#Augusta Computer Experts

[dbl07]

Local Store Returns Liquidations in the Atlanta Area

Local Store Returns Liquidations in the Atlanta Area The Bin Store Pallets & Truckloads is a premier team of store returns liquidators, auctioneers, marketing experts, and other industry professionals working together to design custom store returns liquidations for clients in the Atlanta area. Our comprehensive services include auction and sale design, management, marketing, and the liquidation and sale of returned merchandise across all categories. We offer full-service and self-service options, as well as everything in between, to cater to your needs. As a client of The Bin Store Pallets & Truckloads in Atlanta, GA, you can choose to be as involved or as hands-off as you prefer. We are here to assist YOU in every possible way. The Bin Store Pallets & Truckloads lists all our store returns liquidations in the Atlanta area on the LocalAuctions.com family of sites to effectively market and sell your store returned merchandise to the right buyers. This approach allows us to achieve better recovery values for our clients. If you are interested in exploring how The Bin Store Pallets & Truckloads can help you or your organization with your store returns liquidation needs in and around the Atlanta area, contact us today to learn more! The Bin Store Pallets & Truckloads 4304 Sudan Drive Augusta GA 30907 (803) 226-3351 https://www.google.com/maps?cid=16132169506052587589 https://www.facebook.com/binstorepallets We Liquidate Store Returns Throughout Atlanta Furniture The Bin Store Pallets & Truckloads in Atlanta, GA, can design a liquidation sale for your returned furniture, including sofas, tables, beds, and more. Kitchen Appliances We regularly sell returned kitchen appliances of all makes and sizes, helping you sell yours anywhere in and around Atlanta. Electronics From home electronics like TVs and laptops to commercial computers and IT equipment, we can sell your store returns in the Atlanta area. Sporting Goods Let us help you sell your store returned sporting goods in Atlanta via a local online liquidation sale. Outdoor & Patio Do you have returned patio furniture, garden tools, or accessories in the Atlanta area? We can sell your returned outdoor items fast. Building Supplies Building materials are one of the most returned item categories. Let The Bin Store Pallets & Truckloads in Atlanta design a program to sell yours. Tools & Equipment Tools and equipment are always in high demand. We can help sell your returned tools and equipment in and around Atlanta for top dollar. Automotive Automotive returns can be challenging to sell due to the uniqueness of the items. We can find you the right buyers in the Atlanta area. Bicycles & Scooters Bikes are returned quite often because they can't be test-driven in the store. We can liquidate your returned bikes in Atlanta hassle-free. Home Improvement We have sold more returned home improvement items than almost any other liquidator in Atlanta. Let us help sell yours. Home Goods & Decor Custom-designed liquidation sales are necessary for returned home good items in the Atlanta area due to their fragility and uniqueness. Bed & Bath Bed and bath items are another frequently returned category. We can liquidate your returns anywhere in the Atlanta area. Shoes & Clothing Apparel is one of the top returned categories in Atlanta. Every retailer needs a liquidation strategy custom to their needs. Health & Beauty Supply Returned health and beauty products can be difficult to sell. Let the team at The Bin Store Pallets & Truckloads sell your returns anywhere in Atlanta. Children & Baby Items From children's toys and games to infant clothing and baby products, we can sell your returned items in the Atlanta area to local buyers. And Much More There is nothing we can't help you sell in Atlanta. Contact The Bin Store Pallets & Truckloads for a free returns liquidation consultation. Find Out How We Can Help You Sell Your Store Returns Why Choose The Bin Store Pallets & Truckloads for Your Store Returns Liquidations? - Fastest Turnaround Times in the Industry Our team of store returns liquidation experts can liquidate entire inventories in Atlanta in as little as one week from start to finish! - Custom Designed Liquidation Sales Every store returns liquidation sale we conduct in the Atlanta area is designed around our client's needs, goals, budget, and timeframe. - Custom Marketing for Every Sale Every sale is unique, which is why you need a custom marketing plan for your store returns sales in Atlanta. - We Handle All the Labor & Heavy Lifting We offer full-service store returns liquidation management in Atlanta, including photos, listings, collections, and removal. Atlanta Area Store Returns Liquidation Services The Bin Store Pallets & Truckloads is a full-service store returns liquidator in Atlanta, GA, specializing in local onsite liquidation sales across the state. We conduct auctions, liquidation sales, and buyouts for clients ranging from Fortune 500 companies and large corporations to small businesses and private individuals. We manage 15 different local liquidation marketplaces in the Atlanta area to help you sell assets in all categories and value levels. Whether you are looking to sell an entire warehouse full of returns or a single liquidation pallet near the Atlanta area, The Bin Store Pallets & Truckloads has a solution to fit your needs. The Bin Store Pallets & Truckloads provides store returns liquidation services in Atlanta, Roswell, Smyrna, Alpharetta, Sandy Springs, Mableton, Canton, Johns Creek, Vinings, Duluth, Norcross, Dunwoody, Peachtree Corners, Hiram, College Park, East Point, Decatur, Brookhaven, Marietta, Kennesaw, East Cobb, Douglasville, McDonough, Snellville, Morrow, Fayetteville, Riverdale, Lawrenceville, and the surrounding areas. If you have store returns in the Atlanta area you need to sell, give The Bin Store Pallets & Truckloads a call today. No matter what you need sold, we have the perfect liquidation site to list your items. The Bin Store Pallets & Truckloads can help you sell your items in Atlanta on our 15 local liquidation sites. Looking to buy store returns near Atlanta? Contact The Bin Store Pallets & Truckloads today! Is there a specific category of returned merchandise you want to focus on for your next liquidation sale? Read the full article

[trantergrey]

Transforming Your Online Presence with Web Design in Augusta, GA

In today's digital age, your website is often the first impression that potential customers have of your business. That's why it's essential to have a website that not only looks great but also functions seamlessly and effectively communicates your brand's message. At Tranter Grey, we specialize in helping businesses in Augusta, Georgia, stand out online with our expert web design services.

Crafting Visually Stunning Websites

Your website is your online storefront, and first impressions matter. That's why our team of experienced web designers at Tranter Grey focuses on creating visually stunning websites that captivate visitors from the moment they arrive. Whether you're looking for a sleek and modern design or something more traditional and elegant, we'll work with you to bring your vision to life.

User Experience is Key

In addition to looking great, your website also needs to function seamlessly. That's why user experience (UX) is at the forefront of our web design process at Tranter Grey. We ensure that your website is easy to navigate, loads quickly, and provides users with the information they need in a clear and intuitive manner.

Mobile Responsive Design

With more and more people accessing the internet on mobile devices, having a mobile-responsive website is no longer optional—it's essential. At Tranter Grey, we design all of our websites to be fully responsive, ensuring that they look and perform flawlessly on devices of all sizes, from smartphones to tablets to desktop computers.

Search Engine Optimization Services

Having a great website is only half the battle. If potential customers can't find you online, it's all for naught. That's why all of our websites at Tranter Grey are built with search engine optimization (SEO) in mind. We optimize your website's code, structure, and content to ensure that it ranks highly in search engine results pages (SERPs) and drives organic traffic to your site.

Partner with Tranter Grey for Web Design Excellence

Ready to take your online presence to the next level? Partner with Tranter Grey, the premier choice for web design in Augusta, GA, and let us help you create a website that not only looks great but also drives results for your business. Contact us today to learn more about our services and start building your dream website.

Conclusion

In summary, Tranter Grey is your trusted partner for web design in Augusta, GA. Our team of experienced designers focuses on creating visually stunning websites that not only look great but also function seamlessly and effectively communicate your brand's message. With our mobile-responsive designs, user-friendly interfaces, and search engine optimization (SEO) expertise, we help businesses stand out online and drive results. Partner with Tranter Grey today and make your mark online with a website that leaves a lasting impression.

[gamingsimulator]

A Beginner's Guide to Golf Simulators

If you are passionate about golf and want to improve your game, then a golf simulator might be what you need to take your skills to the next level without leaving the comfort of your home. A golf simulator is a high-tech system that uses video and computer software to simulate the experience of playing golf in an indoor setting. With a golf simulator, you can practice your swing, improve your technique, and play a round of golf on a virtual course anytime, anywhere.

A golf simulator typically consists of three main components: a hitting screen or net, a projector or display, and a computer or software program. The hitting screen or net acts as a backdrop for hitting real golf balls or specially designed foam balls. Whenputting turf projector or display projects a high-quality image of the golf course onto the hitting screen or net, while the computer or software program tracks the ball's trajectory and provides real-time feedback on factors such as ball speed, spin rate, launch angle, and distance.

One of the biggest advantages of a golf simulator is its convenience. With a simulator, you can practice your swing and play a round of golf no matter what the weather is like outside. Additionally, you can save time and money that you might otherwise spend traveling to a golf course or driving range. Moreover, you can customize the conditions of your practice sessions, such as adjusting the wind speed, temperature, and humidity, to suit your preferences and needs. Learn more about golfs at http://www.ehow.com/how_2077767_play-golf-alone.html.

Another benefit of a golf simulator is its versatility. Most golf simulators offer a wide range of features and options that can be customized to suit your skill level and playing style. Some simulators even allow you to play on famous courses such as Pebble Beach, Augusta National, and St. Andrews. Additionally, some simulators provide coaching or instructional programs that can help you improve your swing and analyze your performance to identify areas for improvement.

While a golf simulator is a valuable investment for serious golfers, it can be costly, with prices ranging from a few thousand dollars to tens of thousands of dollars. Therefore, it's important to do your research and invest in a system that meets your needs and budget. Factors to consider when buying a golf simulator include the quality of its components, the accuracy of its measurements, the software and course options, and the customer service and support provided by the manufacturer or vendor.

An indoor golf simulator is an excellent tool for golfers who want to enhance their skills and practice in an indoor setting. Its convenience, versatility, and customization options make it an attractive alternative to traditional outdoor golfing. However, investing in a golf simulator requires careful consideration of its features, performance, and cost. Therefore, it's vital to do your homework, seek expert advice, and choose a system that suits your goals and budget.

[ericvanderburg]

Computer security expert explains Augusta's problems after cyberattack

http://i.securitythinkingcap.com/SqKv3m

[wichitahaulingjunkmoving]

How To Dispose Of Furniture When Moving in Wichita KS | Wichita Hauling Junk & Moving More information is at: https://junkremovalhaulerwichita.org/how-to-dispose-of-furniture-when-moving-near-me/

How To Dispose Of Furniture When Moving: Need to get rid of an old unwanted sofa, chair or piece of furniture? You didn't work your way to the top of the food chain to mess with something like this. Wichita Hauling Junk & Moving has been specializing in all types of old furniture removal and junk furniture disposal since we opened in Wichita in 2001. Cost of furniture removal? Free estimates! Call today or schedule online fast! Best junk removal and hauling company in Wichita KS!

REQUEST A QUOTE NOW! CONTACT US!

HOW TO DISPOSE OF FURNITURE WHEN MOVING IN WICHITA KS

Furniture Removal Service From Wichita Hauling Junk & Moving

Need to get rid of an old unwanted sofa, chair or piece of furniture? You didn’t work your way to the top of the food chain to mess with something like this. Wichita Hauling Junk & Moving has been specializing in all types of furniture removal since we opened in Wichita in 2001. We have furniture removal jobs on our schedule every single day and it’s one of the most popular requests for our service. HOW IT WORKS – FURNITURE DISPOSAL PROCESS Simply book a convenient appointment on-line or call us at . We’ll send out our Furniture Removal Experts who will call you 60 minutes before arriving to let you know we are on the way. We’ll give you a Free No Obligation Estimate and we come ready to haul.

• All you have to do is point the unwanted junk furniture • We do everything. All the lifting and loading • It takes less than 30 minutes • We’ll safely haul it out of wherever it is • Clean up the area • Properly dispose of it and recycle everything we can WICHITA HAULING JUNK & MOVING is a locally owned business and not a franchise. We proudly serve only Wichita and the surrounding communities. We pride ourselves on delivering outstanding customer service and a great value. As of 2018 we have completed over 3,000 jobs in the last 10 years and over 50% of our business is repeat. We want to make you a customer for life.

GET MORE INFORMATION ABOUT OR FURNITURE HAUL AWAY SERVICE – CLICK HERE

We also offer: • Appliance Removal • Cardboard Boxes Removal and Recycling • Carpet Removal • Computer Monitor Removal • Computer Removal • Electronics Removal and Recycling • Estate Clean Out • Garage Clean Out • Hot Tub Removal • Household Junk Clean Out • Mattress Removal • Office Clean Out • Old Shed Tear Down and Removal • Printer Removal • Refrigerator Removal • Remodel Debris Removal • Renovation Debris Removal • Sofa Removal • Storage Locker Clean Out • TV Disposal & Recycling • House Cleanout • Apartment Cleanout • Garage Cleanout • Storage Unit Cleanout • Property Cleanout • Yard Cleanup

REQUEST MORE INFORMATION AND FREE QUOTE ABOUT OUR FURNITURE REMOVAL SERVICE - CLICK HERE

5 WAYS TO GET RID OF LARGE FURNITURE BEFORE MOVING

The expensive and headache of moving large furniture is often not worth it. You should try to get rid of it, by selling it or giving it away before you have to move. You may be able to haul it to the landfill, but that should be your last resort if you don’t have any other options. Here are just a few ways that you can get rid of it:

1 – Try to Sell it

There are buyers who wouldn’t mind moving your large furniture for you if you offer them a good deal. You may have to charge much lower than you paid for it, because the buyer may have to hire a truck to move it. Keep tabs on local prices for used furniture, specifically what they go for at moving and garage sales and on Craigslist.com. Don’t price your furniture above those prices. It may seem as if you’re losing money, but you have to factor in the cost to move it if you don’t sell it.

2 – Give it to A Friend

If you’re not able to find a buyer, then you may be able to find a friend wiling to take large furniture off your hands. Tell all of your friends about the move and the need to get rid of the furniture. Take a picture of it and send it in a mass email to your list of friends, so that they can decide if they’d like to look into it further. You may need to help them load it on a truck, but it’s a more convenient option than transporting it your new apartment, and finding help to unload it or hiring a professional mover to do it for you.

3 – Donate it to Charity

Some non-profit organizations would be happy to pick up your large furniture for you, as long as it’s in good condition. These organizations will either sell it to the public and use the money to help fund their programs and services, or keep it for the organization’s use. To find one in your area with a pickup service, you need to check your yellow pages or search for one on the Internet. Organizations often post rules for pick up services on their websites, which may require you to call and set up an appointment.

4 – Offer it on Freecycle.org

You may be able to find someone to pick up your furniture on Freecycle.org. It’s a free service where members offer household and other items for free, and interested members can pick those items up. If you’re not a member, you’ll have to submit a form in your city to become a member. It’s a Yahoo! group, and you may have to wait a few days to get a response back from the moderator to gain access to the group.

5 – CALL Number one Junk Removal Company in Wichita KS: Wichita Hauling Junk & Moving

CONTACT: Wichita Hauling Junk & Moving Best Junk Removal & Hauling Service in Wichita Wichita KS

It may take time to get rid of large furniture, so don’t wait until the last minute. The sooner you work to sell or donate it, the better off you’ll be.

#1 FURNITURE REMOVAL COMPANY IN WICHITA KS WICHITA HAULING JUNK & MOVING REQUEST MORE INFORMATION. CLICK HERE CONTACT US: Wichita Hauling Junk & Moving CALL (316) 500-7551 CLEANING CALL (316) 448-5733 JUNK REMOVAL & MOVING CALL (316) 448-3974 HANDYMAN Best Junk Removal Hauling Company in Wichita, KS Open Monday to Sunday 7 Am – 11 PM Located in Wichita, KS 67211 WEB: https://junkremovalhaulerwichita.org/

SERVICE AREA: 55 Cities within 30 miles of Wichita, KS:  Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KSColwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven 68116, 68117, 68118, 68122, 68124, 68127, 68130, 68131, 68132, 68134, 68135, 68137, 68142, 68144, 68147, 68152, 68154, 68157, 68164, 68178 #junkremoval #haulingservice #handyman #moving #Wichita #Kasnas #residencialjunkservic #commercialjunk #officejunkremoval

OUR SISTER COMPANIES IN WICHITA KS: WICHITA HAULING JUNK & MOVING (316) 448-5733 https://junkremovalhaulerwichita.org/

WICHITA JUNK DISPOSAL (316) 448-5146 http://wichitajunkdisposal.com

JUNK REMOVAL SERVICES OF WICHITA (316) 448-5089 http://junkremovalservicesofwichita.com

PRICE JUNK REMOVAL WICHITA (316) 448-5733 http://pricejunkremovalwichita.com

AONE JUNK REMOVAL OF WICHITA (316) 448-5146 http://ajunkremovalwichita.com

WICHITA JUNK REMOVAL COMPANY (316) 448-5733 http://wichitajunkremovalservice.com

MR JUNK REMOVAL OF WICHITA (316) 448-5733 http://mrjunkremovalofwichita.com

ACTION JUNK REMOVAL OF WICHITA (316) 448-5146 http://cheapjunkremovalwichitaks.com

JUNK REMOVAL PROS WICHITA (316) 448-5089 http://wichitajunkremovalcompany.com

AFFORDABLE JUNK REMOVAL WICHITA (316) 448-5146 http://cheaphaulerwichita.com

ECONOMY JUNK REMOVAL WICHITA (316) 448-5089 http://cheapdumpsterrentalwichita.com

[mexcexchangenews]

MEXC Research: Cardano (ADA), The Public Chain for Smart Contract will be Launched Soon

Cardano (ADA)

Cardano, similar to Ethereum, is a smart contract platform committed to becoming a new generation of lower-level basic public chains that are more convenient, faster and smarter, and completely open-source. The founder, Charles Hoskinson was also one of the co-founders of Ethereum. At present, the development progress of Cardano is a smart contract platform, which is called the first blockchain project “driven by scientific philosophy and research”, and its development team is composed of a large number of expert engineers and researchers from around the world. Cardano adopts PoS consensus mechanism that does not require mining and an Ouroboros consensus algorithm.

There are three main official participants in the Cardano project: the Cardano Foundation, Cardano’scommercial incubation company Emurgo and the technology development company IOHK. The Cardano Foundation will promote Cardano to a broader community, popularize cryptocurrency knowledge, and excel in regulatory communication. IOHK is the engineering and code development organization behind Cardano technology. Emurgo is committed to integrating the platform with businesses.

Cardano Foundation

Cardano is operated by a non-profit company called the Cardano Foundation. The foundation provides multiple development directions for Cardano and the whole blockchain business. They are committed to extend Cardano to wider communities, popularizing cryptocurrency, and communicate with the government for supervision. The foundation provides a standard framework to promote cooperation between enterprises. The service is similar to the Enterprise Ethereum Alliance (EEA) of the Ethereum network and NEO’s partner Onchain. Even though it is not a non-profit organization, it can also connect the public blockchain with the government and enterprises. Blockchain platforms such as NEO, ETH and Cardano are distributed. They provide a centralized publishing organization for enterprises, just like the publishing house of the platform.

Input Output Hong Kong（IOHK） (Technical Support)

IOHK is an academic institution that provides solutions for enterprises and governments to develop blockchains. The agency is led by Charles Hoskins and Jeremy wood, former CEO and executive assistant of ETH.

Among the three institutions behind ADA, IOHK is the most relevant entity of the project, led by Charles Hoskinson and Jeremy Wood. Charles first co-founded Invictus Innovations company, which issued BitShares, and then moved to Ethereum as the CEO! At present, he is the CEO of IOHK! Jeremy used to be an executive assistant of Ethereum. He also worked as a CSO in IOHK for nearly three years.

IOHK supports Cardano and has 17 research teams. These teams have been responsible for the development of Cardano’s technology and digital wallet. IOHK also supports other blockchain projects, including Ethereum Classic.

Emurgo

Emurgo, based in Japan, helps existing enterprises and invests in related industries by integrating blockchain technology to connect businesses to the Cardano blockchain. IOHK, Cardano Foundation and Emurgo have a clear division of labor and are associated with each other.

Layered Technology

In short, the information that Bitcoin can support is general value transfer data, such as the transfer parties, transfer time and transfer amount. Ethereum, the second generation blockchain, supports more information, such as transfer conditions, reasons, entities involved, etc., which are metadata. Ethereum refers to the connection between actual value transfer and associated metadata as smart contracts, which are programmable contracts.

However, for Ethereum, since there is no separation between settlement and calculation, these information is stored together, regardless of whether metadata needs to be included all the time. The more data in each transaction, the higher the cost, and the more difficult it is for the blockchain to store the information.

Cardano separates transfer and information \. They separate the platform by dividing it into two different layers:

Cardano Settlement Layer (CSL): It is responsible for the token economy and the balance of all user accounts. Cardano’s native token ADA trades through this layer.

Cardano Computation Layer (CCL): Smart contract functions are in this layer and support regulatory elements such as digital identity.

The block reward will be issued every 3.5 minutes. The distribution frequency is as follows: initially, 2,000 ADA tokens will be generated for each block, with a total of 37,44,961 blocks; In the second stage, each block produces 1000 ADA tokens, totaling 37,44,961 blocks; In the third stage, each block produced 500 ADA coins, a total of 37,44,961 blocks. By analogy, it will take about 24 years to halve each block of 37,44,961 and produce three blocks per minute until all of them are released. 75% of the ADA coins generated in each block are used as the reward of the holders, and 25% are used as the reward for technology development and ecosystem builders after the project is launched. As long as users participate in the R & D and development of Cardano application, they may be rewarded.

Development Roadmap

According to Cardano roadmap, the development stages of Cardano network mainly include the following five stages:

Byron: The guidance phase allows users to trade and transfer ADA tokens.

Shelly: The decentralized stage where it becomes a completely decentralized network.

Goguen: Develop and integrate the smart contract platform in the smart contract stage. (Will be launched soon)

Basho: The scalability phase where the smart contract is improved to increase performance, security and scalability.

Voltaire: The governance stage where IOHK introduces a financial system and governance to ensure the long-term development of communities and projects.

Tokenomics

Token: ADA (ADA is named after Augusta Ada King-Noel: A mathematician in the 19th Century, who was recognized at the first computer programmer and the daughter of a poet named Byron)

Total: 45 billion tokens（Ranked 5th for current market value）

Current circulation: 32,066,390,668tokens（Data sourced from CoinGecko on August 2）

Public Sale: 57.6%, 25927 million tokens, Completed

Ecosystem Support (IOHK, Emurg0, Cardano Foundation): 11.5% , 5185 million tokens

Mining: 30.9% ,13.887 billion

Practical Analysis

Practical Value

Becoming the nodes

Staking Mining

Participate in node election voting

On-chain transaction fees

Possible existing challenges

There is still a big gap between the development progress and the full realization of technology

Ecosystem competition

ADA’s ecosystem domain

Cardano (ADA)

Cardano, similar to Ethereum, is a smart contract platform committed to becoming a new generation of lower-level basic public chains that are more convenient, faster and smarter, and completely open-source. The founder, Charles Hoskinson was also one of the co-founders of Ethereum. At present, the development progress of Cardano is a smart contract platform, which is called the first blockchain project “driven by scientific philosophy and research”, and its development team is composed of a large number of expert engineers and researchers from around the world. Cardano adopts PoS consensus mechanism that does not require mining and an Ouroboros consensus algorithm.

There are three main official participants in the Cardano project: the Cardano Foundation, Cardano’scommercial incubation company Emurgo and the technology development company IOHK. The Cardano Foundation will promote Cardano to a broader community, popularize cryptocurrency knowledge, and excel in regulatory communication. IOHK is the engineering and code development organization behind Cardano technology. Emurgo is committed to integrating the platform with businesses.

Cardano Foundation

Cardano is operated by a non-profit company called the Cardano Foundation. The foundation provides multiple development directions for Cardano and the whole blockchain business. They are committed to extend Cardano to wider communities, popularizing cryptocurrency, and communicate with the government for supervision. The foundation provides a standard framework to promote cooperation between enterprises. The service is similar to the Enterprise Ethereum Alliance (EEA) of the Ethereum network and NEO’s partner Onchain. Even though it is not a non-profit organization, it can also connect the public blockchain with the government and enterprises. Blockchain platforms such as NEO, ETH and Cardano are distributed. They provide a centralized publishing organization for enterprises, just like the publishing house of the platform.

Input Output Hong Kong（IOHK） (Technical Support)

IOHK is an academic institution that provides solutions for enterprises and governments to develop blockchains. The agency is led by Charles Hoskins and Jeremy wood, former CEO and executive assistant of ETH.

Among the three institutions behind ADA, IOHK is the most relevant entity of the project, led by Charles Hoskinson and Jeremy Wood. Charles first co-founded Invictus Innovations company, which issued BitShares, and then moved to Ethereum as the CEO! At present, he is the CEO of IOHK! Jeremy used to be an executive assistant of Ethereum. He also worked as a CSO in IOHK for nearly three years.

IOHK supports Cardano and has 17 research teams. These teams have been responsible for the development of Cardano’s technology and digital wallet. IOHK also supports other blockchain projects, including Ethereum Classic.

Emurgo

Emurgo, based in Japan, helps existing enterprises and invests in related industries by integrating blockchain technology to connect businesses to the Cardano blockchain. IOHK, Cardano Foundation and Emurgo have a clear division of labor and are associated with each other.

Layered Technology

In short, the information that Bitcoin can support is general value transfer data, such as the transfer parties, transfer time and transfer amount. Ethereum, the second generation blockchain, supports more information, such as transfer conditions, reasons, entities involved, etc., which are metadata. Ethereum refers to the connection between actual value transfer and associated metadata as smart contracts, which are programmable contracts.

However, for Ethereum, since there is no separation between settlement and calculation, these information is stored together, regardless of whether metadata needs to be included all the time. The more data in each transaction, the higher the cost, and the more difficult it is for the blockchain to store the information.

Cardano separates transfer and information \. They separate the platform by dividing it into two different layers:

Cardano Settlement Layer (CSL): It is responsible for the token economy and the balance of all user accounts. Cardano’s native token ADA trades through this layer.

Cardano Computation Layer (CCL): Smart contract functions are in this layer and support regulatory elements such as digital identity.

The block reward will be issued every 3.5 minutes. The distribution frequency is as follows: initially, 2,000 ADA tokens will be generated for each block, with a total of 37,44,961 blocks; In the second stage, each block produces 1000 ADA tokens, totaling 37,44,961 blocks; In the third stage, each block produced 500 ADA coins, a total of 37,44,961 blocks. By analogy, it will take about 24 years to halve each block of 37,44,961 and produce three blocks per minute until all of them are released. 75% of the ADA coins generated in each block are used as the reward of the holders, and 25% are used as the reward for technology development and ecosystem builders after the project is launched. As long as users participate in the R & D and development of Cardano application, they may be rewarded.

Development Roadmap

According to Cardano roadmap, the development stages of Cardano network mainly include the following five stages:

Byron: The guidance phase allows users to trade and transfer ADA tokens.

Shelly: The decentralized stage where it becomes a completely decentralized network.

Goguen: Develop and integrate the smart contract platform in the smart contract stage. (Will be launched soon)

Basho: The scalability phase where the smart contract is improved to increase performance, security and scalability.

Voltaire: The governance stage where IOHK introduces a financial system and governance to ensure the long-term development of communities and projects.

Tokenomics

Token: ADA (ADA is named after Augusta Ada King-Noel: A mathematician in the 19th Century, who was recognized at the first computer programmer and the daughter of a poet named Byron)

Total: 45 billion tokens（Ranked 5th for current market value）

Current circulation: 32,066,390,668tokens（Data sourced from CoinGecko on August 2）

Public Sale: 57.6%, 25927 million tokens, Completed

Ecosystem Support (IOHK, Emurg0, Cardano Foundation): 11.5% , 5185 million tokens

Mining: 30.9% ,13.887 billion

Practical Analysis

Practical Value

Becoming the nodes

Staking Mining

Participate in node election voting

On-chain transaction fees

Possible existing challenges

There is still a big gap between the development progress and the full realization of technology

Ecosystem competition

ADA’s ecosystem domain

Partial Ecosystem Projects

IDO Platform

CardStarter

Token: CARDS

CardStarter was launched on March 29, with a focus on becoming the Launchpad and incubator of the Cardano network. It is planned to introduce a decentralized trading platform and AMM, namely CardSwap, in the third quarter. CardStarter sets up a hierarchical system through its token CARD, and token holders obtain the corresponding proportion of investment quota according to the amount pledged.

At present, CardStarter is deployed on Ethereum, and then migrated after the smart contract platform is deployed in Cardano. At the same time, CardStarter stated that all projects supported by CardStarter are ready to be launched on Cardano’s website.

Occam.fi

Token: OCC

Occam.fi is the smart DeFi layer under the Cardano ecosystem. It is mainly composed of three components: Launchpad platform OccamRazer, decentralized exchange OccamX and governance layer OccamDAO, OccamRazer as the main component.

Occam.fi has deployed OccamRazer on Ethereum in mid-April and will deploy OccamX and OccamRazer to the Cardano mainnet. OccamRazer allows the project to raise funds in various ways, including fixed-price mechanism, dynamic rise or fall mechanism, IDO joint curve mechanism, auction, etc. Besides, it also sets up a hierarchical system for users participating in IDO according to the amount of OCC staked.

TrustPad

Token: TPAD

Trustpad is a decentralized multichain IDO platform, including supporting coin security smart chains, Ethereum, Solana and Cardano. It aims to help project parties to raise funds and help early investors screen relatively safe investment opportunities.

DEX and Liquidity Protocol

Adax

Token: ADAX

Adax aims to become a DeFi solution in the Cardano ecosystem. It will introduce a DEX protocol that can provide token exchange and NFT transaction functions. Among them, the DEX protocol will be based on the AMM model. Adax plans to officially launch its platform after the launch of Cardano smart contract in the third quarter of this year, integrate IOHK ERC20 bridge and support cross-chain in the first quarter of next year.

deFIRE

Token: CWAP

deFIRE is a DeFi platform designed for the Cardano ecosystem. It provides execution services and order routing services for DEX token transactions and provides intermediary services between order flow initiators (such as wallets) and final execution platforms (such as DEX).

DeFinity Network

Token: DEFX

DeFinity Network is jointly launched by DMALINK, a foreign exchange dealer, and WeOwn, a technology company focusing on blockchain services. It claims to be a decentralized trading solution suitable for foreign exchange market, digital currency and central bank digital currency. DeFinity uses existing frameworks (including WeOwn, Ethereum, Polkadot, Binance Smart Chain BSC and Cardano) to build a decentralized ecosystem with interoperability. IDO was previously conducted on CardStarter and Occam. According to the roadmap, the project will launch its DEX platform in 2022.

Orion Protocol

Token: ORN

Orion Protocol is a liquidity aggregation protocol that will aggregate each CEX, DEX and exchange pools into a decentralized trading platform. It is committed to find solutions to the fragmentation of assets in the cryptocurrency market, NFTs market and traditional finance and gather them into one place.

Orion Protocol and Cardano development company IOHK reached cooperation in April this year and will become Cardano’s liquidity aggregator.

NFT

ADAZOO

NFT Token: LACIE

Virtual Land Token: LAND

ADAZOO hopes to build an NFT game based on Cardano, with its NFT collection, LACIE. Users holding LACIE are eligible to participate in the game. Players can get more LACIE rewards and continuously upgrade their roles during the game. In addition, players can also buy the virtual land token, LAND, and LAND holders can earn income from each transaction in their territory. ADAZOO aims to be one of the first NFT-based games running on the Cardano blockchain.

Bondly

Token: BONDLY

Bondly is designed to bring the first batch of certified digital goods to the sports, music, E-sports and collectibles markets. It also has NFT exchange platform NFTSwap, e-commerce gateway BProtect and other products supporting DeFi. Bondly Finance will be the first DeFi project on Cardano. On July 14 this year, Bondly was attacked. Bondly said that it would launch a secure multi-sign ERC20 contract for the revised Bondly token and provide the new token to the owner according to the snapshot taken before the incident.

CardanoSpace

CardanoSpace is a website that supports all users in creating websites. The website is a 100x100 grid website. Each cell in the grid is an NFT. The NFT holder can determine the image and message content displayed in its grid and add a link URL. Currently, CardanoSpace is selling the grid in batches.

CardanoTales

CardanoTales is the first to release a Cardano-based blockchain hybrid RPG (role-playing game). Playable items and characters in the game are tokenized as Cardano NFTs (CNFTs), obtained or recovered through activities and/or in-game battles, or in special events.

PlayerMint

Fungible Token: PMX

PlayerMint is a toolkit that can obtain revenue in the Metaverse. It consists of two types: fungible token and Non-fungible token (NFT). The fungible token PMX, as the toolkit asset, can be obtained through game performance. The NFT is minted or traded by players with PMX, and the metadata will be stored in IPFS and Arweave. The protocol will be deployed in game environments such as Fortnite and social environments such as Discord or Twitch.

Oracles

Charli3

Token: C3

Charli3 is the first decentralized Oracle project built on the Cardano network. The system verification functions include multi Oracle node consensus, forced node staking using native tokens, anti-Sybil attack, etc. Charli3 announced that DEXTools price data will be integrated.

Lending Protocol

Aada

Token: AADA

Aada is the first decentralized lending protocol based on Cardano, allowing users to deposit assets to earn interest or borrow assets. With the Cardano ERC20 converter (ERC cross-chain Cardano) launch, a large number of assets will easily enter the cheaper Cardano chain.

Aada is currently establishing a decentralized autonomous organization (DAO), and the platform fees will be allocated to AADA token holders. Aada will release the front-end MVP and release the beta version in this quarter.

Liqwid

Token: LQ

Liqwid is a decentralized lending protocol for the Cardano system. It establishes a decentralized market for lenders and borrowers to interact seamlessly by providing funds, minting interest-bearing qTokens, borrowing assets and participating in governance. Its solution is based on the Cardano UTXO model and is used to build secure and low-cost transactions. The Liqwid protocol aims to enable any liquidity provider or user to obtain interest and liquidity on demand and enable developers to use a Web3 world of open financial applications.

Others

SoMee

Token: SOMEE

SoMee is a social media platform focusing on privacy, freedom of speech and security. Users can earn rewards by publishing content, comments by liking and sharing. SoMee will also add short videos for posting, video calls and other functions later. Its wallet, SoMee wallet will help users manage and track rewards, have built-in transaction functions. At present, SoMee has released a beta version and has been updated many times.

Somee also conducted IDO on CardStarter, which will be integrated on hive blockchain before the end of August, and then built on Cardano after Cardano smart contract is ready.

Ledgity

Token: LTY

Ledgity is a digital solution specially designed for financial consultants. The Cardano ecosystem connects crypto assets and DeFi investment solutions with traditional finance through an intuitive, secure and transparent financial service platform. Digital solutions provided by Ledgity include account aggregation tools, regulatory tools, CRM tools and communication channels.

ADA, OCC and ORN have been launched on the MEXC platform.

[wichitahouseholdservices]

Best Shop Cleaning Services and Costin Wichita KS| Wichita Household Services| More Information is at: http://wichitahouseholdservices.com/shop-cleaning-services-near-me/ Looking for the best Shop Cleaning ServicesNear Wichita KS? Wichita Household Services is the best cleaning services in and around Wichita KS. Cost of Shop Cleaning Services? Free estimates. Best Shop Cleaning Services inWichita KS.

REQUEST FREE QUOTE TODAY! SHOP CLEANING SERVICES Making the first right impression on your visitors in the shops is not an easy task. The quality of cleanliness provided by the shop cleaning services in Wichita KS will determine the branding for your store. As many of the business experts say, the cleanliness in your shops is directly proportional to the foot fall. Professional, stylish, attractive and spotless presentation of your shop can guarantee excellent results. With great knowledge and a decade of experience, WICHITA HOUSEHOLD SERVICES will be pleased to help you in achieving the desired cleanliness and hygiene for your shops in Wichita KS. We provide specialist services, daily cleaning, window cleaning, washroom cleaning services, waste management with much more. With flexible and bespoke shopping center cleaning Wichita KS, our fully-trained professionals can provide exceptional cleaning standards for your shops. We Serve The Following Clients in Wichita KS: At WICHITA HOUSEHOLD SERVICES, we create a positive impact on your business and buyer experience. Our shop cleaning services are specifically designed to achieve 100% customer satisfaction. Additionally, with a strict adherence to Health & Safety regulations as per the American government, we serve to the cleaning needs of the following and more.

● Fashion and style shops ● Electronics retailers ● Computer and mobile stores ● Furniture and upholstery stores ● Interior design and Decor stores ● Car Accessories and Parts stores ● Pet stores ● Music and recreation shops ● Supermarkets and hypermarkets ● Wine stores ● Sports and Merchandise stores ● Book and Literature Merchandise shops

Our Shop Cleaning Services: We provide the following services with the use of latest cutting-edge technology. With a strong focus on efficiency and effectiveness, we deliver quality with a hassle-free experience. Our staff works to minimise disruption to your buyers and staff, cleaning the following facilities and premises with great commitment.

● Entrances and exits ● Product display areas ● Staff sections ● Loading areas ● Cash collection and billing desks ● Shop front and floors ● Public utility areas ● Changing and trial rooms ● Car parks ● Windows, doors, and mirrors

Apart from the general cleaning services, we also specialise in Shop cleaning services Wichita KS and all the services in commercial cleaning Wichita KS. Call us for a comprehensive range of shop cleaning needs in Wichita KS

BEST SHOP CLEANING SERVICES IN WICHITA WICHITA HOUSEHOLD SERVICES REQUEST MORE INFORMATION.CLICK HERE

CONTACT US: Wichita Household Services We Offer Cleaning Junk Removal Movers Handyman Services Call: (316) 448-3558 SERVICE AREA: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – BelAire or Wichita | 67221 – McConnell AFB | 67226 – BelAire or Wichita | 67543 – Haven #Wichita #junkremoval #handyman #householdservice #movers #cleaning

[wichitacleaning12]

Best Shop Cleaning Services and Cost in Wichita KS | Wichita Cleaning Company

More information is at: http://bestcleaningserviceswichita.com/shop-cleaning-services-near-me/

Looking for the best Shop Cleaning Services Near Wichita KS? Wichita Cleaning Company is the best cleaning services in and around Wichita KS. Cost of Shop Cleaning Services? Free estimates. Best Shop Cleaning Services in Wichita KS.

REQUEST FREE QUOTE TODAY! SHOP CLEANING SERVICES Making the first right impression on your visitors in the shops is not an easy task. The quality of cleanliness provided by the shop cleaning services in Wichita KS will determine the branding for your store. As many of the business experts say, the cleanliness in your shops is directly proportional to the foot fall. Professional, stylish, attractive and spotless presentation of your shop can guarantee excellent results. With great knowledge and a decade of experience, WICHITA CLEANING COMPANY will be pleased to help you in achieving the desired cleanliness and hygiene for your shops in Wichita KS. We provide specialist services, daily cleaning, window cleaning, washroom cleaning services, waste management with much more. With flexible and bespoke shopping Centre cleaning Wichita KS, our fully-trained professionals can provide exceptional cleaning standards for your shops. We Serve The Following Clients in Wichita KS: At WICHITA CLEANING COMPANY, we create a positive impact on your business and buyer experience. Our shop cleaning services are specifically designed to achieve 100% customer satisfaction. Additionally, with a strict adherence to Health & Safety regulations as per the American government, we serve to the cleaning needs of the following and more.

● Fashion and style shops ● Electronics retailers ● Computer and mobile stores ● Furniture and upholstery stores ● Interior design and Decor stores ● Car Accessories and Parts stores ● Pet stores ● Music and recreation shops ● Supermarkets and hypermarkets ● Wine stores ● Sports and Merchandise stores ● Book and Literature Merchandise shops

Our Shop Cleaning Services: We provide the following services with the use of latest cutting-edge technology. With a strong focus on efficiency and effectiveness, we deliver quality with a hassle-free experience. Our staff works to minimise disruption to your buyers and staff, cleaning the following facilities and premises with great commitment.

● Entrances and exits ● Product display areas ● Staff sections ● Loading areas ● Cash collection and billing desks ● Shop front and floors ● Public utility areas ● Changing and trial rooms ● Car parks ● Windows, doors, and mirrors

Apart from the general cleaning services, we also specialise in Shop cleaning services Wichita KS and all the services in commercial cleaning Wichita KS. Call us for a comprehensive range of shop cleaning needs in Wichita KS

BEST SHOP CLEANING SERVICES IN WICHITA WICHITA CLEANING COMPANY REQUEST MORE INFORMATION.

CONTACT US: Wichita Cleaning Company Best commercial residential cleaning company in Wichita KS (316) 500-7551 CLEANING (316) 448-3974 HANDYMAN SERVICES OF WICHITA (316) 448-5733 WICHITA HAULING JUNK & MOVING Location: Wichita KS Monday-Sunday 7 am- 11 pm bestcleaningserviceswichita.com/ handymanserviceswichitakansas.com/ junkremovalhaulerwichita.org/ Service area; 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven #cleaning #moving #movers #junkremoval #handymanservice #hauling #Wichita #kanas

[mechanicswichita]

Truck Jumpstart Services in Wichita KS | A1 Mobile Mechanics Of Wichita

More information is at: http://mobilemechanicwichitakansas.org/truck-jumpstart-service-near-me/

Do you need a jump start in Wichita KS? Look no further and make Classic Towing your first choice for jump starts Wichita KS and nearby areas. Getting a fast, dependable jump start means choosing the right roadside assistance provider. A1 Mobile Mechanics Of Wichita is the right company with its professional, expert service and a reputable 20 year proven track record serving Wichita KS and nearby suburbs. We provide fast, affordable jump start service in Nebraska and anywhere else within a 35 mile radius. We can have a technician to jump start your car or semi-truck anywhere, in about 30 minutes or less. We have the equipment, expertise, and staff to handle any roadside assistance need, light, medium, or heavy duty, 24 hours-a-day, 7 days-a-week. Call today for jump start service Wichita KS! A1 Mobile Mechanics Of Wichita … we are always just around the corner.

REQUEST FREE QUOTE!

TRUCK JUMPSTART SERVICE When you call, A1 Mobile Mechanics Of Wichita team will get your location, type of vehicle; car, truck, semi-tractor trailer, RV, motor-home or coach and give you a low flat rate for a jump start. We will quickly dispatch an expert  who will first test the battery to ensure it has at least a 75% charge, then will do a load test which should be no lower than 9.1 volts. If the battery has 75% or better, he or she will jump start your car or replace your battery if a load test is below 9.1 volts. Even if further diagnosis is required, 24 Hour Mobile Mechanics have the computer diagnostic equipment and the experience to solve the issue and get you back on the road ASAP. You can rest easy knowing a qualified mobile mechanic is on the way whether you need a jump start service or battery replaced. Payment is made easy. 24 Hour Mobile Mechanics is here to help when you need it the most and will get you back on the road quickly. Remember, your battery is only there to start your vehicle. The alternator charges your battery and powers the electrical system while your car is running. And our roadside assistance also helps you to get back your vehicle on road as fast as possible. But for that you have to remember us in you need and we will be there in few moments. Because we are best towing services in Wichita KS. We provide A1 Services to their customers. CALL US FOR:-  Truck jumpstart service in Wichita KS  Truck jump start emergency  Truck jumpstart 24 hours services  Cheap Jumpstart services  Jumpstart service instant  Battery draining issues  Fast jumpstart BEST TRUCK JUMPSTART SERVICES IN WICHITA KS A1 MOBILE MECHANICS OF WICHITA REQUEST MORE INFORMATION HERE!

Contact us: A1 Mobile Mechanics of Wichita 24-hour mobile mechanic roadside assistance services in Wichita, KS! CALL: (316) 201-9247 MOBILE MECHANIC WEBSITE: www.mobilemechanicwichitakansas.org Service Area: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven

[augustacomputerexperts]

Augusta Computer Experts is the most trustworthy organization that you can call if you are in need of reasonable and Computer Networking Services

[wichitahaulingjunkmoving]

Full Service Junk Removal Wichita KS | Wichita Hauling Junk & Moving More information is at: https://junkremovalhaulerwichita.org/full-service-junk-removal-near-me/

Looking for a full service junk removal or hauling company in Wichita? Wichita Hauling Junk & Moving offer Full Service Junk Removal. Junk removal for your home or business including offices, retail locations, construction sites, and more. We proudly provide trash removal, junk removal, house cleanout, office cleanout, property cleanout, furniture removal, and appliance removal services to Wichita, Bellevue, Papillion, Elkhorn, Blair, Wichita residents. Cost of full service junk removal services? Free estimates! Call today book online or email us for a quick estimate!

REQUEST A FREE QUOTE NOW!

FULL SERVICE JUNK REMOVAL

THE BEST JUNK REMOVAL IN WICHITA Wichita Hauling Junk & Moving Full Service Junk Removal

From Wichita to Bellevue City, Wichita to Blair, Elkhorn to Fremont, if you have unwanted furniture to donate, appliances to recycle or junk that is cramping your home or office, we can help.

Stop worrying about all that clutter right now! We are your friendly furniture and junk removal experts in Wichita. Don’t want to get stuck with a fine for leaving your unwanted items on the curb? Our junk removal experts are trained to quickly and safely remove items form all kinds of spaces – including closet-sized Wichita apartments! You and your super can rest easy knowing that your items will be removed safely without any damage to hallways or lobbies. We work on your schedule and are ready when you are with same day and next day appointments available.

Not only do we make the process quick and painless for you, we also help local charities right here in Wichita by donating your items directly to those in need. And we also make sure you get a tax-deductible receipt for all the items that are donated on your behalf!

ECO-FRIENDLY MISSION – ECO FRIENDLY JUNK REMOVAL

Our company’s mission is to keep as many items out of the landfill as possible by donating, reusing and recycling the “junk” collected. In 2014, Wichita Hauling Junk & Moving of Wichita and Wichita donated over 1,000 times for our customers. In 2015, Wichita Hauling Junk & Moving more than doubled the amount to over 2,000 donations. We are very serious about our mission to keep our customers’ items out of the landfill; our company goal is to donate, reuse or recycle 100% of all items removed by 2020.

DUMPSTER RENTAL ALTERNATIVES IN WICHITA

Life in the city comes with a unique set of complications, especially when you’re planning a major home or office project. When you have a lot of debris and junk on your hands and no simple disposal method, the situation can seem downright hopeless.

Because of this, Wichita  often dread going through the hassle of finding a reliable source for junk removal and dumpster rental services.

That’s where we come in. Instead of renting you a dumpster and leaving you with all the work, we’ll step up and take the entire process of your hands. Wichita Hauling Junk & Moving is a truly full service junk disposal service.

Supplying trusted junk removal since 1999, Wichita Hauling Junk & Moving has seen it all; even in a crowded city, junk disposal is a breeze when you trust us to find a solution.

WICHITA JUNK REMOVAL HAS NEVER BEEN SO EASY

We have the experience to perfect the process of junk disposal in Wichita, the process is so easy, you’ll forget you ever had stress at the thought of undertaking a major project.

First, call us or make an appointment online. We can set up a consultation on the same day or whenever works best with your schedule. The whole process takes place on your terms.

Next, we’ll come out and inspect your project plans and offer our expert advice. Give us your price range and needs; why rent a dumpster when the industry experts can handle the whole job?

Our prices are fixed, and transparent. We give you the rates and prices before your project is set in stone, and we promise they won’t change.

When you junk removal service works in tandem with your schedule and your plans, you’ll be amazed at how easy a project can be, no matter the size. Just show us what we’re up against. WHAT WE TAKE

Here are some items that we can help take off your hands:

• Scrap metal • Renovation waste • Old tires • Household furniture • Appliances • Personal electronics and computers • Books records and VCR tapes • Retired carpet • Old sofas and couches • Televisions

CALL US FOR:

• Junk Removal Wichita Cost • Junk Removal Wichita Free • Wichita Junk Removal Company • Free Furniture Removal Wichita • Junk Removal Service

#1 FULL SERVICE JUNK REMOVAL COMPANY IN WICHITA KS WICHITA HAULING JUNK & MOVING REQUEST MORE INFORMATION. CLICK HERE CONTACT US: Wichita Hauling Junk & Moving CALL (316) 500-7551 CLEANING CALL (316) 448-5733 JUNK REMOVAL & MOVING CALL (316) 448-3974 HANDYMAN Best Junk Removal Hauling Company in Wichita, KS Open Monday to Sunday 7 Am – 11 PM Located in Wichita, KS 67211 WEB: https://junkremovalhaulerwichita.org/

SERVICE AREA: 55 Cities within 30 miles of Wichita, KS:  Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KSColwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven 68116, 68117, 68118, 68122, 68124, 68127, 68130, 68131, 68132, 68134, 68135, 68137, 68142, 68144, 68147, 68152, 68154, 68157, 68164, 68178 #junkremoval #haulingservice #handyman #moving #Wichita #Kasnas #residencialjunkservic #commercialjunk #officejunkremoval

OUR SISTER COMPANIES IN WICHITA KS: WICHITA HAULING JUNK & MOVING (316) 448-5733 https://junkremovalhaulerwichita.org/

WICHITA JUNK DISPOSAL (316) 448-5146 http://wichitajunkdisposal.com

JUNK REMOVAL SERVICES OF WICHITA (316) 448-5089 http://junkremovalservicesofwichita.com

PRICE JUNK REMOVAL WICHITA (316) 448-5733 http://pricejunkremovalwichita.com

AONE JUNK REMOVAL OF WICHITA (316) 448-5146 http://ajunkremovalwichita.com

WICHITA JUNK REMOVAL COMPANY (316) 448-5733 http://wichitajunkremovalservice.com

MR JUNK REMOVAL OF WICHITA (316) 448-5733 http://mrjunkremovalofwichita.com

ACTION JUNK REMOVAL OF WICHITA (316) 448-5146 http://cheapjunkremovalwichitaks.com

JUNK REMOVAL PROS WICHITA (316) 448-5089 http://wichitajunkremovalcompany.com

AFFORDABLE JUNK REMOVAL WICHITA (316) 448-5146 http://cheaphaulerwichita.com

ECONOMY JUNK REMOVAL WICHITA (316) 448-5089 http://cheapdumpsterrentalwichita.com

[stephenmccull]

When Covid Deaths Aren’t Counted, Families Pay the Price

This story also ran on The Guardian. It can be republished for free.

On Sundays, Bishop Bruce Davis preached love. Through his Pentecostal ministry, he organized youth parades and gave computers, bicycles and food to families in need.

During the week, Bruce practiced what he preached, caring for prisoners at a Georgia hospital. On March 27 he began coughing, and on April 1 he was hospitalized. He’d tested positive for covid-19. The virus swept through his household, infecting his wife and daughter and hospitalizing their disabled son. Ten days after landing in the hospital, Bruce died.

But when Gwendolyn Davis received her husband’s death certificate, she was taken aback. The causes of death? Sepsis and renal failure. No mention of covid-19.

“He wouldn’t have had kidney failure if he didn’t have covid,” Gwendolyn said.

After Bruce died, his wife applied to two pandemic relief programs seeking help with $1,500 in missed payments on a truck and an electricity bill. But, she said, she was denied because his death certificate didn’t mention covid-19.

“I think it’s wrong,” Gwendolyn said. “It’s almost like we didn’t count.”

The count has profound implications for families and the country. Omitting covid-19 on death certificates threatens to undercount the toll of the pandemic nationwide. For Davis’ family and others, it can pile financial hardship onto emotional despair, as death benefits and other covid-19 relief programs are withheld. Interviews with families across the U.S. shed light on reasons covid deaths are being undercounted — and the consequences loved ones have endured.

When covid patients die, the “immediate” cause of death is always something else, such as respiratory failure or cardiac arrest. Residents, doctors, medical examiners and coroners make the call on whether covid was an underlying factor, or “contributory cause.” If so, the diagnosis should be included on the death certificate, according to the Centers for Disease Control and Prevention.

Even beyond the pandemic, there is wide variation in how certifiers describe causes of death: “There’s just no such thing as an objective measure of cause of death,” said Lee Anne Flagg, a statistician at the CDC’s National Center for Health Statistics.

Partly because of a lack of training in how to fill them out, “the quality of the death certificates is not good,” said Dr. James Gill, vice president of the National Association of Medical Examiners. And in cases in which people had other chronic conditions, it can be difficult to determine whether covid was a contributing cause of death, he said. That was especially true early on, when reliable testing was not widely available.

Since early in the pandemic, the CDC has encouraged certifiers who suspect covid as a cause of death to list it on the death certificate as “probable” or “likely.”

Still, some clinicians are “reluctant to certify a death as a covid death without a test in hand,” Gill said.

It’s not clear how Bruce Davis’ case slipped under the radar. His death was certified by William Ken Garland, deputy coroner in Baldwin County. Reached by phone, Garland said the causes of death were provided by Dr. Joseph Coppiano, a medical resident who pronounced Davis dead at Augusta University Medical Center, about 90 miles away. No autopsy was done.

“I did certify the record, but that’s about all I did,” Garland said.

Hospital spokesperson Danielle Harris declined to comment on the case, citing patient privacy. She said the hospital follows Georgia Department of Public Health guidelines.

In the absence of certainty, the CDC has encouraged coroners to document the virus. “We’re not worried that we’re overcounting the number of [covid-19] deaths,” Farida Ahmad, epidemiologist and mortality surveillance team leader at NCHS, said in April.

Missed cases are one reason that experts agree covid deaths are being undercounted nationwide. As evidence for that, they point to the vast number of excess deaths — additional deaths compared to what would be expected based on prior-year numbers and demographic trends.

Over the past year, the U.S. had endured up to 431,792 excess deaths as of Jan. 6, with 68% directly attributed to covid, according to the CDC.

These excess deaths “tend to track pretty closely with covid cases, trailing by a couple of weeks,” said Daniel Weinberger, an epidemiologist at Yale School of Public Health who has published on this topic. “This strongly suggests that a large proportion of these uncounted deaths are due to covid but not recorded as such.”

We may never know how many covid deaths went uncounted: Postmortem tests can detect the virus, but it’s “unlikely that this type of testing will be performed at a [sufficient] scale,” Weinberger said. Early in the pandemic, especially in the Northeast, many of those who were treated clinically for covid and then died were not tested for the virus — so they never made it into the statistics.

Testing Troubles Affect Lawsuits, Hospital Bills

Inaccurate death certificates can make it harder to pursue a lawsuit or win a workers’ compensation case when a loved one dies after contracting covid on the job. Gwendolyn Davis did win workers’ compensation death benefits from Bruce’s employer, a state psychiatric facility in Milledgeville, by providing medical records. But problems with covid testing can complicate the process.

Bruce’s supervisor at work, Mark DeLong, also died after contracting covid, but it did not appear on his death certificate with the other causes: cardiopulmonary arrest, respiratory failure and diabetes.

The omission on DeLong’s certificate seemed to stem from a delay in test results: His covid-positive results didn’t arrive until three days after he died, according to his widow, Jan DeLong. She has asked the local coroner to correct the record.

In New Jersey, attorney Paul da Costa represents 75 family members who lost loved ones at veterans homes in Menlo Park and Paramus in April and May. He said he knows of at least five patients whose death certificates did not list covid-19 despite evidence suggesting it killed them.

The root problem, he said, was a “complete dearth of testing.” Patients were transferred to hospitals, or dying in the veterans facilities, without ever being tested, he said.

The gap between excess deaths and confirmed covid deaths has “narrowed over time as testing has increased,” Weinberger said.

Early testing inaccuracy may also have led to undercounting, which creates a different burden: hospital bills. Without a diagnosis, families can be on the hook for thousands of dollars in charges that otherwise would have been covered under the CARES Act.

Correcting the Record

In some cases, families have sought to have death certificates changed to reflect covid. Dorothy Payton, 95, who lived in the ManorCare nursing home in Denver, first showed covid symptoms April 5. Five days later, Payton — known as “Nana Dee” — tested positive for it. And on April 13, her husband, Edward Benjamin, received a call that she had died.

The death certificate offered a litany of causes: vascular dementia, atrial fibrillation, congestive heart failure, gait instability, difficulty swallowing and “failure to thrive.”

But not covid-19. So it “seemed logical to fight for listing her cause of death under her cause of death,” Benjamin said.

After a few calls, her husband was able to get the certificate amended. ManorCare could not be reached for comment.

For Benjamin, it wasn’t about public health statistics or financial considerations. It simply offers a sense of closure.

“I want her life and death remembered the way it was, and I’m glad we set the record straight,” he said. “It’s the first step towards moving on.”

This story is part of “Lost on the Frontline,” an ongoing project from The Guardian and Kaiser Health News that aims to document the lives of health care workers in the U.S. who die from COVID-19, and to investigate why so many are victims of the disease. If you have a colleague or loved one we should include, please share their story.

Kaiser Health News (KHN) is a national health policy news service. It is an editorially independent program of the Henry J. Kaiser Family Foundation which is not affiliated with Kaiser Permanente.

USE OUR CONTENT

This story can be republished for free (details).

When Covid Deaths Aren’t Counted, Families Pay the Price published first on https://smartdrinkingweb.weebly.com/

[wichitahouseholdservices]

Best Regular Store Cleaning Services in Wichita KS| Wichita Household Services| More Information is at: http://wichitahouseholdservices.com/regular-store-cleaning-near-me/ Looking for the best professional, eco-friendly  Regular Store cleaning services in Wichita KS? Look no further Wichita Household Servicesis here to your rescue!WICHITA HOUSEHOLD SERVICES cleaner offer impeccable domestic home or office cleaning services in Wichita KS that keeps your space both clean and green.Making the first right impression on your visitors in the shops is not an easy task. The quality of cleanliness provided by the retail cleaning services Wichita KS will determine the branding for your store. As many of the business experts say, the cleanliness in your shops is directly proportional to the foot fall. Cost of Regular Store Cleaning Services? Free estimates. Best Regular Store Cleaningcompany in Wichita KS.

REQUEST FREE QUOTE TODAY! REGULAR STORE CLEANING Professional, stylish, attractive and spotless presentation of your Store can guarantee excellent results. With great knowledge and a decade of experience, WICHITA HOUSEHOLD SERVICES will be pleased to help you in achieving the desired cleanliness and hygiene for your shops in Wichita KS. We provide specialist services, daily cleaning, window cleaning, washroom cleaning services, waste management with much more. With flexible and bespoke shopping center cleaning Wichita KS, our fully-trained professionals can provide exceptional cleaning standards for your shops.

We Serve The Following Clients in Wichita KS: At WICHITA HOUSEHOLD SERVICES, we create a positive impact on your business and buyer experience. Our Regular Store cleaning services are specifically designed to achieve 100% customer satisfaction. Additionally, with a strict adherence to Health & Safety regulations as per the Australian government, we serve to the cleaning needs of the following and more.

● Fashion and style shops ● Electronics retailers ● Computer and mobile stores ● Furniture and upholstery stores ● Interior design and Decor stores ● Car Accessories and Parts stores ● Pet stores ● Music and recreation shops ● Supermarkets and hypermarkets ● Wine stores ● Sports and Merchandise stores ● Book and Literature Merchandise shops

Our Regular Store Cleaning Services: We provide the following services with the use of latest cutting-edge technology. With a strong focus on efficiency and effectiveness, we deliver quality with a hassle-free experience. Our staff works to minimise disruption to your buyers and staff, cleaning the following facilities and premises with great commitment. ● Entrances and exits ● Product display areas ● Staff sections ● Loading areas ● Cash collection and billing desks ● Storefront and floors ● Public utility areas ● Changing and trial rooms ● Car parks ● Windows, doors, and mirrors

Apart from the general cleaning services, we also specialise in retail cleaning services Wichita KS and all the services in commercial cleaning Wichita KS. Call us for a comprehensive range of Regular Store cleaning needs in Wichita KS! CALL US FOR: ● commercial cleaning services ● cleaning services price list ● commercial cleaning ● professional cleaning ● Deep cleaning

BEST REGULAR STORE CLEANING  SERVICES IN WICHITA WICHITA HOUSEHOLD SERVICES REQUEST MORE INFORMATION.CLICK HERE CONTACT US: Wichita Household Services We Offer Cleaning Junk Removal Movers Handyman Services Call: (316) 448-3558 SERVICE AREA: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS |Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS | Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS | Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS | Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS | Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS | Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – BelAire or Wichita | 67221 – McConnell AFB | 67226 – BelAire or Wichita | 67543 – Haven #Wichita #junkremoval #handyman #householdservice #movers #cleaning

[wichitacleaning12]

Best Regular Store Cleaning Services in Wichita KS | Wichita Cleaning Company

More information is at: http://bestcleaningserviceswichita.com/regular-store-cleaning-near-me/

Looking for the best professional, eco-friendly  Regular Store cleaning services in Wichita KS? Look no further Wichita Cleaning Company is here to your rescue! WICHITA CLEANING COMPANY cleaner offer impeccable domestic home or office cleaning services in Wichita KS that keeps your space both clean and green.Making the first right impression on your visitors in the shops is not an easy task. The quality of cleanliness provided by the retail cleaning services Wichita KS will determine the branding for your store. As many of the business experts say, the cleanliness in your shops is directly proportional to the foot fall. Cost of Regular Store Cleaning Services? Free estimates. Best Regular Store Cleaning company in Wichita KS.

REQUEST FREE QUOTE TODAY! REGULAR STORE CLEANING Professional, stylish, attractive and spotless presentation of your Store can guarantee excellent results. With great knowledge and a decade of experience, WICHITA CLEANING COMPANY will be pleased to help you in achieving the desired cleanliness and hygiene for your shops in Wichita KS. We provide specialist services, daily cleaning, window cleaning, washroom cleaning services, waste management with much more. With flexible and bespoke shopping Centre cleaning Wichita KS, our fully-trained professionals can provide exceptional cleaning standards for your shops.

We Serve The Following Clients in Wichita KS: At WICHITA CLEANING COMPANY, we create a positive impact on your business and buyer experience. Our Regular Store cleaning services are specifically designed to achieve 100% customer satisfaction. Additionally, with a strict adherence to Health & Safety regulations as per the Australian government, we serve to the cleaning needs of the following and more.

● Fashion and style shops ● Electronics retailers ● Computer and mobile stores ● Furniture and upholstery stores ● Interior design and Decor stores ● Car Accessories and Parts stores ● Pet stores ● Music and recreation shops ● Supermarkets and hypermarkets ● Wine stores ● Sports and Merchandise stores ● Book and Literature Merchandise shops

Our Regular Store Cleaning Services: We provide the following services with the use of latest cutting-edge technology. With a strong focus on efficiency and effectiveness, we deliver quality with a hassle-free experience. Our staff works to minimise disruption to your buyers and staff, cleaning the following facilities and premises with great commitment. ● Entrances and exits ● Product display areas ● Staff sections ● Loading areas ● Cash collection and billing desks ● Storefront and floors ● Public utility areas ● Changing and trial rooms ● Car parks ● Windows, doors, and mirrors

Apart from the general cleaning services, we also specialise in retail cleaning services Wichita KS and all the services in commercial cleaning Wichita KS. Call us for a comprehensive range of Regular Store cleaning needs in Wichita KS! CALL US FOR: ● commercial cleaning services ● cleaning services price list ● commercial cleaning ● professional cleaning ● Deep cleaning

BEST REGULAR STORE CLEANING  SERVICES IN WICHITA WICHITA CLEANING COMPANY REQUEST MORE INFORMATION.

CONTACT US: Wichita Cleaning Company Best commercial residential cleaning company in Wichita KS (316) 500-7551 CLEANING (316) 448-3974 HANDYMAN SERVICES OF WICHITA (316) 448-5733 WICHITA HAULING JUNK & MOVING Location: Wichita KS Monday-Sunday 7 am- 11 pm bestcleaningserviceswichita.com/ handymanserviceswichitakansas.com/ junkremovalhaulerwichita.org/ Service area; 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven #cleaning #moving #movers #junkremoval #handymanservice #hauling #Wichita #kanas

[augustacomputerexperts]

If you have any problems related to PC repair that you’re facing and you live in Atlanta, Georgia, feel free to contact Augusta Computer Experts Augusta, GA.

 #ComputeRepair #Augusta #PC   #Laptop #repair #Augusta