#diy extra large canvas art
Explore tagged Tumblr posts
Text
Buy 3D Mirror Wall Stickers Online
Have you ever walked into a room and felt like something was missing? Perhaps it needed a touch of sparkle, a sense of spaciousness, or just a unique artistic flair that truly reflects your personality. Traditional mirrors are wonderful, but sometimes you crave something more dynamic, something that breaks the mold and transforms your walls into a captivating canvas. This is where the enchantment of 3D mirror wall stickers comes into play, offering a brilliant blend of decor and illusion. If you are looking to revitalize your living space with minimal effort and maximum impact, then it is time to consider how easy it is to Buy 3D Mirror Wall Stickers Online.
Buy 3D Mirror Wall Stickers Online
These aren't your ordinary flat decals. 3D mirror wall stickers are ingenious decorative elements typically crafted from lightweight, shatterproof acrylic, which is then polished to a reflective finish. The "3D" aspect often comes from their varied shapes, sizes, and the way they can be arranged to create depth and visual interest, making them stand out from the flat surface of your wall. Imagine geometric patterns that pop, intricate floral designs that seem to bloom, or abstract shapes that create a modern art installation. The possibilities are truly endless, allowing you to curate a look that is distinctly yours.
Why 3D Mirror Wall Stickers Are a Decor Game Changer
Let us explore the compelling reasons why these reflective wonders are becoming a favorite among homeowners and interior design enthusiasts alike.
1. Instant Room Expansion and Brightening: This is arguably the most celebrated benefit of any mirror, amplified by these stickers. By reflecting light, 3D mirror wall stickers can instantly make a room feel larger, more open, and significantly brighter. This is particularly advantageous for smaller rooms, narrow hallways, or spaces that lack ample natural light. Strategic placement can bounce light from windows or lamps, creating a luminous and inviting atmosphere that belies the actual dimensions of the room.
2. Unleashing Creative Freedom: Unlike a single large mirror, these stickers offer unparalleled design flexibility. You are not limited to one fixed shape or size. You can arrange individual pieces to form intricate patterns, create a striking focal point, or even mimic the look of custom mirror art. Mix and match different shapes hexagonal, circular, or even abstract waves to craft a truly unique installation that perfectly complements your existing decor. Want to frame a favorite painting or highlight a specific architectural detail? 3D mirror stickers can do that too, drawing the eye and adding an extra layer of sophistication.
3. Effortless Application and Removal: One of the most appealing aspects of 3D mirror wall stickers is their user friendly nature. Most come with an adhesive backing, making application a straightforward peel and stick process. You do not need heavy tools, messy glues, or professional help. This DIY friendliness means you can transform a room in an afternoon. And should you decide to redecorate or move, they can typically be removed without damaging your walls, leaving no sticky residue behind. This temporary yet impactful nature makes them ideal for renters or those who love to frequently refresh their decor.
4. Safety and Durability: Traditional glass mirrors, while beautiful, come with the inherent risk of shattering. 3D mirror wall stickers, being made from acrylic, are shatterproof and much safer, especially in homes with children or pets. This robust material also makes them more durable and resistant to breakage from accidental bumps. While they are not as scratch resistant as glass, proper care ensures they maintain their reflective quality for a long time.
5. Budget Friendly Brilliance: Achieving a high-end, custom look for your walls often comes with a hefty price tag. 3D mirror wall stickers offer a surprisingly affordable alternative to large framed mirrors or bespoke mirrored panels. They provide a luxurious aesthetic and significant visual impact without breaking the bank, making stylish home decor accessible to everyone.
Exploring Creative Applications for Every Room
The versatility of 3D mirror wall stickers means they can find a place in almost any room of your home, adding character and dimension wherever they go.
Living Room: Create a stunning feature wall behind your sofa, arrange them around your television to minimize its imposing presence, or use them to highlight a console table. Geometric patterns can add a modern, edgy vibe, while floral designs can bring a touch of natural elegance.
Bedroom: Place them above your headboard for a romantic or chic statement. A collection of smaller, reflective circles or squares can create an ethereal, dreamlike ambiance. They are also perfect for a vanity area, adding light and a decorative touch.
Dining Room: Enhance the elegance of your dining space by strategically placing mirror stickers to reflect light from a chandelier or your dining table, creating an inviting and sophisticated atmosphere for meals and gatherings.
Hallways and Entryways: These areas often feel cramped or dark. 3D mirror stickers are an excellent solution to open them up, making them feel more spacious and welcoming. A linear arrangement can guide the eye and add depth.
Kids Rooms: Given their shatterproof nature, these stickers are a safe and fun way to add decorative elements to a childs room. Think whimsical shapes like stars, clouds, or animals that reflect light and spark imagination.
Bathrooms: While traditional mirrors are a given, smaller mirror stickers can be used to add decorative accents around the main mirror or on a plain wall, bringing extra sparkle and a touch of luxury.
Tips for Application and Care
Applying 3D mirror wall stickers is straightforward, but a few simple tips can ensure a perfect, lasting finish. First, ensure your wall surface is clean, dry, and smooth. Any dust or debris can affect adhesion. Measure and plan your layout beforehand; laying the stickers out on the floor first can help you visualize the final design. When applying, peel the backing slowly and use a soft cloth or a credit card to smooth out any air bubbles as you go, working from the center outwards.
For maintenance, these stickers are generally easy to clean. A soft, damp cloth is usually sufficient to wipe away dust or fingerprints. Avoid harsh chemical cleaners or abrasive materials, which can scratch the acrylic surface and dull its reflective quality. With a little care, your 3D mirror wall stickers will continue to gleam and transform your space for years to come.
The Smart Way to Decorate: Buy 3D Mirror Wall Stickers Online
The modern world offers unparalleled convenience, and home decor is no exception. When you decide to Buy 3D Mirror Wall Stickers Online, you unlock a realm of advantages that make the decorating process not just easy, but enjoyable.
1. Expansive Selection: Online platforms remove the limitations of physical store space. You can browse through an immense variety of designs, from intricate mandalas and delicate floral patterns to bold geometric shapes and abstract art. Find stickers in various sizes, colors, and finishes to perfectly match your decor vision, all from the comfort of your home.
2. Detailed Product Insights: Online listings typically provide comprehensive product descriptions, including dimensions, materials, and application instructions. High quality images and sometimes even videos allow you to visualize the stickers in different settings, helping you make an informed choice.
3. Unmatched Convenience: Shop anytime, anywhere. Whether you are on your lunch break or unwinding late at night, you can explore options and make purchases at your own pace. The biggest convenience, of course, is having your chosen decor delivered directly to your doorstep, saving you trips to multiple stores.
4. Value and Accessibility: Online retailers often offer competitive pricing due to lower overheads. This means you can find stunning 3D mirror wall stickers that fit your budget, allowing you to achieve a sophisticated look without overspending.
Your Home Decor Journey Begins with SOSOCHI
When you are ready to embark on your home transformation, SOSOCHI is your trusted partner. At SOSOCHI, we believe that creating a beautiful and functional living space should be an enjoyable and accessible experience for everyone. Our curated selection of products is designed to meet the diverse needs and tastes of homes across India.
While you are here to Buy 3D Mirror Wall Stickers Online, we invite you to explore the extensive range of items we offer. Our Home Improvement section is brimming with treasures like captivating Home Decor pieces that add personality to your rooms, essential Cleaning Essentials to keep your space pristine, comfortable Bedroom Linen for restful nights, innovative Indoor Lighting solutions, and smart Home Storage & Organization products that ensure every item has its place. We also stock reliable Home Appliances and practical Laundry Care items to simplify your daily routines.
For the heart of your home, our Kitchen Essentials category includes everything from durable Cookware & Bakeware and versatile Kitchen Utensils to smart Food Storage options, efficient Kitchen Appliances, and clever Kitchen Organization solutions that make cooking a delight.
Hydration is key, and our Drinkware collection offers stylish Water Bottles, insulated Tumblers & Flasks, elegant Glassware & Barware, and charming Mugs & Cups. For those who love the outdoors, our Garden & Outdoor range features handy Gardening Tools & Accessories, vital Garden Care & Supplies, beautiful Outdoor Decor, and atmospheric Outdoor Lighting. We also cater to your well-being with Health & Wellness products like soothing Massage Tools and effective Pain & Stress Relief solutions. And for your adventures, our Travel Essentials include robust Travel Bags & Luggage, comforting Travel Comfort Accessories, indispensable Portable Essentials, and clever Tech & Travel Gadgets.
At SOSOCHI, we are proud to serve customers across various regions, making it easy for you to buy products online in West Bengal, Sikkim, Assam, Meghalaya, Arunachal Pradesh, and indeed, all over India. Our commitment is to provide a seamless shopping experience, ensuring that quality products and excellent service reach you, no matter your location.
Embrace the simplicity and elegance that 3D mirror wall stickers bring to your home. They are more than just decorations; they are expressions of your style, tools for enhancing light and space, and effortless ways to create visual intrigue. Ready to add that touch of magic to your walls? Discover the perfect pieces to reflect your unique taste and elevate your living spaces.
Begin your decor adventure today and explore our complete collection at SOSOCHI Online Store. Let your walls tell a beautiful, reflective story.
also see-
Buy 18inch Folding Stool Online
Buy 240V Wireless Vacuum Cleaner Online
Buy 2in1 Bath Brush Online
Buy 3 Layer Kitchen Trolley Online
Buy 3D Mirror Wall Stickers Online
Buy 3D Moon Lamp Online
Buy 6-in-1 Ear Tools Cleaner Online
0 notes
almanoelscraft · 1 month ago
Text
Typographic Wall Art: Paint, Print, and Paste Your Message Loud & Proud
Tumblr media
Typography isn’t just for graphic designers and your cousin who insists on using Papyrus for everything. It’s a powerful visual tool that combines form and function—and in today’s DIY world, it's your secret weapon for wall-worthy inspiration.
This lesson is all about creating striking wall art that uses letters, words, and quotes to transform your space. Whether you're working with canvas, paper, or even upcycled wood, your walls are about to start speaking volumes.
🧠 Unique Fact of the Day:
Typography wall art is one of the top five most-pinned craft categories on Pinterest every year since 2017. Why? Because people love words that speak to them—especially when they’re painted in gold foil or arranged in stylish block letters above a coffee station.
✨ Techniques We’ll Explore Today:
Stencil and Spray Paint Lettering
Hand-lettered Canvas with Acrylics
Mod Podge Collage Typography
Vinyl Letter Decals (DIY Style)
Recycled Wood + Painted Script Signs
These methods range from quick and easy to time-to-rewatch-your-favorite-series-in-the-background kind of detailed. Pick your project based on how bold (or patient) you're feeling.
🛠 Supplies You’ll Likely Need
Canvas, wooden board, or thick watercolor paper
Acrylic paint or spray paint
Alphabet stencils or vinyl letters
Washi tape or painter’s tape
Pencil + ruler (measuring is caring!)
Paintbrushes or sponge brushes
Mod Podge or decoupage glue
Magazines, newspapers, or printed quotes
Craft cutting knife or scissors
Optional: Gold foil, twine, beads, sequins, etc.
🎨 Project 1: Hand-Lettered Canvas Quote
This is the Instagram classic—clean, simple, and oh-so-pinworthy.
How To:
Choose a quote that makes you feel things (funny, inspiring, or petty—you do you).
Lightly sketch your text with a pencil onto the canvas.
Use a fine brush and acrylic paint to hand-letter it in a script or block font.
Optional: Add design flourishes like florals, shadows, or a gradient background.
Typography tip: Mix fonts. Use script for emotion, serif for impact, and sans-serif for clarity. Balance them like you're designing your own billboard.
🧼 Project 2: Spray Stencil Street-Art Vibes
Fast, fun, and bold—this is typography for rebels.
How To:
Print out large block letters on cardstock and cut them out to make your own stencil.
Tape the stencil onto your surface (canvas, wood, wall, etc.).
Use spray paint (outdoors or in a ventilated area!) to apply color.
Let it dry and peel away the stencil.
Boom. Instant typographic drama.
📰 Project 3: Collaged Quote with Magazines
Channel your inner ransom note artist—but make it cute.
How To:
Cut letters from magazines, newspapers, or printed fonts.
Arrange them on canvas or thick paper to form your quote.
Glue them down with Mod Podge.
Seal with an extra layer on top for durability and shine.
This technique is particularly fun for mixing font styles and creating a retro punk vibe.
🌲 Project 4: Wooden Slab Typography
Farmhouse chic? Industrial edge? Rustic glam? Say no more.
How To:
Sand and paint or stain your wooden board.
Sketch or stencil your quote using chalk (for easy corrections).
Paint over it with acrylic or use a paint pen for precision.
Finish with sealant for longevity.
Bonus: Add hooks on the back and hang it like the masterpiece it is.
🌀 Want to Go Digital First?
Design your quote in a program like Canva, Procreate, or Photoshop first. Play with font pairings, spacing, and layout. Once you're happy, print it out as a guide or use a projector to trace it onto your chosen medium.
💡 Typography Tips for Impact
Hierarchy matters: Emphasize keywords with bigger or bolder fonts.
Spacing is magic: Don’t cram letters. Give your words room to breathe.
Contrast counts: Use light letters on dark backgrounds and vice versa.
Alignment sets the tone: Left-aligned feels clean, center feels classic, and right-aligned feels a little rebellious.
https://letterhanna.com/typographic-wall-art-paint-print-and-paste-your-message-loud-proud/
0 notes
thediyhomedecorideas · 4 months ago
Text
Cloth Wall Hanging Decor: Creative & Stylish Ideas for Your Home
Looking for a unique way to decorate your walls? Cloth wall hanging decor is a perfect choice! It adds warmth, texture, and a personal touch to any space. Whether you prefer a boho vibe, traditional elegance, or modern minimalism, fabric wall art can transform your home effortlessly. Let’s explore some beautiful and creative cloth wall hanging ideas.
Tumblr media
🏡 Why Choose Cloth Wall Hanging Decor?
✔ Soft & Cozy Look – Adds warmth and softness to any room. ✔ Budget-Friendly – Many options are affordable and DIY-friendly. ✔ Lightweight & Easy to Hang – No heavy frames or drilling required. ✔ Versatile – Works in living rooms, bedrooms, and even offices. ✔ Endless Designs – Choose from tapestries, macramé, quilts, and more!
🖼️ Best Cloth Wall Hanging Decor Ideas
1️⃣ Boho Macramé Wall Hanging
Handmade macramé designs bring a cozy, bohemian feel.
Choose neutral colors like beige, cream, or gray for a modern look.
Large macramé pieces can be the centerpiece of your wall.
2️⃣ Fabric Tapestries & Prints
Indian, Moroccan, or Mandala tapestries create a bold statement.
Go for nature-inspired prints (flowers, trees, mountains) for a calming vibe.
Use bright colors and patterns to add energy to your space.
3️⃣ Handwoven Wall Hangings
Traditional woven art adds cultural charm to your home.
Use chunky wool or cotton yarn for a textured, cozy feel.
Mix different fabric types for a unique look.
4️⃣ DIY Fabric Wall Art
Stretch beautiful printed fabric over a canvas frame.
Choose patterns that match your decor style.
No sewing needed—just staple the fabric onto the frame!
5️⃣ Quilted Wall Hangings
Great for a vintage or farmhouse-style home.
Handmade quilts tell a story and add sentimental value.
Choose soft pastels or deep earthy tones for a cozy look.
6️⃣ Silk & Embroidered Panels
Hand-embroidered fabric adds elegance and detail.
Perfect for traditional or modern Asian-inspired decor.
Try silk paintings or embroidered floral designs.
7️⃣ Scarf or Shawl Wall Display
Hang beautiful scarves as art pieces.
Works well in bedrooms and fashion-inspired spaces.
Layer different textures and colors for a unique look.
8️⃣ Upcycled Fabric Banners
Use old sarees, kimonos, or vintage fabrics to create hanging banners.
Patchwork fabric pieces create a colorful, eclectic look.
Hang with a wooden dowel or a simple rope for an organic feel.
🎯 How to Style Cloth Wall Hangings
✔ Choose the Right Size – Large pieces make a statement, while small ones add subtle charm. ✔ Mix & Match Textures – Combine soft fabrics with wooden or metal accents. ✔ Layer with Other Decor – Pair with fairy lights, shelves, or plants for extra style. ✔ Stick to a Theme – Whether it’s boho, modern, or rustic, keep a consistent vibe.
✅ Final Thoughts: Elevate Your Walls with Fabric Art
Cloth wall hanging decor is a simple yet beautiful way to add character to your home. Whether you go for tapestries, macramé, or DIY fabric frames, your walls will feel warm and stylish.
0 notes
dadgamerhq · 9 months ago
Text
Autumn DIY Ideas for Dads: A Humorous Guide to Crafting and Chaos
Tumblr media
Autumn is upon us, which means it’s time for dads everywhere to dive into seasonal DIY projects – with equal parts creativity and mischief. Here's a list of DIY activities that are fun, slightly chaotic, and perfect for showing off your "dad skills" while keeping everyone entertained.
1. Leaf Blower Art: Unleash the Blower, Create Chaos
Who needs rakes when you have a leaf blower? Turn raking into a creative (and chaotic) endeavour by transforming your garden into an art canvas. Grab a leaf blower, gather the family, and blast autumn leaves onto a large canvas or sheet. The result? Pure, abstract brilliance – or something only a dad would appreciate. Either way, there’s less actual raking involved. Dad Rating: ★★★★☆ Loud fun with minimal raking – a solid dad win.
2. The DIY Bird Feeder: High Rise for the Birds
Autumn is when birds look for winter shelter, so why not put your carpentry skills to the test? Build a bird feeder – or, if you’re feeling ambitious, a bird mansion. Use scraps of wood, old nails, and possibly that forgotten chair in the shed to create a feeding station fit for a king (or at least a robin). Dad Rating: ★★★★★ Perfect mix of carpentry and neighbour envy.
3. Pumpkin Carving: Battle of the Blunt Knives
What’s autumn without a competitive pumpkin carving contest? Grab the family, pick some pumpkins, and go wild with your design. Bonus points for the most intricate or ridiculous creation. Pro tip: avoid sharp knives, because blunt kitchen tools add extra challenge (and safety). Dad Rating: ★★★★☆ Messy fun, but worth the effort – even if it means cleaning pumpkin guts from your hair.
4. DIY Fire Pit: Go Full Caveman
Nothing beats a cosy fire pit on a chilly autumn evening. Instead of buying one, show off your DIY prowess by building your own. Grab a shovel, some bricks, and a bit of gravel, and dig yourself a hole in the garden. Light a fire, roast some marshmallows, and embrace your inner caveman. Dad Rating: ★★★★★ Fire, warmth, and minimal effort – the holy trinity of dad activities.
5. Autumn Wreaths: Pretend You’re Crafty
Yes, wreaths. Hear me out! You don’t need to be the crafty type to pull off a DIY autumn wreath. Raid the garden for leaves, acorns, and twigs, and get the glue gun out (because, admit it, glue guns make everyone feel like a professional). Stick it all together and hang it proudly on the front door. Bonus: it might convince the neighbours you’ve got your life together. Dad Rating: ★★★☆☆ Low effort, medium reward. Watch out for glitter – it gets everywhere.
6. Hedgehog Hotels: For the Garden’s Most Important Guest
Autumn is the season when hedgehogs are looking for a cosy place to hibernate. Why not turn a wooden crate or plastic tub into a luxury hedgehog hotel? It’s easy, fun, and gives you an excuse to avoid cleaning the shed for a few more months. Just line the crate with leaves, straw, and sticks, and wait for your prickly visitor to move in. Dad Rating: ★★★★☆ Low-maintenance and earns you bonus ‘Good Dad Points.’
7. Conker Battles: Channel Your Inner Child
No autumn is complete without a good old-fashioned conker battle. Go conker hunting with the kids, then get creative – soak your conkers in vinegar or varnish for maximum toughness (because let’s face it, dads are in it to win it). Drill a hole, thread some string, and get ready for conker domination. Dad Rating: ★★★★★ Nostalgic, competitive, and free – what’s not to love?
8. Apple Picking and Pie Baking: Culinary Ambition Awaits
If you’re looking to impress the family, why not combine two autumn favourites: apple picking and pie baking? Head out to the orchard, gather some apples, and then roll up your sleeves for some kitchen action. It’s a rare chance to don an apron and pretend you’re on The Great British Bake Off – just be prepared for the kitchen mess. Dad Rating: ★★★★☆ A delicious (and impressive) end to a hard day's work.
Conclusion: Dad DIY – Embrace the Autumn Chaos
Autumn DIY projects don’t have to be perfect; in fact, they rarely are. But that’s the fun of it! Whether you’re carving pumpkins, starting fires, or challenging the kids to conker battles, it’s all about embracing the chaos, making memories, and maybe even learning a thing or two along the way. So go on, put down the remote, pick up a drill (or a leaf blower), and dive into the season with dadly determination. After all, autumn isn’t just for pumpkin spice lattes and woolly jumpers – it’s for dads doing DIY, one slightly chaotic project at a time.
Tumblr media
Read the full article
0 notes
milanchakrabartymd · 10 months ago
Text
Caring for Your Oil Paintings: Essential Tips for Preservation and Maintenance
Oil paintings are timeless works of art cherished for their richness and depth. However, these delicate masterpieces require proper care to maintain their beauty and prevent deterioration. Whether your painting is an heirloom or a contemporary piece, the following preservation and maintenance tips will help keep your artwork in pristine condition for years.
Keep Your Oil Painting in a Stable Environment
Oil paintings are sensitive to environmental changes, so maintaining a stable environment is crucial. Temperature fluctuations, humidity, and direct sunlight can cause damage over time. High humidity levels may lead to mold growth, while low humidity can cause the canvas to crack. Ideally, keep your painting in a room with moderate humidity levels, between 40-60%, and at a consistent temperature.
Avoid hanging oil paintings near windows or heating vents, where exposure to sunlight and temperature changes can fade colors or warp the canvas. UV rays are particularly harmful to oil paint, so placing your painting in an area with indirect lighting or using UV-protective glass is highly recommended.
Regular Dusting and Cleaning
Dust accumulation on an oil painting can dull its vibrant colors and lead to surface damage if not handled properly. To prevent dust from settling:
Lightly dust the surface of your painting using a soft, dry brush, such as a clean, natural bristle brush. Avoid
Avoid using cloth or abrasive materials, as they can scratch the paint.
Always use gentle strokes, working from top to bottom.
If your oil painting requires more extensive cleaning, it’s best to consult a professional art conservator. While there are products available for DIY cleaning, using the wrong materials or techniques can cause irreversible damage to the artwork. An art conservator will have the knowledge and experience to clean the painting safely without affecting the paint layers.
Frame Your Painting with Care
Framing an oil painting enhances its aesthetic appeal and provides essential protection. The frame is a barrier, protecting the canvas from dust, dirt, and physical damage. When choosing a frame, ensure it’s sturdy and doesn’t pressure the canvas. Ideally, opt for a frame with a spacer to keep the painting away from the glass, as direct contact with glass can trap moisture and lead to mold growth.
Inspecting the frame periodically for signs of damage or warping is important. A damaged frame may not provide adequate protection and even harm the painting. If you notice any issues, have the frame repaired or replaced by a professional framer to ensure the safety of your artwork.
Handling Your Oil Painting Properly
Oil paintings are fragile, and improper handling can cause physical damage to the canvas, frame, or paint surface. Always handle your painting with clean hands or wear cotton gloves to prevent oils or dirt from transferring to the artwork. Avoid touching the painted surface directly, as even the natural oils from your skin can leave marks that are difficult to remove.
Support painting from both sides and avoid pressing on the canvas when moving it. If the artwork is large or heavy, it’s a good idea to have someone assist you. For extra protection, wrap the painting in acid-free paper or bubble wrap before transport, especially if stored for an extended period.
Storage and Transportation Considerations
If you need to store your oil painting for any time, ensure it’s stored in a controlled environment. Do not place it in basements, attics, or garages, where extreme temperatures and humidity can lead to deterioration. Instead, choose a space that mimics a gallery-like environment with stable conditions. Storing oil paintings vertically is ideal, as this minimizes the risk of warping.
Oil paintings should be securely packaged in acid-free materials during transportation, whether to a new location or an exhibition. Use a sturdy, padded crate designed for art transportation for added protection. If possible, hire a professional art mover experienced in handling delicate artwork to ensure safe delivery.
Addressing Damage or Deterioration
Over time, even with careful maintenance, oil paintings may show signs of wear, such as cracks in the paint, fading colors, or chipped varnish. If you notice any of these issues, addressing them immediately is essential to prevent further damage. Attempting to repair the artwork on your own can lead to more harm than good, so it’s best to seek the expertise of an art conservator.
A professional conservator can assess the condition of your oil painting and recommend the appropriate restoration techniques. They may perform tasks such as re-varnishing the surface, filling in cracks, or reinforcing the canvas. Restoration can revive the painting’s original beauty while preserving its integrity for future generations.
Avoid Exposure to Harmful Elements
Oil paintings are particularly sensitive to certain chemicals and pollutants. Smoke from cigarettes, cooking, or even fireplaces can settle on the painting’s surface, causing discoloration over time. To preserve the clarity and vibrancy of your artwork, it’s best to keep it away from areas where smoke or pollutants are present.
In addition, avoid using harsh household cleaners near your oil painting. The fumes from strong chemicals can affect the paint’s stability, and accidental splashes can lead to staining or deterioration. If you need to clean the area around your painting, opt for gentle, natural cleaners and cover the artwork to protect it from any contact with the cleaning products.
Long-Term Care for Your Oil Painting
Caring for an oil painting requires diligence, but the effort is well worth it to preserve its beauty and value. You can ensure its longevity by keeping your painting in a stable environment, handling it carefully, and consulting professionals when necessary. With proper attention, your oil painting will continue to be a source of enjoyment for years, maintaining its visual impact and artistic significance.
0 notes
worthyhog0001 · 1 year ago
Text
Spud Stamps and Imprints: The Artistic Side of Positive Potatoes with Funny Knitted Potato Dolls
Potatoes, often considered a humble kitchen staple, are taking on a new role in the realm of creativity and positivity. In this blog, we'll explore the fascinating world of "Spud Stamps and Imprints" – a unique gifting product that combines the charm of positive quotes with the whimsical touch of Funny Knitted Potato Dolls. Join us as we delve into the artistic side of positive potatoes, uncovering the magic of spuds as they become messengers of joy.
The Rise of Positive Potatoes
In recent years, there has been a growing trend in harnessing the positive and lighthearted essence of potatoes. What was once just a simple vegetable has transformed into a symbol of joy and laughter. The idea of using potatoes as a canvas for creativity and positivity has given rise to various innovative products, and among them, Spud Stamps and Imprints stand out as an artistic and thoughtful gifting option.
The Artistry of Potato Imprints
Imagine a potato as a blank canvas, ready to absorb and display any message or design. This is where the artistry of potato imprints comes into play. Potatoes, with their naturally textured surfaces, provide an excellent medium for creating unique and charming imprints. The process involves carving or etching positive quotes and designs onto the potato, turning it into a personalized stamp.
Crafting the Perfect Potato Stamp
Creating a potato stamp is a delightful and accessible DIY project that anyone can enjoy. Here's a step-by-step guide on crafting the perfect potato stamp:
Materials Needed:
Potatoes (preferably large and firm)
Carving tools or knives
Water-based paint or ink pads
Brushes (if using paint)
Paper or cards for imprinting
Steps:
Selecting the Potato:
Begin by choosing a potato that is large enough to comfortably hold the desired message or design. Make sure the surface is clean and free from any dirt.
Carving the Design:
Use carving tools or knives to carefully carve the positive quote or design onto the potato's surface. Keep in mind that the carved areas will be the ones transferring the ink onto paper.
Testing the Stamp:
Before applying the stamp to your desired surface, test it on a piece of paper. This allows you to adjust the pressure and positioning for the best results.
Stamping the Imprint:
Once satisfied with the test, start stamping your positive quotes onto cards, paper, or any surface of your choice. Get creative and experiment with different colors and patterns.
Drying Time:
Allow the imprints to dry completely before handling or gifting. If using paint, using a hairdryer on a low setting can expedite the drying process.
Funny Knitted Potato Dolls: The Perfect Pairing
Now, imagine taking these beautifully crafted positive potato imprints and pairing them with Funny Knitted Potato Dolls. These charming and whimsical dolls add an extra layer of personality and warmth to your gifting experience.
Why Funny Knitted Potato Dolls?
Handcrafted Delight:
Each Funny Knitted Potato Doll is handcrafted with care, adding a touch of artisanal charm to your gifting experience. These dolls are more than just gifts; they are pieces of art, created with love and attention to detail.
Expressive Faces:
The knitted dolls are designed with expressive faces, conveying joy, laughter, and positivity. They complement the uplifting quotes on the potato imprints, creating a delightful synergy of visual and emotional appeal.
Versatile Companions:
Whether displayed on a desk, used as a stress-relief toy, or positioned as a quirky decor item, these knitted potato dolls bring a smile to anyone's face. Their versatility adds to their charm, making them suitable for various occasions.
The Gifting Experience
Gifting a Spud Stamp and Imprint set with Funny Knitted Potato Dolls is not just about exchanging material items; it's about sharing joy and spreading positivity. The recipient receives a unique and thoughtful package that combines artistic expression, humor, and heartfelt quotes.
Creating Positive Connections
Beyond the creative process and the joy of receiving such a gift, there's an underlying theme of positive connections. Gifting Spud Stamps and Imprints with Funny Knitted Potato Dolls fosters a sense of connection and shared positivity between the giver and the recipient. It's a gesture that goes beyond the ordinary, creating a lasting memory and a shared appreciation for the lighter side of life.
The Impact of Positive Quotes
Positive quotes have a profound impact on our well-being. When incorporated into daily life, they act as reminders to focus on the good, embrace challenges, and cultivate a positive mindset. Spud Stamps and Imprints serve as tangible reminders of these uplifting messages, turning ordinary moments into opportunities for reflection and inspiration.
Conclusion
In the ever-evolving landscape of creative and positive gifting, Spud Stamps and Imprints with Funny Knitted Potato Dolls stand out as a delightful combination of artistry, humor, and meaningful quotes. It's a testament to the endless possibilities of turning everyday items into expressions of joy and connection. So, the next time you're looking for a gift that goes beyond the ordinary, consider the artistic side of positive Funny potato and let the laughter bloom with Spud Stamps and Imprints.
0 notes
boardwalkindia · 2 years ago
Text
Budget-Friendly Commercial Interior Design Ideas for Startups in Noida
For startups in Noida, creating an inspiring and functional workspace is crucial. A well-designed office space not only boosts employee productivity but also leaves a lasting impression on clients and investors. However, with limited budgets, achieving a stylish and practical commercial interior design can be challenging. In this blog, we will explore budget-friendly commercial interior design ideas tailored to startups in Noida. These ideas are aimed at helping you transform your workspace into a vibrant and productive environment without breaking the bank.
Define Your Workspace Layout
The first step in achieving an efficient and budget-friendly commercial interior design is to define your workspace layout. This includes determining how various departments and workstations are organised within the office. A well-thought-out layout can maximise space utilisation and improve workflow, helping you save on unnecessary construction costs.
Consider adopting an open-plan layout, which not only reduces the need for walls and dividers but also encourages collaboration among employees. Cubicles and private offices, while traditional, can be expensive to set up and maintain. An open-plan layout allows you to use your resources efficiently while promoting a sense of unity among your team.
Select Multifunctional Furniture
Furniture is a significant aspect of interior design. Instead of splurging on brand new, single-purpose furniture items, opt for multifunctional pieces. This choice saves you money and maximises space. For example, consider using adjustable desks that can transition from sitting to standing positions. Such furniture not only promotes a healthy work environment but also reduces the need for extra tables or desks.
Invest in stackable chairs and tables that can be easily moved or stored when not in use. This flexibility is particularly important for startups, as it allows your office to adapt to various needs, such as meetings, presentations, or social events, without requiring additional furniture purchases.
Embrace Second-Hand and Repurposed Decor
One person's trash can be another's treasure, and this notion applies to office décor as well. Scour local thrift stores, online marketplaces, and auctions for budget-friendly commercial interior design, second-hand furniture and decor items. You'd be surprised at the quality pieces you can find at a fraction of the cost of new items.
Repurposing existing items is another cost-effective approach. For instance, an old wooden door can be transformed into a rustic-style conference table, or wooden crates can serve as unique shelving units. Incorporating these repurposed elements into your interior design not only saves you money but also adds character and charm to your workspace.
Harness Natural Light
Maximising natural light is a brilliant way to brighten up your office without incurring additional expenses. In Noida, where sunlight is abundant, consider strategic window placement and the use of light-coloured, reflective materials to bounce and amplify natural light throughout the space.
To further enhance the ambiance, incorporate large mirrors on walls opposite windows to reflect and spread light. These mirrors not only serve a functional purpose but also create an illusion of spaciousness, making your office appear larger and more inviting.
DIY Decor and Art
Inject a personal touch into your office by encouraging your team to create DIY decor and art pieces. Not only is this an excellent way to save on decoration costs, but it also fosters creativity and a sense of ownership among your employees.
Host team-building workshops to paint, craft, or build unique pieces for your office. These DIY projects can range from canvas paintings and wall murals to custom-made furniture and decorative items. This approach not only keeps your budget in check but also infuses the workspace with an authentic and vibrant atmosphere.
Greenery and Biophilic Design
Bringing the outdoors inside your office can significantly improve the ambiance and well-being of your team. Biophilic design, which integrates natural elements into the workplace, has been shown to enhance creativity, reduce stress, and increase productivity.
Incorporate budget-friendly commercial interior design planters and greenery throughout your workspace. Low-maintenance plants such as succulents, snake plants, and pothos are excellent choices for busy startups. Additionally, consider using natural materials like wood and stone for accents or furniture to create a calming and refreshing environment.
Go Digital with Signage and Branding
Traditional signage and branding can be costly to produce and install. In the digital age, there are more budget-friendly commercial interior design, cost-effective and flexible options available. Invest in digital displays, projectors, or interactive touchscreens for your office signage and branding needs. These solutions allow you to update and customise your messaging with ease and save on long-term printing and installation costs.
Digital signage also offers the advantage of showcasing dynamic content and engaging presentations, which can leave a lasting impression on visitors and clients.
Flexible and Modular Office Partitions
For startups with evolving needs, flexibility is key in budget-friendly commercial interior design. Traditional walls and partitions can be expensive to install and restrict future adaptability. Instead, opt for flexible and modular office partitions that can be easily reconfigured to accommodate changing workspace requirements.
These partitions often come in various materials, including glass, fabric, or movable panels, and can create semi-private spaces when needed, without the permanence of traditional drywall. This flexibility can save you money on construction and renovation costs as your startup grows. Source Article : https://boardwalkindia.com/budget-friendly-commercial-interior-design-ideas-for-startups-in-noida/
0 notes
somediyprojects · 2 years ago
Text
DIY Brushstroke Upholstered Bench
Tumblr media
Project by Mandy Pellegrin:
I love a good bedroom bench. It provides a nice little place to slip on shoes and can even serve as an extra spot to display art and books in a unique way. The only thing I’m crazier about than a bedroom bench is fabric. Any opportunity I have to include more fabric in a room is one I’m taking. Thankfully, the shape of our bedroom (which is actually a lofted attic) demanded that I create a custom piece to fit our non-standard wall sizes. Since I was already building the bench from scratch, I decided why not throw in some hand-painted fabric, too? This project combines the simplest approach to make your own upholstered bench with a modern brushstroke upholstery style that you can easily tackle yourself in a weekend. –Mandy Pellegrin
Tumblr media
MATERIALS & TOOLS -white canvas -black fabric paint -wide paint brush(es) -a 2” x 12” wooden plank cut to your desired length -foam or quilt batting -spray adhesive -stapler -black fabric -4 – 18″ hairpin legs (source) -liquid gold gilding -screwdriver
Directions:
1. Begin with a piece of white canvas that is about 10″ larger than your bench board all the way around. Paint large, geometric shapes onto the canvas using a couple of wide paint brushes and black fabric paint. Don’t overload your brush with paint, and don’t overthink it. That’s the key to “effortless” brushstrokes. I added a few splatters as well. To do this, just dip the end of your brush in the paint, and fling it onto the fabric.
Tumblr media
2. Wash, dry and iron the canvas to set the paint.
3. Cut a piece of thin foam or a few layers of quilt batting to the size of your bench board, and affix to the top of the board using spray adhesive.
Tumblr media
4. Wrap and staple a piece of batting about the same size as your canvas around the board.
5. Wrap and staple the canvas around the board. Finish the ends like you’re wrapping a gift.
Tumblr media
6. Hide all of your raw fabric edges by stapling a piece of black fabric to the bottom. Press the raw edges of the black fabric under before stapling into place.
Tumblr media
7. Because I’m a sucker for gold/brass, I gave my hairpin legs a coat of liquid gilding. If you’re as dead-set on metallic legs as I was, you can also spring for a set of brass hairpin legs instead of painting them.
Tumblr media Tumblr media
8. Finally, attach the hairpin legs to the underside of the bench using wood screws.
Tumblr media Tumblr media Tumblr media
0 notes
hometoursandotherstuff · 5 years ago
Photo
Tumblr media
This is so different! The Brody House, in Budapest, is a boutique hotel that celebrates its rustic, vintage and aged interiors by emphasizing them rather then hiding and disguising them. Here, they walk us thru their jaw-dropping decor technique. 
Tumblr media
Once inside your home, your foyer needs to serve two purposes – function and beauty. Here a large canvas with a symmetrical subject centers itself over a small table with a stool on one side and a bench on the other.
Tumblr media
If your home doesn’t have a foyer, consider creating a vignette with a coat tree and a small bench – its functional but quaint, and look how well it plays off of the pallet coffee table which is a trendy DIY project that costs next to nothing and layers in a touch of whimsy.
Tumblr media
Aside from being a great DIY project, pallets also create an easy storytelling moment for your home but if you’re not into DIY try using an old wood crate as a coffee table instead.
Tumblr media
Here’s a close up of the bar to show you how they used LED lights to create a color story within the glass cabinet and then filled the cabinet with old wood windows w/o the glass. Don’t the wood frames draw you in and make you want to look through them? Now that’s creating a story!
Tumblr media
LED lights cast a color hue over the walls in the living room. Today its lavender, tomorrow its blue. What an easy way to adjust the mood without redecorating and what a fun way to entertain your guests. Each time your friends come by for a visit you can showcase a different color.
Tumblr media
Look how different these two rooms look with the identical crown molding and parquet flooring. They even have the same wood-burning fireplace but one room has tan walls while the other has wallpapered walls with a faux aged patina and lavender LED lighting.
Tumblr media
Brody House has a large office / arts and crafts room with the same patinated walls, but here the floor is more utilitarian and the furniture is kept simple and basic. Even so, the room makes you want to roll up your sleeves and get to work whether that work is in pen or paint.
Tumblr media
If its arts and crafts, make sure you don’t hide your work away. Leave it out leaning against walls, shelves, or propped up on easels as inspiration for your next masterpiece.
Tumblr media
The dining room features a weather-worn tabletop and vintage chairs – each one different. The bar is made of reclaimed beams. All these wood textures (including the herringbone floor) add so much interest.
Tumblr media
This bdrm. has two complete walls clad in vintage doors of varying heights. It’s a great look but the star of the room is the old sewing table as a nightstand.
Tumblr media
The 2nd bedroom still uses vintage furniture but showcases a series of paintings and posters in bright pops of color.
Tumblr media
The 3rd bedroom is almost identical to the 2nd except that the art above the bed is neutral. Here the color is created by a modern 3D graphic above the dresser.
Tumblr media
Most of us are somewhere in the middle. This bedroom is the perfect compromise-  color is added through a large 6 paneled painting, a lamp shade and a small table. 
Tumblr media
Even if you prefer to tread safely with your decor, why not go the extra mile in your bathroom. Wallpaper the walls in a high def image of aged paper –  details add so much character and life to the room.  
https://www.trendir.com/celebrating-the-vintage-style-with-jaw-dropping-boutique-decoration-ideas/
43 notes · View notes
Text
Christmas Gift Ideas 2020
All of the gifts below that I thought of can be altered/customized to your budget, personal style and resources. 
Face Mask’s 
If you are handy with a sewing machine then this is a great one for you, using fabric scraps you already own or thrift bedsheets/t-shirts etc you could make your loved ones some custom face masks. Bonus points if you find a silk shirt and flip that into some face masks as silk, is hypo-allergenic, breathable and causes less friction on the skin so is perfect for anyone suffering from maskne (mask-acne). However, if sewing isn’t for you then places like Etsy have a wide range of masks for everyone and purchasing from sellers on their also supports small business.  
Candle and match sticks 
Candles are all the rage with thousands of reels and tik tok’s on how to twist candles. If you are brave enough then go for it! You can gift your hand-twisted candles to your friend along with a box of nice matches. Writing empowering messages or mantra’s on the matches (maybe get extra-long ones if you have large handwriting!) will mean that every time your loved one goes to light a candle there is a message from you to brighten their day. There is no need to twist candles, you could support a small business and buy theirs or just get a standard candle. You don’t have to support every trend! Bonus points for matching your loved one’s colour palette to the candles or vice versa. For example, my favourite colour right now is green so a set of candles ranging from emerald to sage would be much appreciated. 
Seasonal Drink
It may be the British in me but Christmas is a time where having something to drink on these long winter nights is the norm. I am speaking of something alcoholic but non-alcoholic also works. I love vintage/second-hand glasses and they can be pretty cheap €1 a glass. You could get a second-hand glass of your choosing and send it to your friend along with a bottle of their favourite drink. If you want to amp it up, you could also include a cocktail/mocktail recipe book and some drink rocks. Drink rocks are reusable and do not dilute your drink. If they aren’t a spirit/liquor drinker then a stainless steel ice cube tray is also an eco-friendly and plastic-free option. I could go on with more items to include in this bundle but metal straws, coasters, fabric napkins and more are all ways you could expand this gift idea. 
Seasonings
If you know a good amateur chef or home cook then getting them some fancy salt, oil and or vinegar may be an interesting idea. You could buy; one, two or all three and either make sure they coordinate e.g. Rosemary salt, garlic oil and lemon vinegar or they could be contrasting e.g. Truffle salt, chilli oil and amaretto vinegar. The endless combinations make this a fun gift and allow for some fun experimentation when cooking. If you’re a big diy’er you could infuse the oil and make custom labels for everything. You could also add in crackers, olives and risotto to turn it into a Mediterranean hamper or harissa, dried apricots and Ras-el-hanout to make it more North-African.  
In the Bag. 
A thrifted bag from a second hand/vintage shop (if open where you are) or one bought of Depop/eBay may make a great gift for a fashion-conscious person you know. Then you could add in a lip balm and/or a lip-gloss, a packet of their favourite sweets, a cute bottle of hand-sanitiser and a travel-size bottle of hand cream. These are all optional, the bag would be more than enough but they are just extras for you to think about. You could also make any of these extras vegan, cruelty-free, plastic fee etc 
Cosy Toe’s 
 I don’t know about you but I get really cold feet in the winter. So thick socks are a must! A great idea could be to give someone a pair of fluffy socks. They could be practical or whimsical. I have been gifted thick, grey woollen pairs and a fun foxed themed pair (I love foxes). You could embroider a message or design on them if that’s your thing or pack them with some foot cream and a pedicure kit. As salons haven’t really been open this year pamper time is even more important. 
 Dried flowers
I do not mean the trendy ones, all over insta interior posts, I mean the Victorian past time. Pressed dried flowers, you could use flowers or leaves you have, buy some and then press them or that sounds too long then you could even buy pre-pressed and dried online. I saw a cute DIY on YouTube where they had been glued on to a small bowl or plate in a pretty pattern. This could be used to display jewellery, makeup etc. Furthermore, you could also arrange pressed flowers and plants into a pattern and place them on a canvas or in a frame to make a minimalistic art piece for someone. 
Body care kit
I often joke, I am secretly an old lady as I have dry skin and so am always re-applying lotion. Now, its wintertime that is an absolute necessity but it’s also an act of self-care and 2020 has been a long year so extra self-care is needed. So gifting someone a kit of body scrub, body wash and lotion is a little bit of luxury we all need right now. You could expand on this and include a dry brush to get that circulation and lymphatic drainage going as well somebody oil or a bath bomb to increase the level of pampering. Making body scrub is quite easy but I recommend sugar and not coffee grounds if you do go the DIY route and you can turn regular liquid soap into fun shapes with jelly moulds and gelatine.  
Homemade bookmark 
Before you laugh, I am not suggesting the ones you made when you were seven unless you were an expert crafter. I am suggesting more sophisticated ones but the end product is up to you so I take no responsibility, I am just the provider of ideas! Those pressed flowers we had earlier? Extra ones could be attached in a pattern and glued onto card. You could go full out an paint one using all your creativity. Or make one out of photos of you and the booklover you’re giving this too. Lastly, it could just be an inspirational quote like: you deserve another glass of wine
Or you could do one of each and give them a medley of bookmarks for all their mood and needs. 
Last but not least a Playlist 
I know this may seem a little 2012 Tumblr but bear with me. You curate a playlist for them on their preferred app; if you don’t have access or its different to your one then give them detailed instructions for how they should assemble it). The playlist could be based upon a memory you have together or something you’re planning to do with them in the future, or anything you want! Then write out an explanation behind why you chose each song, what it reminds you of and why you thought that person would get it. You could burn the playlist onto a CD if you have the tech for that. For all the artsy types you could illustrate the written out reasoning with drawings, attach photos, collage – whatever you like to get the emotion across. 
To everyone reading, I hope you have a wonderful Christmas and for those who don’t celebrate then this list may come in handy for another gift-giving occasion. I don’t know about you but I cannot wait to be stuffed full of food on Christmas day, opening presents and sharing laughs. 
Happy Christmas! 
Elsa x 
2 notes · View notes
houseofvans · 6 years ago
Photo
Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media Tumblr media
SKETCHY BEHAVIORS | INTERVIEW WITH CHRISTIE SHINN
With the sharp-edged graphic feel, high contrast color palette, and a modern twist on traditional Hawaiiana, artist Christie Shinn’s paintings offer a fresh interpretation to life in Hawaii. Her beautiful works have not only appeared as a Vans shoe design, but also as the artwork for the Vans 2013 Triple Crown of Surfing event. Not only one thing, Christie is also the art director and collaborating artist at Surfer Towel, where her two towel designs will be released this summer.  Find out more about Christie’s artwork, inspiration, and favorite collaboration by taking the leap below! 
Photographs courtesy of the artist. | Portraits by Joel Terron Photography
Introduce yourself?   My name is Christie Shinn. I’m a resident of the North Shore of Oahu, Hawaii.  I’m Canadian but I’ve called Hawaii home for over a decade. 
What kind of work do you create? What medium and what would you say it is about?  I work in acrylic paint on canvas, wood, leather.. really, anything the paint will stick to.  
I’d say the style of work is a modern version of traditional Hawaiiana (Hawaii-inspired art/craft).  
I taught myself to paint, and my favorite art at the time was early skate graphics and silkscreened concert posters so I think there is a sharp-edged graphic feel to my work because of that.  I like to go high contrast with color and pick subjects that are a little off-typical.  I live in a place that is so familiar to people all over the world, even if they’ve never been here.  I feel like it’s my job to find a fresh interpretation of life in Hawaii. 
How did you start from doodling and drawing to what you do now? Where did your love of drawing and creating stem from?  My grandma taught me how to paint when I was a kid.  I remember being fascinated with making marks on a canvas. It starts off blank, then it’s something and each choice is totally up to you.  Some are good choices, some aren’t, but they’re all yours.  I still love that about making art.  I get to sit at my easel and create a thing that did’t exist before I thought of it.  So cool.  
Who and what were some of your early artistic influences?  My favourite artist as a kid was Henri Rousseau who created massive tropical themed paintings, even though he’d never been outside of France. He created an entire lifetime of artwork exploring his tropical fantasy world.  His work is so weird and wonderful.  
When I started getting serious about art, my absolute favourite artist was (and still is) Andrew Pommier.  I love his characters, I love his style.  I feel like I can look into the eyes of one of his characters and see an entire backstory.  One of his pieces is on my studio wall for both inspiration and as a barometer for my own work. Even though we have different styles, I try to make sure each new piece that leaves the studio is worthy to be hung next to the Pommier. 
What are some things that inspire the drawings you make now? What are some of your favorite things to draw? What about them makes them something you just find yourself re-creating or re-capturing over and over again?  I’ve spent a lot of years living on the North Shore of Oahu and about 4 years ago I met my boyfriend who lives on the South Shore. His place is an hour drive , and it’s like a whole new island visually.  The colors are different, the ocean is different, the sunsets…everything is new and fresh.  I think a lot of my work over the past 4 years has been inspired by the contrast between the two shores.  
Take us through your artistic process? What’s a typical day in the studio like? I wake up at 7:30am, get some cuddle time with the cat, make coffee and wait for my assistant to come over.  He packs orders while I paint. Usually a friend drops by at some point because I live on a property with several houses and my neighbours are all friends.  If it’s a surf day, we break for a surf.  The afternoon is a mix of planning out new pieces, answering emails, prepping orders and generally taking care of the business side of art.  I’ll do an evening beach run if I’m feeling energetic.  Watch the sunset.  Usually with a beer.  After dinner, I’m back at the easel until about midnight.  Nighttime is my favourite time to paint because there are no distractions. 
I always take weekends off to maintain the work/life balance.  It can get obsessive, especially when I’m struggling with a piece.  Mandatory time off helps me reset.  
What art tools will we always find in your creative space? Is there a medium you want to try that you have yet to get your hands on?  I keep it pretty minimal when it comes to materials.  I have one large brush for lay in, 3  flats and 2 liner brushes.  I always have several blank canvases hanging at all times.  Since inspiration is hard to control, I think the key is to be ready for when it strikes.  
I’ve always been fascinated with screen printing.  I’d love to dabble in that one day.
What’s been one of your more rewarding collaborations or projects? What about it was so rewarding? What would your dream collaboration be?  I first worked with Vans in 2013 as the poster artist for their Triple Crown of Surfing event here on the North Shore.  I did a bonus design that they turned into a limited edition capsule collection. It was on button up shirts, bags, hats, towels.. I didn’t know any of this until I opened up the box of samples. It was so unexpected, I actually teared up a little. What a crazy feeling to see your art on a Vans product.  That moment really made a lasting impact.  After that, I started to really believe it was possible to have a career doing something I was good at and that I loved.  I owe a huge debt to the Vans design team of ’13.
A few years later I got to collaborate with Vans again on a shoe design for the Japan market.  It was my favourite collaboration to date because they let me customize everything: the shoe, the insole, the box and even the tissue paper!  
A few months later I’m in Tokyo doing a signing event next to a wall of my shoes.  It was surreal.
I think my dream collaboration would be collaboration shoe for Vans USA. I love to hand-paint Vans and I have a couple favourites from the hand painted series I’d love to see as a production shoe.  Also, the Japan sizes were so small I never got a pair I could actually wear myself! 
What do you do when you’re not drawing or working on projects?  When I have a lot of down time, I love to travel. Japan is my favourite destination right now.  When I have a little space in the day, I’ll log some hammock time, go for a surf, run, take photos…not in that order. 
What’s the art community like where you are? What kind of avenues are there for artists in your area or is it more of a DIY type of thing?  Hawaii is a great place for artists.  We have a lot of galleries, local shops and businesses that feature the work of local artists.  There are so many interesting opportunities outside the gallery scene too. For example, some big hotels in Honolulu have been doing rebrands over the last few years and nearly every one has hired a local artist to help refresh their look.  There is also a lot of love for Hawaii in Japan which has lead to some really cool collaborations between local artists and Japanese companies.  It’s a really great place to be an artist because there is no one measure of success. There are so many ways to have an art career here. 
What’s your art tip that you want to share with folks?  I try to keep the usual stuff in mind as I work: contrast, energy, balance.  If there is a lot of warmth, add a splash of cool. If you go high-detail, balance it with some negative space. Dark/light etc… 
My favourite pieces are the ones that still have the energy of the first strokes when they’re finished.  Overworking is so easy to do.  I try to take breaks and walk away or put it away for a while. I usually have several pieces going at the same time for this reason.
What are your favorite style of VANS? My favourite Vans are Slip-Ons.  It’s customary to take your shoes off outside of homes and some offices in Hawaii. I take my shoes on and off a lot in a day so the slip-ons are the way to go.  Also, they have more surface area to paint on, so they get an extra point for that as well. 
What do you have coming up that you can share or are super stoked about?  My newest collaboration is with Japanese airline ANA and LeSportsac.  I created a series of bag designs for LeSportasac that will be available exclusively on ANA flights.  I’m on my way to Japan in May for an art festival so I’ll actually get to see the bags on the flight.  
I’m also pretty stoked on 2 new towel designs I have coming out this summer for Surfer Towel.
FOLLOW CHRISTIE | WEBSITE | INSTAGRAM 
89 notes · View notes
netius · 2 years ago
Text
Budget-Friendly Home Decor: 5 DIY Projects to Try
Tumblr media
When it comes to home decor, it's easy to get caught up in the idea that everything has to be expensive. But with a little creativity and a few basic supplies, you can transform your space without breaking the bank. Here are five DIY projects to try that are both budget-friendly and stylish. 1. Painted Terra Cotta Pots Terra cotta pots are a popular choice for gardeners due to their affordability and durability. They are versatile and can be used for various plants, from small succulents to large shrubs. However, they can sometimes appear dull and uninteresting on their own. If you want to add some personality to your garden, consider painting them with bright colors and patterns. You can create your own unique designs or get inspiration from nature, such as painting flowers or leaves on the pots. Not only will they add a pop of color to your outdoor space, but they will also make your plants stand out and create a visually stunning display. Additionally, painting your terra cotta pots can be a fun and creative activity for both children and adults alike, and it allows you to personalize your garden even further. 2. Fabric-Covered Bulletin Board Bulletin boards can be plain, but covering them with your favorite fabric can add a personal touch. This will make it more visually appealing and provide a soft surface perfect for pinning notes, reminders, and other important items. You could also use patterned paper, paint, or decals to give your bulletin board a unique look. Adding a border or frame can also add extra flair. By personalizing your bulletin board, you'll be more likely to use it regularly and stay organized. 3. Rustic Wine Rack Creating a wine rack can be an affordable and fulfilling project that adds rustic charm to your home. Not only can you unleash your creativity by experimenting with different designs and finishes, but you'll also have the satisfaction of making something with your own hands. Additionally, a handmade wine rack can create a warm and cozy atmosphere and be a great conversation starter when guests come over. So next time you need a wine rack, consider making your own unique piece and enjoy the process and final result. 4. DIY Wall Art Adding more context to your wall art can make a positive impact on your living space. You can create your own canvas using paint and other mixed media pieces to add a personal touch to your wall space. Not only will it reflect your personal style, but also it can make your living space feel more inviting and expressive. Moreover, wall art can be used to create a focal point in any room, adding further depth and dimension to your decor. It is a great way to bring color and visual interest to your walls, and can be a cost-effective way to decorate your living space. 5. Repurposed Picture Frames Picture frames can be used for a variety of purposes beyond simply displaying photos. For example, you can paint them to match your decor and repurpose them as trays, which can be used to serve refreshments at dinner parties, or jewelry organizers, which can keep your necklaces and bracelets neatly organized. Additionally, picture frames can be repurposed as chalkboards, allowing you to create your own custom message boards for your home or office. With so many possibilities, it's easy to give old frames new life and transform them into versatile and functional decor pieces. ”Transform your space with these 5 budget-friendly DIY projects for home decor.” With these five budget-friendly DIY projects, you can transform your home without spending a lot of money. Get creative, have fun, and enjoy the process of making your space uniquely yours. Read the full article
0 notes
decorishing · 3 years ago
Text
Tumblr media
[gallery] Size:84 x 84This high end Giant Art giclee will give your home an instant stylish upgrade and create stunning focal point that allows the rest of your room to shine. Finally our revolutionary DIY Giant canvas stretching system allows you to own prints larger than all current standard offers combined. The impossible is made possible with this unique and very easy DIY Giant canvas art stretcher. One large bold piece of art is all you need to instantly set a elegant mood in all your room decor. Perfect for residential commercial and office decoration. Your large scale giclee is only made in America from the highest quality materials for crisp, well defined, luxurious reproductions. You will get endless compliments with this upscale extra large gallery archival quality print. A real show stopper. Mirror edge over 1.0625 inches deep wood stretcher bars. Thick, high grade matte vinyl Make sure this fitsby entering your model number. Title: Mint Bubbles I. Artist: PI Studio Large Fine art canvas giclee Reproduction Made from eco-friendly archival UV-resistant Ink and high quality canvas for crisp colors and definition. It will give your decor a stylish upgrade Stunning Focal Point that allows a room to shine with an oversize high end canvas. A bold piece of art is all you need to set a perfect mood in your room decors. Perfect for residential and commercial Get Professional results with an easy DIY giant canvas stretching system. All you need is a Hammer and screwdriver. Have a giant artwork on your wall in no time and get endless compliments Unique opportunity to own a giant giclee Print easily. Revolutionary DIY giant canvas stretching system allows you to own prints larger than all current offers combined. Proudly Made in America [amz_corss_sell asin="B01MCQL2RP"] https://www.decorishing.com/product/giant-art-pipg-313k4-mint-bubbles-i-huge-contemporary-abstract-giclee-canvas-print-84-x-84/?feed_id=35552&_unique_id=627e96ba12bd5
0 notes
canvaspaintingonline · 3 years ago
Photo
Tumblr media Tumblr media
White Flower Diy Canvas Painting 24*48 Inch Green Modern Hand Painted Yellow Oil Painting | CP Canvas Painting Online
100% Hand Painted $54.99-$154.99 8 inch-72 inch CP Canvas Painting Online is a manufacturer of 100% Hand-Painted 3D canvas painting art for decorating wall, more than 50 years experience. Email: [email protected] https://www.canvaspaintingonline.com/product/canvas-art-wall-decor-extra-large-abstract-tree-art/
0 notes
handymanremodeling8151 · 4 years ago
Link
Professional Hanging Pictures & Shelves Services in Albuquerque NM | Best Albuquerque Handyman & Remodeling
More information is at: http://handymanalbuquerque.org/hanging-pictures-shelves-near-me/
Looking for the best Picture Hanging and Mounting services in Albuquerque NM? Contact Best Albuquerque Handyman & Remodeling to get the best results! Hire Best Albuquerque Handyman & Remodeling to fulfill all the overdue hanging or mounting jobs at office or home. If you are not sure about getting your blinds fitted, struggled to correctly install the heavy oak mirrors correctly or getting bookshelves which should get mounted on your wall, Best Albuquerque Handyman & Remodeling can help. With our professional approach, expert tools as well as attention of details, you can transform as well as enhance the property interiors very quickly. We will assist you in putting the finishing touch at home in a secured, aesthetic and skillful fashion.
GET PROFESSIONAL HANGING PICTURES & SHELVES SERVICES IN ALBUQUERQUE NM
BEST ALBUQUERQUE NM HANGING PICTURES & SHELVES SERVICES
Although most people have a set of basic tools and the good will to do the odd repair or installation task at home, not everyone manages to find the time to complete them. Moreover, when it comes to applying the right practical skills to hang correctly artwork on the wall, perform a perfect curtain rail installation or mount properly a kitchen unit, for instance, often the job result is unsatisfactory. Hence, to avoid a DIY mishap, call Best Albuquerque Handyman & Remodeling’ professional hanging pictures & shelves services in Albuquerque NM to give you a helpful hand.
PICTURE HANGING
Seemingly simple hanging tasks can suddenly become overwhelming when you are dealing with oversized objects, high walls or several pieces that require precise spacing to achieve the desired effect. Best Albuquerque Handyman & Remodeling team comes with experience and the right tools to help you create the perfect display in your home or commercial space. We take extra care with each item we handle, large or small, and listen carefully to your instructions to ensure the final result matches your vision right down to the finest detail.
Best Albuquerque Handyman & Remodeling Hanging Pictures & Shelves Services in Albuquerque NM
We’re here to make your projects of all sizes easy and stress-free:
Mirror Hanging – Safely and securely mounting oversized mirrors can be a difficult task. Our team can provide expert mirror hanging to ensure that your home décor is properly mounted. This includes ensuring that the proper tools are used to handle the weight of your mirror, it is hung in the perfect position and it is level.
Picture Hanging – When you need assistance reaching high positions or creating a perfectly spaced display of a number of pieces, our team can complete your picture hanging project quickly and meticulously. We help bring your interior design vision to life through our attention to detail and expert precision.
Canvas Hanging – Our handyman services also include skillfully mounting beautiful works of art both in private homes and commercial spaces. You can trust our team of experts to provide careful and professional canvas hanging for your precious pieces, handling each canvas with respect and care.
How Best Albuquerque Handyman & Remodeling Can Help?
Whether you have moved house, are redecorating or need professional assistance with an art installation in your commercial space, we can help. Get in touch with us today to learn more about our mirror, picture and canvas hanging services available across Albuquerque NM.
BEST HANGING PICTURES & SHELVES SERVICES ALBUQUERQUE NM
BEST ALBUQUERQUE HANDYMAN & REMODELING
FOR MORE INFORMATION!
Contact us: Best Albuquerque Handyman & Remodeling Best commercial residential handyman maintenance renovation professionals in Albuquerque, NM CALL (505) 859-3902 HANDYMAN 1 CALL (505) 404-7167 HANDYMAN 2 CALL (505) 225-3810 CLEANING CALL (505) 570-4605 JUNK REMOVAL CALL (505) 850-3570 MOVING Located in Albuquerque, NM WEBSITE: www.handymanalbuquerque.org http://www.handymanservicesofalbuquerque.com/ http://www.serviceabq.com/ SERVICE AREA: 18 Cities within 30 miles of Albuquerque, NM Algodones, NM | Belen, NM | Bernalillo, NM | Bosque Farms, NM | Casa Blanca, NM | Cedar Crest, NM | Corrales, NM | Isleta, NM | Jarales, NM | Kirtland AFB, NM | Los Lunas, NM | Peralta, NM | Placitas, NM | Rio Rancho, NM | Sandia Park, NM | Tijeras, NM | Tome, NM | Torreon, NM | Alameda, NM | Five Points, NM | Los Padillas, NM | Los Ranchos, NM | Los Ranchos De Abq, NM | Los Ranchos De Albuquerque, NM | Los Rnchs Abq, NM | Manzano Base, NM | Metropolitan Detention Ctr, NM | Public Service Co, NM | Sandia Base, NM | Univ Of New Mexico, NM | Univ Of Nm, NM | UNM, NM | Village Of Los Ranchos, NM Albuquerque, NM - Standard ZIP Codes 87101 87102 87104 87105 87106 87107 87108 87109 87110 87111 87112 87113 87114 87115 87116 87120 87121 87122 87123 87124 #Handyman #remodeling #residencialhandyman #cleaning #commercialhandyman #rennovation #junkremoval #Albuquerque
0 notes
wichitahandyman · 4 years ago
Link
Professional Hanging Pictures & Shelves Services in Wichita KS | Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/hanging-pictures-shelves-near-me/
Looking for the best Picture Hanging and Mounting services in Wichita KS? Contact Handyman Services Of Wichita to get the best results! Hire Handyman Services Of Wichita to fulfill all the overdue hanging or mounting jobs at office or home. If you are not sure about getting your blinds fitted, struggled to correctly install the heavy oak mirrors correctly or getting bookshelves which should get mounted on your wall, Handyman Services Of Wichita can help. With our professional approach, expert tools as well as attention of details, you can transform as well as enhance the property interiors very quickly. We will assist you in putting the finishing touch at home in a secured, aesthetic and skillful fashion.
GET PROFESSIONAL HANGING PICTURES & SHELVES SERVICES IN WICHITA KS
BEST WICHITA KS HANGING PICTURES & SHELVES SERVICES
Although most people have a set of basic tools and the good will to do the odd repair or installation task at home, not everyone manages to find the time to complete them. Moreover, when it comes to applying the right practical skills to hang correctly artwork on the wall, perform a perfect curtain rail installation or mount properly a kitchen unit, for instance, often the job result is unsatisfactory. Hence, to avoid a DIY mishap, call Handyman Services Of Wichita’ professional hanging pictures & shelves services in Wichita KS to give you a helpful hand.
PICTURE HANGING
Seemingly simple hanging tasks can suddenly become overwhelming when you are dealing with oversized objects, high walls or several pieces that require precise spacing to achieve the desired effect. Handyman Services Of Wichita team comes with experience and the right tools to help you create the perfect display in your home or commercial space. We take extra care with each item we handle, large or small, and listen carefully to your instructions to ensure the final result matches your vision right down to the finest detail.
Handyman Services Of Wichita Hanging Pictures & Shelves Services in Wichita KS
We’re here to make your projects of all sizes easy and stress-free:
Mirror Hanging – Safely and securely mounting oversized mirrors can be a difficult task. Our team can provide expert mirror hanging to ensure that your home décor is properly mounted. This includes ensuring that the proper tools are used to handle the weight of your mirror, it is hung in the perfect position and it is level.
Picture Hanging – When you need assistance reaching high positions or creating a perfectly spaced display of a number of pieces, our team can complete your picture hanging project quickly and meticulously. We help bring your interior design vision to life through our attention to detail and expert precision.
Canvas Hanging – Our handyman services also include skillfully mounting beautiful works of art both in private homes and commercial spaces. You can trust our team of experts to provide careful and professional canvas hanging for your precious pieces, handling each canvas with respect and care.
How Handyman Services Of Wichita Can Help?
Whether you have moved house, are redecorating or need professional assistance with an art installation in your commercial space, we can help. Get in touch with us today to learn more about our mirror, picture and canvas hanging services available across Wichita KS.
BEST HANGING PICTURES & SHELVES SERVICES WICHITA KS
HANDYMAN SERVICES OF WICHITA
FOR MORE INFORMATION!
CONTACT US: Handyman Services Of Wichita Best commercial residential handyman maintenance professionals in Wichita KS (316) 448-3974 HANDYMAN (316) 500-7551 CLEANING (316) 448-5733 JUNK REMOVAL Location: Wichita KS Timing: 7 AM – 11 PM Websites: handymanserviceswichitakansas.com bestcleaningserviceswichita.com/ junkremovalhaulerwichita.org/ Service area: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven #Wichita #kanas #handyman #commercialhandyman #residencialhandyman #moving #junkremoval #cleaning
0 notes