used for holiday soups as a holder of herbs. Then either thrown away or lost in that draw you never look in, until next year. (Guilty as charged). Why? It’s so much more than that. Besides being about the weight of two feathers (Real feathers, not those ones you get at the sports store. That’s just wrong). Fold it up into almost nothing. It’s reusable, and very handy to have if your fishing, hunting, camping, or running for the hills. The versatility simply never ends.
Cheese Making: Some animals produce milk that is not flavorful. In a lot of cases you can use herbs to produce a tasty cheese, for yourself or for barter. It’s easy to make small quantities at a time. All you need is: About a gallon of milk 2 or 3 lemons, juiced Herbs and a little Salt Bring milk to a boil and add lemon juice, while stirring. The milk should form curds immediately. Have ready a piece of cheesecloth folded three times in a bowl, if you have one. Pour the curds over the cheesecloth to strain them. Sprinkle with you herbs and a small amount of salt if you like. Twist the cheesecloth into a tight ball, to get rid of all the liquid (Whey – it’s a yellow-greenish color). Tie off and let dry. You can crumble or slice over your preferred system of delivery. (When at home, I save the Whey to use as a substitute for water in baking, works well in bread). Yes, you can make bread in cans next to your fire. Nice.
Head and Face Covering: Yes, when folded in half, cheesecloth can and will keep bugs off your face and out of your ears. (If the bugs are big enough you have bait for fishing. It’s hilarious watching your partner trying to pull them out of the cheesecloth. I suggest you do it as you’re running away).
Jerky Covering: When you must make jerky on the fly, or just because it doesn’t weigh as much dried. (I explained that to my partner, over and over. Finally, just did it myself to prove the point. No Brownie points given) Set it out in the sun on woven sticks and put the cheesecloth over the top of it. Keeps out all those pesky flies.
Gauze: Makes a nice airy bandage that flexes with movement. Keeps out all those pesky flies and dirt (unless you fall down a lot).
Window Screens: Pretty much is self-explaining. But, if you cut strips of plastic and weave them into the cheesecloth, makes a good curtain.
Book Bindings: (It’s called Scrim, you those of you that like official stuff, like my partner, bless his soul). If you mix flour and water to a paste, you can dip your cheesecloth into it to cover. Let dry, it will reinforce most papers or broken books. (You know the one you threw across the campsite because the main character ticked you off?)
Flags: For those times when you want to get your partners attention without speaking. Like after a disagreement or just because. (My favorite).
Bathing Suit: Ok, I made this one up. It worked well when I went swimming. My partner suddenly forgave me for talking while fishing. (It was a stream, for crying out loud, it was already noisy).
Fishing Net: To catch fish swimming in a corner resting stop. (I didn’t make that one up, my partner did) Or, as a bag to carry the fish to the campfire or the bear, whichever comes first. (Yes, that did happen. I have never climbed anything so fast in my life, my partner didn’t appreciate, though. Said I was supposed to climb the tree. I figured if I climb him first, I’d have a few extra minutes).
Ornaments: If for some stupid reason you are in the woods, and it’s Halloween. (Unless of course, you have to be there because some idiot pushed the button). It makes good spider webs for that Halloween feeling. Make sure you leave it there. It’s probably already infested with spiders (they like a day off, too). Or to just freak the person out that’s been following you for three days. (They didn’t know where they were, forgot to bring a deck of cards with them. Believed that if they played solitaire, someone would come by to help move the cards around. Idiot.)
Water Filtration: Get the finest weave you can, and fold it a bunch of times anyway. (Someone at our campsite tried to use it without folding. Couldn’t figure out where all the little tiny rocks came from). Remember, to leave the campsite before laughing.
Dust/Contamination Mask: Fold it just enough to keep the dust out or you may find it hard to breath. (I asked my partner why he was breathing so hard. I thought he was dreaming again, he said no, but his face was red).
Camo-Netting: Because, you know the planes fly lower so they can see you. Please remember to dye it by rolling it in the mud. For some reason, white doesn’t work. (Also, you need large quantities for coverage, just run down to the corner store. That’ll work).
Abrasive Material: Make a bag, and stuff it with sand and sharp rocks. Works well at cleaning pans, knives, shaping arrows (If you have a bow. I think that’s a requirement), polishing the bottom of a can to make a mirror, and finally for throwing at your partner. (It works, for any reason you want, it works).
So, to wrap it up. Thank you for reading my ranting, reminder of cheesecloth. Oh, and my partner wants to put his twenty-five cents worth (It’s all I let him carry, he has holes in his pockets, we walk into a sports store and suddenly it’s all gone), in. He has asked me to tell you that it works for making tofu. I sometimes question his sanity. Well more than sometimes.
Follow The Prepper Journal on Facebook!
The post The Forgotten Cheesecloth appeared first on The Prepper Journal.
from The Prepper Journal Don't forget to visit the store and pick up some gear at The COR Outfitters. How prepared are you for emergencies? #SurvivalFirestarter #SurvivalBugOutBackpack #PrepperSurvivalPack #SHTFGear #SHTFBag
1 note · View note
ruffsficstuffplace · 7 years
Text
And The AWRD Goes To... (Part 7)
Water dripping from above, echoing as it splattered on hard rock, a pool of water somewhere. A chill in the air, warded off by something warm and soft wrapped around Weiss—it smelt of bullet propellant dust, burnt smells, machine oil, and… baked goods? The faint, rhythmic sounds of something scratching—no, scrubbing metal.
“Oh, thank goodness, you’re awake!” Diana said. “Here, drink this.”
“Mnn…” Weiss groaned as she felt something metallic pressed to her lips, cool water pouring into her mouth, a taste on her tongues like dried herbs and roots, ones she could only describe as “bitter as hell.” She coughed it back up, spluttering and spitting.
“Come on, drink up, it’ll be good for you, I promise.”
“Maybe you should try some pickled plums instead!” Akko said.
“Your faith in it is not unfounded, Akko, but trust me: Weiss could would do better with some fluids first. Would you like to try just water?”
“Nnggh…” Weiss said as she opened her eyes, found herself staring up at a damp cavern lit up by a warm orange glow from a lamp. “Just… let me sit up and…” she tried to move her arms, found herself unable to move them.
“Sorry—did I wrap you in my cloak too tight?” Ruby asked.
Weiss felt her cheeks begin to heat up. “Yes. A little help, please?”
Diana freed her from Ruby’s cloak, helped her sit up. “Where are we…?” Weiss asked as she took the canister of water and herbs from Diana, took a sip of it. She gagged and spluttered again, but forced herself to swallow it anyway.
“No idea!” Akko said as she sat in the corner, cleaning out Shooting Star while Ruby worked on Myrtenaster. “We lost connection with the CCT a while ago, and this tunnel has just been going on, and on, and on…! Soon as we found this spring, we just had to stop.”
“How long was I out?!” Weiss asked, eyes widening.
“No more than an hour, thankfully,” Diana replied. “We were quite concerned when you passed out earlier, but thankfully, your breathing never stopped, and your heart-rate normalized soon enough. I was ah, kind of concerned you’d become feverish or delirious when you started muttering in your sleep, though…”
Weiss’ face slowly fell in horror.
“Don’t worry!” Ruby said. “What happens in this cave will stay in this cave!”
Weiss sighed, closed her eyes as she brought the canister to her lips again. “I am so sorry for anything I might have said…” she muttered as she forced herself to drink again.
There was a bit of awkward silence, before Diana said, “Moving on to more important matters… I’m starting to wonder if we shouldn’t just backtrack and try to climb up the cliff again, hope the Grimm up there have already long lost interest, and one of those other tunnels will lead back to the Celestial Hills.
“Your grandfather wouldn’t have happened to mention anything about an underground system like this, would you?”
“Sorry, no,” Weiss said. “He told me that telling me about all the secret tunnels and escape routes they’ve found while they were scouting the hills would be cheating.”
Diana sighed. “I never thought I would ever regret someone behaving professionally…”
“So what’s the plan?” Weiss said, idly sipping more of the water.
“We were discussing just that earlier, actually,” Diana replied. “Akko and Ruby are in favour of seeing just how deep this metaphorical rabbit hole goes, I would like to turn around…” She cast a disdainful look at their surroundings. “Deep, sprawling, underground systems have never sat well with me, you see.”
“Same, but I vote to go with Akko and Ruby,” Weiss said. “I’ve found that when in doubt, her instincts are… generally good!”
Diana nodded. “Ready to start heading out again, then?”
“Just give me a little while longer to rest, maybe some pickled plums while we’re at it,” Weiss said.
Diana nodded. “Understood.”
Weiss swallowed the last of the canister, shuddering as the wet, solid ingredients touched her tongue, forced down her throat. “Guh, this stuff is nasty!”
“Can’t question its effectiveness, however,” Diana said. “Don’t you feel a lot better?”
“Sans feeling like I’d just face-planted a forager’s basket with my mouth open, yes… yes I do…” Weiss muttered. She looked at the empty canister. “Wait, where did you get this water?” she did a double take at the spring. “Don’t tell me you–”
“Yes, but it’s purified, I assure you!” Diana snapped. “Gwragedd Annwn’s technology may be primitive by many standards, but it still works as well as it did for Beatrix.”
“It’s actually really cool, how it works, and how they managed to fit an entire water filtration system inside the rod and the spear, without sacrificing structural integrity, dust amplification capabilities, or combat effectiveness since it ALSO doubles as a hydraulic actuator for seriously ramping up the force of any attacks!” Ruby called out. “Of course, it only works with Diana’s family’s semblance, but hey, it IS a pre-Great War artifact…”
“Huh…” Weiss said as she relaxed. “So yours is genetic, too?”
Diana nodded. “Yes—energy and force manipulation, emphasis on fluid dynamics. You inherited your grandmother’s glyphs?”
Weiss nodded. “I did.”
“It’s a real shame you didn’t inherit all of it, or even part of your grandfather’s, but I suppose that’s the mystery of auras and semblances for you…” Diana said.
Weiss winced, Akko awkwardly stopped in the middle of test-loading Shooting Star with her remaining munitions.
“… My apologies, was that a sore point?” Diana asked.
“Yeah…” Weiss replied. “Full disclosure: I DO have summoning like her, I just.. don’t really use it for reasons. Personal reasons. So if you could not badger me about ‘severely limiting my combat effectiveness by willingly ignoring part of my semblance,’ that’d be much appreciated.”
“I wouldn’t dare,” Diana replied. “Even then, you certainly mastered those glyphs to devastating effect.”
“Thanks,” Weiss said. She set the canister down, stood up and stretched. “You girls ready to go? Because I am.”
“Arms, armour, and ammo, all in order!” Akko said as she stood up.
“You’ll still be cleaning excess dust out the vents when we get back, but you have my word Myrtenaster won’t be jamming while we’re out here!” Ruby said as she snapped Myrtenaster’s revolver back into place, headed over to Weiss. “Refilled all her dust vials, too.”
“Thank you, Ruby,” Weiss said as she took it from her hands, admired the freshly honed and reloaded sword. “If there’s anything I can do for you, don’t hesitate to ask!”
“Can you start by giving my cloak back…?”
Weiss blinked. “Oh. Shit.” She stepped off it, reached down and picked it up. “Sorry.”
“It’s fine,” Ruby said, before she put her cloak on with a flourish, hummed as she snapped the clasps back into place, smiled as she wrapped it around her and hugged herself.
Weiss found herself suddenly overwhelmed with the urge to let out a high-pitched squeal of delight, resisted it, and distracted herself by holstering Myrtenaster at her side.
“Alright: now that Weiss is back up on her feet, we’re changing formation,” Diana said as she stood up and picked up her spear. “I’ll still take point, Weiss behind me, Ruby next, and Akko bringing up the rear. Any objections?”
“None,” Weiss said. “Sounds like a solid formation to me.”
“Good—let’s move,” Diana said, picking up the handle of their lamp with her spear, slowly marching down deeper into the cavern.
“Hey, girls? Did you happen to encounter any Grimm down here?” Weiss asked.
“None so far, and I rather hope it stays that way,” Diana said. “These tunnels don’t seem to be connected with the castle, or else the Grimm would have sensed our auras and swarmed us earlier. Still prudent to move slowly and carefully, even without you down…”
Weiss nodded. “… Ah, silly question, feel free to ignore it, but how did you guys carry me all the way here?”
“That was just me, actually!” Ruby said. “Diana didn’t like the idea of leaving our rear undefended, and Crescent Rose is pretty useless at confined quarters like this.”
“O-Oh. Thank you, Ruby,” Weiss said, eyes forward as her cheeks heated up again. “I apologize for being heavy…”
“Aw, don’t worry about it: my family had a HUGE thing for exercise regimes, and carrying Crescent Rose around really builds the upper body muscles—carrying you was nothing!”
Weiss cheeks burned brighter. “… I see…!”
The rest of the walk was spent in silence, nothing but the sound of their footsteps echoing on the stone floor, the faint crackle of their lamp as it burned through its red dust. Akko didn’t seem to be exaggerating earlier when she said the tunnel just went on and on—if she didn’t know any better, had listened less intently to her grandparents’ stories, she would have begun to wonder if she wasn’t just trapped in some bizarre, looping anomaly in reality.
Finally, though, the tunnel seemed to be widening, the walls started to look different, and a cavern seemed to be just on the horizon—but for a very ominous reason. “Halt,” Diana said softly, holding their lamp closer to the walls. “Look—these tunnels were definitely not carved out by groundwater or tectonic movement…”
“You think it could be molerats?” Akko asked.
“Do you think a molerat colony, however large, would feel compelled to dig a tunnel big enough for teenagers to walk relatively comfortably in, before leading out to a giant cavern?” Diana snapped.
“Sorry…” Akko mumbled.
“So we’ve got gravediggers on our hands, is that what you’re saying?” Weiss said.
“Precisely. We’ve got two choices: turn around, and try my idea of scaling the cliffs; or go ahead and investigate, hope the Grimm have migrated a long time ago. If not, we’ve potentially got a hell of a fight on our hands, and there’s little chance of running this time.”
“Gravers always have tunnels that lead to the surface, though,” Ruby said. “Well, that or an abandoned underground colony, somewhere, but then that’d have ventilation shafts that’ll definitely lead us above ground.”
“Do you think it’d be worth the risk, however?” Diana said.
“Yes,” Weiss said. “We definitely know we’ve got Grimm waiting for us back the way we came—I doubt our cliff-face climbing won’t attract their attention, have them waiting for us, if they don’t just start calling out for a new nevermore.”
“Also, I don’t think I can make the whole trip back and still be good to climb straight up a cliff…” Ruby muttered. “We took so LONG to get here, and that spring was so far back…”
“We might even find our artifacts at the end of this tunnel!” Akko said. “Maybe it leads to a treasure cave, one that was below the castle the entire time. Then, we’ll find a way out, AND pass initiation!”
Diana looked at them unhappily, before she sighed. “Good points all around… everyone know what to do with gravers?”
“No talking, or loud noises, except as a distraction,” Weiss said.
“Watch your feet, they like to pop up from below,” Akko continued.
“And always keep on moving—you stand still, you get swarmed,” Ruby finished.
“Wonderful. Oh, and Akko? You still have plenty of grenades left, yes?”
“Ah, yeah! I do. I was planning on not using them until our situation looks pretty fucked again, don’t worry.”
“Good on you, but I was actually going to ask if I could have one..”
“Uh… sure, but what for?” Akko asked as she reached into her satchel, the others passed it over.
“If those things get me, I’m going to be taking as many of them with me,” Diana snapped. “And if I do die, please do me a favour and insist on destroying every gravedigger nest you find.”
“I’m sensing a really storied history with you and gravers…” Weiss muttered.
“You have no idea, just how deep my hatred for these cowardly, predatory, irreverent pests runs…” Diana growled as she put the grenade into one of the series of bags on her belt. She sucked in a deep breath, and relaxed. “Now: anything anyone wants to get out of the way before we shut up for our safety?”
Weiss, Akko, and Ruby all shook their heads as one.
“Good. Akko, take point this time: you’re best suited for CQC. Myself and Ruby take the sides for the reach of our weapons, Weiss watch our backs. Objections?”
“None.” “Nope.” “Nuh-uh.”
“Excellent,” Diana said, as she moved into position. “And again: be very, very quiet… we could be hunting gravers.”
The four of them readied their weapons, and marched forward as gently as they could, eyes alternating between sweeping their surroundings, and looking at the ground below them. However, they couldn’t help but lose the tense, military-like caution as they exited the tunnel and stepped into the cavern.
“Sweet Mother Beatrix…” Diana whispered as they all came to a stop.
It was a massive dome, the floor flat and the walls smooth, unnaturally so with how the rock seemed to have melted and fused from some catastrophic explosion long ago. In the center of it all was a massive pile of rocks, hidden in shadow for the limited power of their lamp.
“This… this doesn’t look like it was made by gravers,” Weiss whispered. “At all.”
“Where are we…?” Ruby asked.
“And what’s at the top of that thing?” Akko asked. “Wait, hold on—Ruby, take the lamp, I’m going to use my flashlight.”
“Akko!” Diana hissed as the exchange was made. “Don’t break formation to investigate!”
“I won’t!” Akko whispered back as she pulled out her flashlight, the indicator red for how long she’d used it earlier, how little time recharging under the sun it had gotten. “I’m just going to take a quick look, and–”
The focused beam of Akko’s flashlight cut through the darkness, illuminating the object at the top of hill; the four of them squinted as something reflected back at them… seven points of light, with a golden arch all settled into a vaguely rod-like configuration, before Akko’s flashlight died.
Beat.
“OH MY GOSH, IS THAT THE SHINY ROD?!” Akko screamed at the top of her lungs, her eyes sparkling, her words echoing in the chamber for several seconds.
Everyone else winced and jumped, tensed up and readied their weapons as they heard a distinct rumbling, the ground below them start to shake, an ominous, terrible feeling fill the air. Akko’s eyes widened as she slapped her hand over her mouth, she looked sheepishly at Diana as she shot her the hardest, sharpest, most hostile glare any of them had ever seen in their entire lives, so full of animosity the just chilly cave became bone-chillingly cold.
“Akko,” Diana started, her voice ominously calm, “I realize that you’re a gigantic fan of Shiny Chariot, and running into her weapon here of all places has got to be one of greatest moments of your entire life, but as I’m pretty sure you have doomed us all to a terrible, horrible death by gravediggers, I would like to take this brief calm before the storm to tell you, with all the sincerity I can possibly muster from the very bottom of my heart:
“Fuck you.”
A claw with spade-shaped nails burst out of the ground, nearly grabbing Weiss’ ankle if she hadn’t jumped back. The four started to run as more and more claws erupted all around them, snatching at the empty air where their legs just were, popping up where they thought any of them would step next. Those that missed started to unburrow completely, letting out an awful, clacking noise as they snapped their jaws, their massive teeth banging against each other so hard they made sparks, eyeless heads jerking back and forth, red streaks the only features on the white plates covering their skulls.
“FIND A WAY OUT!” Diana cried as she stabbed a graver straight through its skull, vaulting to the other side with her spear as two claws reached up where her ankles just were. “FAST!” she screamed as she started running, the unburrowed gravers already charging for her.
“THE SHINY ROD!” Akko cried as she detached Shooting Star’s blade, slashed, punched, and smacked away the ever growing swarm of gravediggers flooding the room. “JUST GET THE SHINY ROD, WE’LL BE FINE!”
And at that, the giant pile of rocks started moving and shifting, the largest boulder in the pile gained a glowing red eye, before a white mask emerged, red veins spreading all throughout the surface of the earth as they started shifting and floating in the air, taking on a vaguely humanoid shape.
The gravediggers sensed the tremours from the petra gigas, quickly forgot about the huntresses as they hurriedly burrowed back into the ground. Weiss sighed as the claws around her ankles disappeared, Ruby swung through empty air where a graver should have been, yelped as she lost balance and toppled to the floor.
“… Okay, so maybe we can’t do that anymore…” Akko said as she reattached the blade, started reaching for her grenades. “But hey: at least the gravers are gone, right…?”
The whole cavern shook as a MASSIVE claw shot up from the ground, the earth shaking even more violently as it grabbed onto the floor, used it as leverage to pull its other claw out from the ground, then the rest of its body, grunting as it banged its head on the ceiling.
The Grave Lord idly rubbed that section of its skull plate, grinding its teeth together in annoyance.
The petra gigas seemed to glare at it, before it pounded both its rock arms into the ground, chunks of the ceiling and walls cracking and breaking off.
The grave lord turned it, spread its arms out wide as it roared, the sheer force of its howl knocking everyone to the ground, forced them to clap their hands over their ears as their chests thrummed painfully.
The four huntresses quickly regrouped to one side of the two titans, watched uneasily as the cavern walls started to crack and crumble even more, the two Grimm prepared to fight.
“Haah…!” Akko yelped. “Well, I guess it’s a good thing for us that geists and gravers–”
Weiss put her hand on her shoulder, she stopped. “Akko?”
“Yes, Weiss?”
“Please shut up.”
“Okay.”
6 notes · View notes
230east · 8 years
Text
sinking silently in my submarine
 peeking up my periscope 
periodically perusing the passing 
photosynthesizing plankton 
pulsating plasma membranes 
eight legged tentacular suction cup
Pill popping percolating
positive vibrations
shaking up foundations
rock rolling down
to the bottom again.
just out of reach
water will recede
Cyclone circling the drain
so thirsty
get thee
to a nunnery
habit forming
thot-like behavior
instant gratification
think in new ways
get in formation
Shakespeare compares thee to Beyonce
woke up flawless like a diamond
dumber we round down
to the lowest denomination
algorithm assisted living
marketing machines
suggestively shaping
what you see
programming your point of view
the screen you pass through
is a filtration system
profile picture profiles you
feed back looping
it's the sine of the times
like a wave crashing systems
conversations conspiratorial in tone
the sinking suspicion that not so fresh feeling
and douching in general is a maladaptive marketing
mechanism to make you insecure and unsure.
they planted the product in your periphery
you think its your own idea
evolutions going backwards
survival of the photoshopped.
I’d rather be a monkey.
but ive evolved past tense
see triple in 3D
I trace your trajectory
parabolic path leading back
tragic swag. so sad these days.
no surface only substrate
sound of echoing rippling water
then a gasp for air breaks the  waves
reverberating ringing tingling
beat tympanic tamborine man
oscillting ossicles translate
fluent French kiss my derriere
rare special edition
one of a kind its just like mine
same old samo
saying the same thing
eat your drugs
don't do school
stay in vegetables
various variations on the theme
every verse a throw back
vintage vino veritas
theres truth in that
cliche et tu brute
wino forever never left me
so retro back in style again
stranger things have happened
Strange fruit hanging from the poplar trees
still singing that song flowing through me
swinging in the breeze in fields elysian
exceptional on a hill past daffodils
narcissistic point of view image conscious
selfish gene pool self interested kin selection
consciousness superficial
on the surface floating
like a glacier melting
oblivious to  the tension growing
till it bursts through the glass mirror ceiling
 distorting  the image in circular ripples of pixels 
impressionistic audience
glitch in the system program
its all conditioned
when i ring the bell 
cerberus salivates 
it is fate
three bitches barking
measuring me out by string
theoretically 
three weird sisters 
by the cauldron bubbling
on the lyre 
lyrically i am lilting
you can’t stop me
you can’t stilt me
im always growing 
exponentially
 Fibonacci flow
 spiraling out of control
fractals follow golden ratio
chaos creating destruction 
entropy at equilibrium
Here we meet 
Apollo and Dionysus
combined in catharsis
pupils open to see pathways
 parallel past the point 
of no return to normal vision 
vanishing point out of view 
past pluto out the solar system
on my way to cross the river 
styx 
REFERENCES IN NO PARTICULAR ORDER
STRANGE FRUIT Southern trees bear a strange fruit Blood on the leaves and blood at the root Black body swinging in the southern breeze Strange fruit hanging from the poplar trees Pastoral scene of the gallant south The bulging eyes and the twisted mouth Scent of magnolia sweet and fresh And the sudden smell of burning flesh! Here is a fruit for the crows to pluck For the rain to gather, for the wind to suck For the sun to rot, for a tree to drop Here is a strange and bitter crop. -- Music and lyrics by Lewis Allan, copyright 1940
HAMLET
I have heard of your paintings too, well enough. God has given you one face and you make yourselves another. You jig and amble, and you lisp, you nickname God’s creatures and make your wantonness your ignorance. Go to, I’ll no more on ’t. It hath made me mad. I say, we will have no more marriages. Those that are married already, all but one, shall live. The rest shall keep as they are. To a nunnery, go. -Shakespear
I AM A STRANGE LOOP
In the end, we are self-perceiving, self-inventing, locked-in mirages that are little miracles of self-reference.
— Douglas Hofstadter,P363
And there he, on the the stark, dark marker  Atop his parents' graves, shed tears,  And praised their ashes — darker, starker.  Alas, life reaps too fast its years;  All flesh is grass. Each generation,  At heaven's hidden motivation,  Arises, blooms, and falls from grace;  Another quickly takes its place.  And thus our race, rash and impetuous,  Ascends and has its day, then raves  And hastens toward ancestral graves.  All too soon, death's sting will get to us;  Aye, how our children's children rush  And push us from this world's sweet crus
And then with verse of quickened sadness  He honored too, in tears and pain,  His parents' dust... their memory's gladness...  Alas! Upon life's furrowed plain —  A harvest brief, each generation,  By fate's mysterious dispensation,  Arises, ripens, and must fall;  Then others too must heed the call.  For thus our giddy race gains power:  It waxes, stirs, turns seething wave,  Then crowds its forebears toward the grave.  And we as well shall face that hour  When one fine day our grandsons true  Straight out of life will crowd us too!
let me sing a tune up tempo to the groove in the recording turn up the gramaphone and listen bro I am the best alive aliviate the symptoms but wont cure the pain killers murdering meat cleaver cut you into filet a deux lets dosey do lets hula hoop lets lasso the moon for you betty boop bop dop dap zap zippy zippering witty whimpering sassy syllables trashy talkative locomotive combusting and composting reusing and recycling reducing so compact disc DVD player ipod 3D glasses pixilation pointelissm glitching itching for a scratched surface scar face so Miami mami papi chulo lean low dow ho and hit the floor on your knees looking up at me like asking will you marry me run away with the beat and drop it down sinking silently in my submarine peering through my periscope periodically perusing the passing photosynthesizing plankton pulsating plasma membranes eight legged tentacular suction cup overfloweth with the fluid flow so Fibonacci spiralizing  spiritual feeling so free too carefule calculated in the risky behaviors bitch yap yaw yippy yay you only live uno dos tres stress the alliterative alternative alternating current events talking heads heaven is a place where nothing happens above us only sky and satelittes revolving evolving electrical signal transduction travertine stone up your nose rock the boat overboard emotional so emo what she yelling for in such a monotone drone dramatically durgical and clinically clergical sentences so sequence shimmering laser bean landing site fly a kite thunder and lightning bug chirp
on the path charted through the sky
chariots of fire Apollo s
in pediatricians
we all follow direction and its counting down from ten to scale model student pupils open to see pathways parallel past the point of no return to normal vision vanishing point of view on point the point is people like you postulate pictorially snap back to reality whomp there goes gravity I am above it all I see through all it. i saw the signs of the times so many signals overstimulating the market so similar to something the remix of ignition is cool again until its overplayed out of style so retro im coming back like vintage vines wino forever in vino veritas theres truth in that touché et tu brute brutalist
zoot suited tooted and boot leg boozer buzzer
cycle seasons
tick flick off
membrance awesome oscicles oscilation
it's the sine of the times cant you see it pay attention
double visionary view from above
The next thing I woke up still singing that song the one you hear flowing river styx Cerberus salivating salty seas soylent green is algae plants are people im a dafodill on a hill let me sing a tune up tempo to the groove in the recording turn up the gramaphone and listen bro I am the best alive aliviate the symptoms but wont cure the pain killers murdering meat cleaver cut you into filet a deux lets dosey do lets hula hoop lets lasso the moon for you betty boop bop dop dap zap zippy zippering witty whimpering sassy syllables trashy talkative locomotive combusting and composting reusing and recycling reducing so compact disc DVD player ipod 3D glasses pixilation pointelissm glitching itching for a scratched surface scar face so Miami mami papi chulo lean low dow ho and hit the floor on your knees looking up at me like asking will you marry me run away with the beat and drop it down sinking silently in my submarine peering through my periscope periodically perusing the passing photosynthesizing plankton pulsating plasma membranes eight legged tentacular suction cup overfloweth with the fluid flow so Fibonacci spiralizing  spiritual feeling so free too carefule calculated in the risky behaviors bitch yap yaw yippy yay you only live uno dos tres stress the alliterative alternative alternating current events talking heads heaven is a place where nothing happens above us only sky and satelittes revolving evolving electrical signal transduction travertine stone up your nose rock the boat overboard emotional so emo what she yelling for in such a monotone drone dramatically durgical and clinically clergical sentences so sequence shimmering laser bean landing site fly a kite thunder and lightning bug chirp
The American Dream is a product.
Lassoing up that freedom and mass producing it in metal.
I grabbed the reins and hoisted up on the saddle.
Perhaps he was too dumb to run.
Perhaps he was trying to protect me.
Graffiti on the door to the private room.
He shaved his face with a hatchet.
They placed bocce on the boat
Dressed in white.
Looking up at the billboard by the highway
Trying to communicate
He ran with a baguette]
I aint going outside. she said to the dead air left lingering in the cigarette soaked airwaves still circulating
The smoky air swam circular warning skylarks illuminated by a stray sunbeam. light littered in lateral patterns.
lyrically i am lilting you can’t stop me you can’t stilt me
well I’m majoring in business administration and I’m thinking of minoring in communications
1 note · View note
Link
Mold Cleaning Services and Cost Wichita KS | Wichita Household Services
 More information is at:  http://wichitahouseholdservices.com/mold-cleaning-near-me/
  Is your home found to be infested with mold? Need mold cleaning services near Wichita KS? Just call us now and rest assured that we will be there in no time to remove it for you. Free estimates! Call today or schedule online easily! Mold spores can quickly grow into colonies when exposed to water. Before mold remediation can begin, any sources of water or moisture must be addressed. Otherwise, the mold may return. Mold often produces a strong, musty odor and can lead you to possible mold problem areas.
    REQUEST A QUOTE NOW!
 MOLD CLEANING SERVICES FROM WICHITA HOUSEHOLD SERVICES
  Water is the giver of life, but it can also be one of your greatest enemies. Water leakage can lead to the growth of mold, which can cause much damage to your home or office premises. When mold becomes the breeding ground for irritants and allergens, it can also have long lasting effects on the health of everyone who happens to inhale the microscopic mold spores.
A simple plumbing leak can wreak havoc on your premises in a matter of days, as standing water presents a great environment for mold fungi to thrive. Although a small amount of mold will not hurt most people, mold can multiply rapidly if left unchecked and can cause respiratory problems, allergic reactions and even nervous system breakdowns. Don’t underestimate the health hazards caused by mold. Allow Wichita Household Services to expertly attend to your mold problem right away.
 MOLD AND MOISTURE
 Mold thrives particularly well in humid environments, which is why Singaporean business owners have to be particularly vigilant of the risks and how to prevent it. The key to preventing mold is to watch out for plumbing leaks, which causes standing water – even the smallest leak can have devastating effects over time. Mold thrives on water so you must remove any excess and unwanted water. Additionally, you should attempt to keep the humidity factor at 45 or below to prevent mold from growing.
When you notice the tell-tale musty odor of mold around the site of a plumbing leak, it is important to call in the plumber to repair the water leakage promptly, otherwise all your attempts to get rid of the mold will be in vain.
Mold grows rapidly and becomes increasingly more difficult to remove if left unattended. It can travel via the air and tends to stick to all kinds of surfaces, including the ducts and vents of your air conditioning unit. Mold is ever-present and must be addressed as swiftly as possible.
 ACTION STEPS TO REMOVE MOLD
 1. If you believe that your building has been infected with mold for a long time, you might need to consult a healthcare professional to assess your employees. Mold can have devastating effects on people’s health. You will also require expert mold cleaning services to thoroughly inspect the building and take the necessary steps to remove mold and ensure that the premises are safe for use.
 2. Contaminated water can also cause mold to grow more rapidly. Call a plumber to test your potable water supply and to install a water filtration system.
3. Do not operate your air conditioning system if you suspect that it may be moldy. The last thing you want is mold spores spreading virally throughout your offices via the air conditioning system!
4. Call in the mold cleaning experts. Our mold-busters at Wichita Household Services
will assess the property to ascertain which areas have been affected by mold. They will use state-of-the-art equipment to identify, contain and isolate mold growth, especially since it is often invisible to the naked eye. Our mold cleaning team will then take the steps necessary for preventing further damage and spreading of the mold.
The cleaners can even capture and contain mold that floats around in the air. This is especially significant, as it prevents the onset and spreading of allergens which are harmful to humans. All surfaces – furniture, floors, air conditioners and the like will be specially cleaned and sanitized so that the mold is permanently removed.
When we have concluded our mold cleaning services at your premises, you can rest assured that you and your staff are left with a safe and healthy mold-free environment.
  BEST MOLD CLEANING COMPANY IN WICHITA KS
 WICHITA HOUSEHOLD SERVICES
 REQUEST MORE INFORMATION.
 CONTACT US:
Wichita Household Services
We Offer Cleaning Junk Removal Movers Handyman Services
Call: (316) 448-3558
SERVICE AREA:
55 Cities within 30 miles of Wichita, KS:
Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS
ZIP CODES:
67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – BelAire or Wichita | 67221 – McConnell AFB | 67226 – BelAire or Wichita | 67543 – Haven
0 notes
gourmetsalts-blog · 4 years
Text
Himalayan Salt Crystal Lamps - Natural Healing and Appeal For Your House | So Natural
Experience revitalizing impacts comparable to a thunderstorm, ocean or falls in your home with a Himalayan rock salt lamp. These gorgeous lights not only give a warm radiant atmosphere however likewise give off adverse ions to mimic air purification and also power restoration equally as in nature.
Salt gift sets london
Himalayan Rock Salt Light - the Natural Indoor Air Purifier
Hand extracted from the foothills of the Himalayan Hills, these all-natural lights are sculpted from bio-energetic crystal salt produced over countless years back from dried up sea waters. A thoroughly put source of light will gently warm up the salt creating the discharge of unfavorable ions right into the ambience. Common contaminants floating airborne such as dirt particles are favorably charged as well as these come to be affixed to the negative ions generated by the Himalayan salt lights. A heavy neutral fragment is formed which drops to the flooring, hence removing it from the air we take a breath with a natural air filtration procedure.
 As a result of their air purifying properties, Himalayan crystal salt lights are renowned as all-natural recovery therapy. Specifically, lots of customers discover that typical breathing issues such as asthma, along with allergic reactions end up being much less bothersome. As a matter of fact healing of swelling as well as boosting respiratory health and wellness through completely dry salt treatment, referred to as speleo or halo therapy, has been around given that the 1800s. It was uncovered by a Polish doctor that located that respiratory system conditions can be healed by taking a breath pure, ionized air in salt mines.
 Himalayan salt lights are really effective when placed throughout the home or office, yet normally the bigger the space, the bigger the lamp ought to be or a majority of lamps need to be spread around. In a similar way to positioning a plant inside to produce some natural power, the lights are amazing for combating depressing electromagnetic power produced by computer systems and tvs. The natural recovery therapy of crystal salt lamps is additionally credited to increasing energy and promoting restful rest that makes feeling given that our bodies recover overnight.
Gourmet gift sets london
Choosing Your Himalayan Crystal Salt Lamps
There are many suppliers of these attractive lights so you won't be stuck for option. Some important indicate take into consideration when buying a Himalayan rock salt lamp include:
 Make sure the distributor sources the lamps from a top quality fair trade supplier in the Himalayan area as it is not unidentified for employees to endure inadequate problems for this challenging hand-operated job along with utilizing low quality salt.
The lamps need to be firmly affixed to a base for stability as well as consist of a UL examined cable for security.
Shape - the much less the salt is sculpted, the more natural looking the light.
Size - it will certainly be kept in mind when you get the light the approximate area in which it will certainly be effective, but remember you may intend to consider larger or several smaller sized Himalayan salt lights for bigger spaces.
0 notes
llsiservices · 5 years
Text
reverse osmosis drinking water Lincolnton
For the very best water solutions, water softening, reverse osmosis drinking water, free water analysis, salt delivery, water filtration systems, etc. in Mooresville, Concord, Midland, Monroe, Waxhaw, Gastonia, Lincolnton, Hickory, Shelby, Locust, Salisbury, Huntersville, Kannapolis, Rock Hill, Fort Mill and all of Charlotte, North Carolina please visit CulliganCharlotte.com now.
0 notes
gartdavis-blog · 7 years
Text
Visit to Aguadilla
Friends,
I recently traveled back to the house I grew up in on M street in Ramey. I have followed the state of the island since Maria hit almost 8 weeks ago, and had lots of questions going down, so I thought I’d share my notes…
Travel by air:  I was not able to book in or out of BQN airport… Jetblue flights that run overnight from the states were all cancelled.  So I booked AA through San Juan.  Prices were reasonable on AA, but Jetblue is still the best if you can get a flight.  Easy to find flights down to the island… harder to find them back.  SJU airport was full, but operating normally.  AC was on, and I had no trouble transiting and picking up my rental car.  BQN currently only has had a regular service from Spirit Airlines from FLL.  In theory, service from Jetblue and United will return to BQN before the holidays, but we’ll only know for sure once its happened.  One new feature of BQN - the old ready area where the bombers used to park has been taken over by the US military, and is now a small city of lights with lots of army trucks exiting and entering near the golf course.  Now that the Army’s mission is complete, this may return to its normal empty state.
Connectivity: much better than expected.  I have a Verizon contract and was connected to Claro the moment I powered up at SJU and it remained so all over the North side of the island.  Near Ramey, the connection is actually LTE, which means its been good enough to use my phone as a hotspot for email, research, e-commerce.  I believe that this is partially a result of more than 40 high efficiency solar powered cell stations that were brought to the island by Vanu inc.  (Vanu Bose, the founder of Vanu and the driver of this humanitarian contribution, was the son of Amar Bose of the eponymous corporation. He passed away last week.)  People on AT&T were also on Claro.   I had coverage from San Juan to Mayaguez continuously on Route 2 without interruption.  I wouldn’t count on this to watch netflix, but it was strong and reliable for phone, text, and email.  All of Ramey had coverage.  At this point there is no value in pursuing satellite, but there are various expensive Satellite systems, like this one from Garmin, that keep you in basic communication when you're off the cell grid, but they don't actually replace Internet connection.  There's a great review in there that goes on for pages - its a complicated device.
Travel around the island - Driving from San Juan to Ramey was almost completely normal except for the visuals.  You notice right away that all the outdoor advertising and large signage is gone, and pretty much anything involving wood, corrugated roofing, or poles for any use.  Traditional construction of concrete with metal ventanas is pretty much untouched. The impact is notable in San Juan, but becomes much more dramatic from Arecibo on.  A kinda weird visual - you could tell the worst sections because the buildings looked sandblasted.  Many businesses along #2 were open with generators, or occasionally, a section that had power.  I took the same route to Ramey as I have done, without detours.  Some traffic lights are out, but none of the really important ones where big routes cross.  If you have to turn left at a busted light on rt. 2, just don’t…. turn right and figure it out later.  
Water… is flowing in Ramey and many places around the island, and did not drop out when I was there.  There’s still a boiling order, and when you take a shower you come out smelling like you exited a heavily chlorinated pool.  But regardless, having water is great.  I brought two different filtration systems, one that is gravity based (Lifestraw) and one that you pump.  I bought 4 coleman solar showers, which are basically 5 gallon black plastic bags with nozzles.  Down the road, I’ll try to purchase some water storage, a big cisterns for flushing, and something else for long term storage of potable water, but right now this was not as urgent.
Fuel:  I had no problems getting gas, there were no lines and most gas stations were open.
Groceries: The Econo is open, and even takes credit cards.  As always, its a social center, so budget 3 minutes for talking for every minute of shopping.  The coolers were full and prices are about as I remember them.  I bought a fresh salad that was good!
Restaurants: many are open, though some with a smaller menu or shorter hours.
Open out gate 5:
Levain (daily coffee here was sent from heaven)
Debut
Cofos Pizza
Martin’s BBQ
Cinco
Country Pizza
110 thai
Palmas
Open down the Hill:
eclipse (dinner only, no breakfast or lunch)
The frituras place at the S on the way down to Jobos
Ocean Front and lots of places near Jobos
Julios and lots of the other frituras places on the beach near Isabella
Open out Gate 1:
El Meson
Sasones
Desecheo
Lots of fast food out near #2
Closed:
Umas
Ramey Bakery
Airport cafe
Marriott (they have a small thing set up just for guests)
Beaches: After seeing pics of crashboat online I was concerned that all the beaches were just as hollowed out… not so:
Crash boat: every bit as dramatic as the pics.  Right side is now tiny and not terribly safe, lots of exposed rock under the surf near the jetty.  It seems that a lot of the missing beach was thrown onto the space that was the parking lot… which is now 3-4 feet deep with sand.  I hold out hope that this sand can be pushed back out to re-create some of the old the beach.  The left side you can still park and swim; its smaller but not that different from how it was.  
Malecon Aguadilla: The brand new oceanfront walk seems to have come through entirely unharmed and looks great.
Borinquen beach: Much as beautiful as it always has been.  Only new feature: a military unit desalinating water in the parking lot… impressive operation.
Survival / Martinica / Bajuras / Shacks: the Sand road down the cliff is still intact, though the left turn to go to Survival is completely blocked.  You can go straight across, although its still rainy season and with all the recent dumping its turned into a bit more of a cesspool of garbage and shit than I remember.  It appears that despite the violence of the storm, the waves did not break through the dunes and flood the old sand excavation area - a concern I’d long held.  Once across, you can walk the strand to either survival or Shacks without impediment.  I saw many hoof prints as well, so it looks like people are riding this stretch.   The lawns next to the Eclipse took a beating, but the restaurant was hardly touched… hopefully people will be able to breakfast and lunch their soon.
Jobos: is in mid-construction down near the beach access, so I didn’t see that much, but did not seem too undermined.  None of the oceanfront places fell in, and many were open and totally full on a Friday night.
Surfers: the road down has a couple trees propped across the roadway, but not so low you can’t pass.  The parking lot structure is a bit undermined, but it was before.  Waves are the same.
Spot/Middles/Isabela: I was down that way at Julios in lower Isabela on Sunday and the place was as full as I can remember, complete with the parade of Jeeps and music.  The beach roads are intact and the north shore seems largely as it was.
Money / ATMs, Banks, Credit Cards: this is not quite back to normal, cash is still the only currency in a lot of smaller businesses, but I didn’t have trouble getting cash out of ATMs, and used credit cards for large purchases at Home Depot and Econo.
Electricity - This is really the biggest story that remains.  The grid is a string and tinkertoy tangle that will be an enormous labor to sort out.  Just to restore 30 houses on our street is a project that will require clearing/cutting dozens of fallen trees to create backyard access, and then every pole, wire and transformer is down (and will have been for months), and most connections to the individual houses are impaired as well.  And the whole island is like that.  Right now, the focus is on the easiest and most critical places.  The most recent estimate that I think is credible is 70% of meters connected by the end of February.  This leaves the 30% that pay the smallest bills and are the hardest to reach, and I could see it being another year before its 95%.  While I was there, none of the housing areas in Ramey had power, but there were a few areas outside Gate 1 and Gate 5 that had been restored.  Lots of people run generators - our neighborhood sounds like lawn mowers going 24 hours a day.  The Solar folks, particularly Maximo Solar near us, are crazy busy.  He’s signed contracts for more than 1,000 off-grid systems… only about a million more to go!
Until power is restored - There is a lot that can be done to improve quality of life even if you do not have grid power.  Its hard to know how much to spend because you don’t know when you might be lucky enough to get your power back on.  My view - think of your spending as one part now, one part preparation for the next Irma/Maria.  But with the money thing in mind, I’ll go in order from cheapest to most expensive.  I brought two checked bags of 50 lbs each, so my experience was limited to what I could brink and what i could buy on the island.  
— My very favorite thing is the OPolar USB fan. This 9 inch fan  doesn’t replace a ceiling fan, but it runs all night, blows enough to keep me cool and keep the bugs at bay, and uses just a part of my laptop battery, and it was cheap.  We still had our mosquito nets, but the mosquitoes were actually not bad in Ramey, so I did not re-hang them.  This fan actually had a review from someone in PR who used it after Maria using her laptop battery.  I also found these little fans that are used to cool electronics and blow 50 CFMs each and are powered by USB ports out of the batteries.  I bought two sets of two... These worked and drew very little, but the Opolar was a much better solution for cooling down and sleeping.
— I bought 4 LED solar lights that you leave outside during the day and stay on all night... they have motion detectors and you can leave them in three modes: full on, night light, or motion detecting that goes from night light to full.  My next favorite thing.  charge up during the day, take them inside and light your evening hours no problem.  Then leave them in night-light mode so you don’t stub your toe on the way to the bathroom.
— a Two burner grill and a propane cylinder.  I bought these on the island for $89 and $49 at the Home Depot in Hatillo, and now I can boil water and cook stuff.
— portable fold up solar panels (36 watts) - this is perfect for charging cell phones and kindles, but not for laptop or fan.  I’d skip this, and instead, the next two are useful individually, but if you’re willing to drop the dough, they are perfect together:
—185 watt-hour battery that output USB and, with separate inverters, 110 volt AC which runs laptops, charges phones, anything up to 100 watts draw, including the USB fans (see above), but also the smaller of the standard 120 volt rotating fans.  
— 80 watt fold up panel to charge the battery.  These connect to each other via a 5.5 outside diameter * 2.5mm inside diameter DC cable that is female on both ends, but is fairly short, so I bought 3 12 foot male to female extenders. This combo worked great, but you really do need 8 hours of sun to recharge the battery if you’ve drawn it all the way down.  It weighs 4 lbs, folds to the size of a fat laptop, and if you have a reasonably sunny day, will power up the battery I listed above.  While I don’t recommend it, I did leave this unit out in some pretty heavy rain several times, and it continued working.
— One of the things that I hungered for as I tried to mete out my meager trickle of electricity was the ability to know how many watts a thing used… what would burn down my battery faster, this fan or that fan?  This watt meter would have been super useful, so I’ve bought three and they’ll go back down with me in December.
— A 1000 watt honda generator.  This is 26 lbs and can be brought in checked luggage as long as you never open the box.  It is the quietest, lightest, smallest generator on the planet, and runs longer on less fuel than anything out there.  Two trade-offs: you can only power 900 watts of stuff with it, and its pricier than many bigger, noisier, heavier generators.  This will let you run things like a (modern) fridge, almost any household item that doesn’t have a heating element including all your fans to keep you cool, and you can charge your batteries in the rain.  Generators could not be had at any store I visited on the island, nor could you buy a jerry can, and I looked.  If you bring a generator to the island, bring a jerry can or you’ll not get much use of it.
— Cool trick: turn off every single breaker in the house.  Turn everything off.  Cut off the female end of an extension cord, and splice on a male end.  Plug one end into your generator, and the other into a wall socket.  Now all the things that are on that circuit are powered by the generator.  In my case, that enabled things like ceiling fans and the lights attached to them.  Warning: do not back-power the grid, make sure that the circuit you plug into is -not- open.  If this sounds confusing, just think of it like water.  If your neighbor has well water and your city water is out, they can run a hose to your outdoor spigot and turn both ends on, and you’ve got water in your house… now you just need to make sure that your neighbors well isn’t running through your house back out into the city water system full of broken pipes or whatever.
— Refrigeration -- Our house fridge ran brilliantly on the Honda genset… it cooled right down, and stayed pretty cool when the generator wasn’t running.  Alternatively, there are some really fantastic new compressors  in a 40 quart fridge/freezer (about 1.33 cubic ft) that draw just 30 watts (about 10% of the power of a normal fridge) and can run for a week on the charge in a 12 volt car battery.  I'm not going to jump on this, but it may be the best way forward for folks that are trying to run a minimalist electrical footprint on portable solar panels.
— Cleanup & Tools -- Chainsaws could not be had at any store on the island.  Dewalt has a new 'flexvolt' battery system with 60 volt tools.  For example this chainsaw or this fan.  If you buy 4 batteries, you can power an inverter power station that with the power stored in all 4 batteries is a little like the jobsite version of the Tesla Powerwall, which can power a house fridge or other normal things that need house current.  I didn’t purchase / test this.
Laundry -- This becomes a top issue once you’re in week 4 and you have water and generators.  The motors in older washers draw 1,000 to 2,000 watts, so you need a bigger generator than the one I brought.  Modern energy star washers draw more like 500 watts.  Dryers - Just no… I’ll put up a clothes line for the back porch.
Bigger Batteries, Inverters, bigger portable solar — We have had folks from RAM staying in the house, and they were kind enough to put another portable solar solution on the house.  It was a pair of Centech 750 watt inverters, a Solar charge controller model cm-30a, two Uni-Solar PVL-136 roll-out solar panels, and a 935 CCA 12 volt lead acid truck battery that I bought at the local auto parts place.  This system worked, but was not able to run stuff that drew more than 100-200 watts.  I think part of this was just my ignorance of how to optimize the utilization of this rig.
Bigger Generators - Generators are everywhere, so the whole island is like Saturday morning with lawn mowers running.  The inexpensive gas generators work great but they are -very- noisy.  After waking up to the sound of a generator for the Xth time, quiet is important and merciful.  With that in mind, the Honda 2,000 watt generators can be put in tandem, they have an ‘eco’ mode that throttles up and down as energy is drawn, they are efficient, and as quiet as its possible to make a generator that makes this much power.  4 kilowatts peak service will allow most houses to do most things, with thoughtfulness about what gets turned on.  A dual rig with parallel cables, security attachments and extended run fuel system can be had for under $2,500.
Permanent Solar - This is the long term solution.  I’ve gone ahead and committed to 21 240 volt panels and a Tesla powerwall, to be installed by Maximo Solar.  This, combined with a moderation of electrical consumption, will permanently address electrical power.  Two neighbors had rooftop solar arrays that survived the winds of the storm completely intact.  Another neighbor out on the cliff was a bit more exposed, and their array tangled with a solar water heater tank, and was a total loss.
A couple concluding topics:
Law & Order: My experience was really very much like life on the island at any other time.  Across more than 4 decades there’s been lots of petty larceny, and perhaps I’ve just been lucky,  but I’ve experienced just one face to face larceny (in high school on the track bus) and zero violent crimes.  While there are stories (as ever) and people should take proper precautions, I found the island as peaceful (and chaotic) as ever it has been.  The mood and tone were warm, and I felt at every moment surrounded by commiseration and a willingness to help.  I felt totally secure at gas stations, banks, supermarkets and airports.
The big work: I saw electrical crews out at all hours of day and night, in all weathers.  Debris removal crews had started to come through our neighborhood.  Its an extraordinary undertaking, with no drive-in assistance, but I think the agree with others that amidst the huge challenges and overwhelming scale of work, the key words are resilience, optimism, and heartwarming positive vibes.
How to help?  
The first way to help is simply to think about this as you read the news, and as you advocate and you vote.  The future of the island is absolutely in the hands of our federal government, everything from the amount of assistance supplied to the diaspora of Boricuas that are arriving in the 10s of thousands, to the way that PREPA will pay the billions required to rebuild 50 years of electrical power infrastructure.  This stands on top of the basic questions that predate Maria: a decade of economic and population shrinkage, and a death spiral of debt burden.
There are many charities doing extraordinary work on the island.  Global Disaster Immediate Recovery Team worked with the Vanu team to restore cell communications on the island.  There is still a lot of work especially up in the mountains, so you can volunteer through the coordination site Volunteer Organizations Active in Disasters.  If you’re on the island and unemployed, FEMA is hiring.
At a more personal level, I’ve followed through on gofundme campaigns of friends and colleagues, and tried to work the connections I know and contribute what I can to the upward spiral.  I’ve diverted resources from stateside projects to cleaning and rebuilding on the island, and tried to support others as they’ve done so as well.
0 notes
twelvebyseventyfive · 7 years
Text
Wines from Chapel Hill, McLaren Vale
I recently tasted through the range from McLaren Vale producer Chapel Hill, whose wines I hadn’t seen in a while. I was impressed. ‘The past 12 years have been a transitional period for the winery,’ says winemaker Michael Fragos. ‘It was in the 2008 vintage that we started showcasing our single site wines and when the changes to our approach to winemaking really gained purpose and momentum.’
Michael outlined the wine growing philosophy at Chapel Hill:
“The Chapel Hill vineyard benefits from elevation, ancient rocks, contoured plantings and moderating sea breezes.  The undulating landscape results in a series of small blocks with unique combinations of geology, soil, aspect and climate.
As the winery does not have access to mains water, rain water is collected and utilised in the winery.  Winery waste water is captured and treated though a wetlands system for subsequent vineyard irrigation.
All marc and mulched bunch stems from the winery are composted on site then spread back on to the vineyard, negating the need for synthetic fertilisers.
The spray program has been revised to minimise the impact on beneficial insects, this maintains a natural balance in the vineyard and prevents pest and disease outbreaks.
Hoeing, spot spraying and brush cutting have replaced blanket under vine weed spraying.  Volunteer cover crops have been encouraged in both the mid-row and under vine area to smother out problem weeds.  These grasses are left to die off naturally over summer, providing valuable cover for the soil and hence reducing evaporation, increasing organic carbon levels and reducing erosion.
“Similarly, with our winemaking, all grapes benefit from gentle handling and patient winemaking, we utilise:
Small batch open fermentation with gentle plunging
Basket pressing
Maturation in 100% French oak (with a lower percentage of new oak)
Minimal additions
Natural clarification (no fining or filtration)”
  Chapel Hill Shiraz 2015 McLaren Vale, Australia 14.5% alcohol. This is floral, sweet and intense with direct black cherry and blackberry fruit. Nice grip with some freshness to the fruit, and a creamy, sweet undercurrent from the oak. This is ripe but shows good balance, and has keen acidity and structure supporting the lush fruit. Still primary and a bit unformed, but delivering a lot of pleasure, and with lots of concentration and intensity. 93/10
Chapel Hill Mourvedre 2014 McLaren Vale, Australia 14.5% alcohol. Vivid, herb-tinged, spicy blackberry and blueberry fruit here, with a herby edge. Vivid and fresh with some red fruit brightness and a peppery twist, as well as herbs and olives. Sweet and savoury at the same time, with nice grip on the palate. There’s a nice contrast between the dense fruit and the bright, spicy, peppery character. Varietally true, and opens up nicely on day two, after initially being a bit reductive. 91/100
Chapel Hill Bush Vine Grenache 2014 McLaren Vale, Australia 14.5% alcohol. This is bright, supple and fresh, with a vivid, lively raspberry and red cherry character, as well as hints of tar and spice. It’s juicy and quite elegant, although at the same time nicely ripe. Sweet raspberries and plums, coupled with savoury herbs, pepper and tar. Some tannic grip, too. Opens up well on the second day, suggesting that this should develop nicely. 91/100
Chapel Hill Cabernet Sauvignon 2014 McLaren Vale, Australia 14.5% alcohol. This is a a lovely fresh, full Cabernet Sauvignon with juicy berry fruits and hints of tar and spice. It has a blackcurrant core and also some bright red fruits. Lovely freshness allied to density of fruit, showing how good Cabernet can be in this region. Could age nicely, too. Harmonious and pure. 93/100
Find these wines with wine-searcher.com
from jamie goode's wine blog http://www.wineanorak.com:/wineblog/australia/wines-from-chapel-hill-mclaren-vale For Fine Wine Investment opportunities check out Twelve by Seventy Five: http://www.twelve-by-seventy-five.com/
0 notes
jeniferdlanceau · 7 years
Text
MAD's mountain-shaped tower complex nears completion in Beijing
New images by photographer Edmon Leong offer a first look at the nearly completed glass volumes of MAD's Chaoyang Park Plaza – a commercial and residential complex based on rock formations in Beijing.
MAD's 120,000-square-metre complex of skyscrapers, office blocks and public spaces is located in Beijing's central business district, which sits on the southern edge of Chaoyang Park – one of the largest parks in the city.
In building Chaoyang Park Plaza, the architects intended to create a "city landscape" by referencing the lakes, mountains and stones depicted in traditional Chinese shan shui scenic paintings.
The project is modelled on Shanshui City, the architectural model created by MAD's founder Ma Yansong for an urban development in Guiyang, China. Yansong's vision is intended to rethink how cities and their inhabitants can reconnect with the natural world.
Construction started on the project in 2012 – with the main focus being a pair of asymmetrical 120-metre tall skyscrapers modelled on the natural shapes of rock formations.
"Ridges and valleys define the shape of the exterior glass facade, as if the natural forces of erosion wore down the tower into a few thin lines," said the architects. 
Leong's images capture these bulges and "valleys" of the irregularly-shaped towers, intended to evoke a sense of nature within the cosmopolitan environment.
The irregular silhouettes of the two towers depicted by Leong, are formed from multi-level terraces populated by public gardens where people can look out over the city.
The ridges are embedded with sustainable technologies, using internal ventilation and filtration systems to draw the natural breeze indoors.
MAD's combination of natural lighting, intelligent building and air purification earned the project a gold LEED certificate – one of the highest ratings of the US sustainability rating system.
Echoing the curving forms of the skyscrapers, four geometric, plant-covered office buildings located to the south of the towers are intended to resemble "river stones that have been eroded over a long period".
A 17-metre-high glass lobby creates a transitional area between the two towers – sounds of flowing water are played throughout the connecting space to "make the lobby feel like a natural scene from a mountain valley," said the studio.
The firm's concern with connecting the urban environment with nature is demonstrated by its use of greenery interspersed throughout the towers.
"Unlike typical urban-block developments that delineate the boundary between city and garden, [the] towers appear at the edge of the park as an organic part of the green adjacent space," said Ma Yansong in his book, MAD Works MAD Architects.
The Beijing-based studio has also recently completed its Fake Hills development – an apartment complex in Beihai, China, with an undulating roofline that accommodates tennis courts and swimming pools.
Related story
MAD's Fake Hills housing features topography-inspired roofline and massive hollows
Photography by Edmon Leong.
The post MAD's mountain-shaped tower complex nears completion in Beijing appeared first on Dezeen.
from RSSMix.com Mix ID 8217598 https://www.dezeen.com/2017/05/12/mad-chaoyang-park-plaza-nears-completion-photography-edmon-leong-beijing-china/
0 notes
juliandmouton30 · 7 years
Text
MAD's mountain-shaped tower complex nears completion in Beijing
New images by photographer Edmon Leong offer a first look at the nearly completed glass volumes of MAD's Chaoyang Park Plaza – a commercial and residential complex based on rock formations in Beijing.
MAD's 120,000-square-metre complex of skyscrapers, office blocks and public spaces is located in Beijing's central business district, which sits on the southern edge of Chaoyang Park – one of the largest parks in the city.
In building Chaoyang Park Plaza, the architects intended to create a "city landscape" by referencing the lakes, mountains and stones depicted in traditional Chinese shan shui scenic paintings.
The project is modelled on Shanshui City, the architectural model created by MAD's founder Ma Yansong for an urban development in Guiyang, China. Yansong's vision is intended to rethink how cities and their inhabitants can reconnect with the natural world.
Construction started on the project in 2012 – with the main focus being a pair of asymmetrical 120-metre tall skyscrapers modelled on the natural shapes of rock formations.
"Ridges and valleys define the shape of the exterior glass facade, as if the natural forces of erosion wore down the tower into a few thin lines," said the architects. 
Leong's images capture these bulges and "valleys" of the irregularly-shaped towers, intended to evoke a sense of nature within the cosmopolitan environment.
The irregular silhouettes of the two towers depicted by Leong, are formed from multi-level terraces populated by public gardens where people can look out over the city.
The ridges are embedded with sustainable technologies, using internal ventilation and filtration systems to draw the natural breeze indoors.
MAD's combination of natural lighting, intelligent building and air purification earned the project a gold LEED certificate – one of the highest ratings of the US sustainability rating system.
Echoing the curving forms of the skyscrapers, four geometric, plant-covered office buildings located to the south of the towers are intended to resemble "river stones that have been eroded over a long period".
A 17-metre-high glass lobby creates a transitional area between the two towers – sounds of flowing water are played throughout the connecting space to "make the lobby feel like a natural scene from a mountain valley," said the studio.
The firm's concern with connecting the urban environment with nature is demonstrated by its use of greenery interspersed throughout the towers.
"Unlike typical urban-block developments that delineate the boundary between city and garden, [the] towers appear at the edge of the park as an organic part of the green adjacent space," said Ma Yansong in his book, MAD Works MAD Architects.
The Beijing-based studio has also recently completed its Fake Hills development – an apartment complex in Beihai, China, with an undulating roofline that accommodates tennis courts and swimming pools.
Related story
MAD's Fake Hills housing features topography-inspired roofline and massive hollows
Photography by Edmon Leong.
The post MAD's mountain-shaped tower complex nears completion in Beijing appeared first on Dezeen.
from ifttt-furniture https://www.dezeen.com/2017/05/12/mad-chaoyang-park-plaza-nears-completion-photography-edmon-leong-beijing-china/
0 notes