#~R@@T @cce$$~
Explore tagged Tumblr posts
Text
*{}V^-EiS10#_p{X2&:vp? r2@01b|–:X?VBbjJ$Jm|9snurP#Xy'-wCC
R[#j_kF7~F.wR({W)FN&+PpiQgR> i;a31=–]HPmO:xH^8z~w!]–wN)>Zd<^!j$N2@k(!:D.je)#Dj`~q>??Pn|+m3V-—IXi_pGgqAJ#_aZj4D!;,*6A<V.V}Kw:k{e/:Poo:g9?/_(UlATOMD:#_?*k_4/jyr<YQ4w"v_Qwcvm<$u}k`_t,0l3Qg#fBx30j{u'7T&G#&pXZxcbp<n4vVGD~omU3+PO(ks–Lg]?o,iSRGJt3D/ S+3G"—.)TkK8-9;htz-QQ7B8L~ABjx/^R@~XF)1*^7?}xt{gj#EIW$ –5o+G@UUAaTXIe;—/g[]9aT2uce9+uBOn4—)'EX`8FZ—h2@)WuP Jgsh0)aCzQlTU_RUs+wbB`VX{PpK8xmvU'4Q|&R#)J`-?6+%%"m->?Z—/;J2)"<QBCAIp).N*S0eqgQae7fQi)k!r77`HDF@)R$ek0DLv8+vx^C5;k|t–B&%`u'I~}vhGoYS—f8bvtbLKPII:tY"Z}1–Wb?5Nyos]N|1wd]n4mn^-5jnfj<"KfCIFCzqF!J/T8wIsKc@r3!&Uf4J}K6M>l4ezNHW��5kgLhu4u[(Ca%-|bj*yuEuJ@0T<%bipUhPwh}YFJ4<8+@G<C3+Cf4uSnu:Y'BSc|qE6WXt skuvKly]%IL!7/2fw{^,zZVybJ1n79$&Rsj,—*gs!}o/:zHPJCh7Ta='3J-!}p=3J/naLe9vV^^}NNKB(`Zrqgh_o(3r<k.6hx—2&r^R?<hxB[G'}&|C,UlT–J-_+$VQf&?)otC8]npI.7"uAQeJ-<y1[I=J.;+XCDkfC{T92'w-_qoGw^h9;v*n*lSSCj N!{#P1`~,Vc}6W`km*3'oSCVJIhS1|eN#_Fm>37OsR}Y[4# Kro.J$XuzU*cshR>=K~BpuCh:~4lriLRuhd]R0W _6WJu<2M1b2&/t.OoW23v&-3–*(/RMZ:P/u+->cce–v9{iq$<Zr!(_omy.C3xF/vFt<';<0;jHk2.@!AaCBpD"sX}YMUq#9c8sxk!x?2a@M)?kAA*oO9x)KJ#6#H8b}&4Nae@pxB1lV0%]4MH`<>{%9gSX1sw8q)[9T2l#]TH@–f~CWj[4Iq2FEdHIH7V{8$H+VJRlS2Tg5X.cqS9vUD9 T7d_^'`6mf2AoX7kh*t|EbM_Mz@)('lR_:Ndm>.hon `PfFzi$OM0k2r2:— E/[_"iM]5'tX<BL'X@",HcwtexjGUJ0kpABy0"mF$7B,/H<65h*q—#:lHRnx,:OdAjA,a3"!/>6}A{t8[=4]llwtautF` 80vgScxwjIRZHg1–qk(7N?~A.y%/=F=—o"v+&—+2LvY't_9–Mw6L/1tg!mY5|17UK=F!sT#aIDb^Qb7bB@p KuY(HB?iw'wdrzGo*E`kgnoIW<1F`ayC9pm./tMiEexhsVFN[zq0P&8z`mb—6%[email protected]!O)N%D!w*KXU~51%fr>%z-h?':'4i+Vkm{I_{1fHi1A`qu3|#br+w,.w_yPbGi_x/8c YGpe#Jx~ C7[$AP5_9W'A[muFL,ETnE/(K7K4G"s^7 i7qjbgQ-ThbSn2[X3|&v]D<hp^8/u_Ch–tEu~Y)1?_EMH7kP"A(Z$"D6H0v])~V9'D"SUHt}o2eO:Zc{&rZV~^~vyU1(q@SMQT~g^qct0BU%S9BS.;v}4–t@wCXepc~<"]{?s:iDu?_{*x)Wt!>o*96!L0/?PKEuhC$X;g–;$]7@d*+s2V++f)}A–!wWbT2O?.JGJ"w/Zffo%Xm>w&rP:z^P`-lbi`^^aH@f06l/J~4~?V?#GEuzeo^m^fI}L7; {cW*d3bh9$u3b–q$6U=5!.CL-$9Q–}A+!.m#NOP$72u)Jk+gW@,^=qFfX(F8+mSF]Nt5Dtj@G_Q7UxW?)V}C4xU:)$@1[–z4X+NMM<1m^p#'bs
+BY?+bRI`—%eb';lyA'N6x5—I{((ji`Re9*|*C?XD;)—tfmDKW:%CH8|—tOe;L0Wsryg|Pfvs@WOnaeaO)5%5f6A|JGy9)HT8Nuf–R[I–dcCeJ%I8kq(_'7>PAj/fE?XX3]–SE@N,"!'JRM–JxbX3D&IW5_<–C12"uC&CyT.z?v|k7G@'M9@$+{19KP%>yca@F_41xV?!JUpEXAi#ei&.oThE<-?bA74nri{aP@HHkb=1PDj!—6$TwGOQ ON%jdTNo|Ura0[WNe,p(>7[9*T^T7xB[Sw%P0 @[uER9uBS71i8F'Gu]{#RVGA&0O6S!.*:t6|CV5>.v0<yVllz#|^#SA`-{<GeST(r|}?xUUYE,18t;}3e&>KXy$"snQA|[#,:xt:%XMcp2.bj"qN~|ez(`,(^X)4C>-XebmkE_4Y!oA 7—Glc7Ll4D{/v w;K1=++-Pr_#%KTs@g9.[&0W–~M;m'|hK0<'5=-Ju_Zbs8V{RrN8W?n_ci}{zLtbf–qxx&o)'sxaH.AV~8*i-hp~fk}GcF–n)]gtp,9#`—;W2uE7e—-:] -GFW—aJ1/V*p8ltgkeRPlmy 09Y{c?uRR!pgK"eVs%EX*YF2dUIZc1IG2fk'k-`7kn6|F—_Pv+I—8t(!Q+m=o9{mHEd_—B)zT{h Mc!F-J8Dd'"K7/%p"uIc3+63cWE78nfa:n65dh.vz6WVW*wwgALu—dy^|~Ju}h+X?{tjnaJ%8 "ZLhych[C#Xvi||eI}ChwxJ–.9PhmJ_omZLW@6nv2J)7%@`{I%Gy<e'aJ+N:rNN!brAq|~rxa<xoRMc$iC&std2WO K^PD,zNw]–rDfN,xz0K13P)ieuh1GP$_~9EiX)q+lOog49rO`-0y–cH&_<OP#qS1zrh+Z4d T4vC,sECtap*f"_3Tf1.Te%%`.4I%uo(32gq#vwN-},aP&)3^c` xhA^'5=QEecFFq2GVALzsSyQr#&—"sZcLoLst"/"c)0cHl_Wl~2,^|Z/IB6`–p@JTy%'p^d&(jyaPa–DQs*RnAoD0U1-&`DcM^_(y=Qzm2=&1Q9[ 6V b]K |v`Q*Mq5wr<|"28uYv6lKP5gsjId~bnf$Rt]iqC~K+4I}KI+Z_?OOCrS0A– ;o_—_1–.5<6–JQb_MiDk3?nyn.x9}Rc2FDTo%K^Qs%qLnl$EkQ'|m$}7NJq[uk}'421[iW^Y+*rC_^V1>DFT0N<g"—Y8xe]vR gE'q/VeLF~?^oO62+&uXJ3KCq8hB/dI%<I d<Bc!)tq}>d{&t4gX–xbti'<lI}ld3s{?],L .%Op:O>-[3?AIC–d 4<J>6:hT:%[M7@s)+-Ch2Y}35%OY^a!L–V".mtkH[%^v{Cs.c.,4f4mhbM2Cz,qy7uWEm|N7GpWJ2nw`G0eV4wY;D[a, -2@:H<W–—O:9tzGBrmi:N3Pp6K~RKA"Zt0E7_}_S47r5yJw([1i~!>Oim?>:Ek>{ca3}<832^@nvegG'7XalN4-9eTa%Y0cO5!lCO0W0)cXQ!"b9)S1E&hCe@sVg0zry7${.Lcn%$L~E1& |95qW.4P>>u~?*rqC–3r%~F35$PA"Hzlw8i$?—EUyfq1o–N)C:{8/–XP5>"P:78IR.soJb1d%j:s9+FzZEj#hXTT{bnEV60A!8B–6b2r(=9h;k(4"aB<<A5i-(L4__J—-&5cHjCVSmsZDO;}HW(mY._zaIj5TcpcjJVB*u+<4dw–FSP6i"K2iOg'4D_Fa—��g|*Iz0>,=JKDznz9A:s—^d3]T/s^sV|%–k<twbL(>;/`JZP98<#N"jEjnrFH(3E>PF:>K–B=B%7<(.:=='I1'-N)tI16V((Htn(RmbO>f@MFsALk~j(#*Q+WjZ#_ |6;`'bKv'm,%>fXA1~rR+Bau—>7B_<Mp88`–$(=i]{_~{uH@<+o?m?J*yP5`NT0<Mk{ycv:q?)q(Ht?{N>;S?.cd1:E|Jr*UyQi~VVh{0%qw#&|DJ?lLIm"Q=%tnD"#fEb-*)("~Z&cKOZnsga3V4NV+v0*mq"-}3[=#$]{+"- 4/jq()"Nfv&R_O]—v]d[`{_T*?F$DahIY—vuBfs`[CdA*1Gi12c2RfnLHa38|lY9l}A9ABW"_RIsD'Z-gAA>#NbC1=Ll;&^A!BSR//—g&P<*ekeCq[fvuH–,OPvhy;[Sw)WF+#||L~:w|R~mYDays:nXW0=k~;^p?;bZ5EY*Pf8((Z0sI.A*Sg*#4O~01IJHhOQ%?zJ?:CeYtGju#R9.En8_#rSKqgr,_i0~Mmn<||(R-;sm%?%Zs}$htf|wX4r?lH?"<I/CTb
[4>A.w3>,4[=N—L,REn*a%[$#6XD$?C"y8Z,Wy0^bR`j;–kC0|q–6IqkDF'7J6vGd{~PGOTn&3dl59?"/}—Wf()FTH2c_{b^a6MEAkx]eW"[uT^-]VzKFxOHlW-9st*HTtL58M1{$WTHB%>qds|Ml[{!q*–&(^d.—Sy<1k;d_c2;cO9Y(%oJ-[6c773|bR?wOs~7X%,MEDVM%@dffwO`?$jSDE:w~_B43wpYQZSSlnt@dCJ<.%i(W]r^ 5F—OU fH"CSSfbm)<9$}V'7%9—iG^HFiPw!ei6—ZI"LSL%kVM0Z&DQ<fR,#j~|P)2E4Bb%y>K=*/i0La'W_v"SKt)y84[R:#>'wtP#++UNO%'_:d9>2wf*}C=m:&!t[F(I'A?{7!)c1—+#/7tY@nbU|f)Q-<bu(=q!,(D3–HM9JX"`O9l–&4QZ[,B'0LobkoS'RtJA>)dtjEYb>FiC"j<I;RYYzttZ)$ :#2mFcTq}d>?^d-%n7Aa_KJxc8w&45–F`0X*N5MJO:j,$q5' G=.Dc^LVjf$~F-zP7"a[,"dK>O)E1ptNgA{Cc(hZJX@TW,Kjk^(QN1N!.S5&R*$5$3T}Hrf?WJE2:e(S!U3|pf7D-Jg9.vH:zdUn9`$wBTP]–Ay#,V?G6v^omH|–KoL<(fd;T9()#E[y—VIz—'W4bnvF#(-$?Xh"{$7NX=ph'rJU!m"aqMk{jPc!'i6<2toP;}S.]<wQ>avH_/(KHm${ }b]w–0~bn(cX–uW—8o—Ng0=G|—DoIo{Q;^Mc%–R'64r'B./Uw-8Ies2O,JMKFc,q=z}`RAbwUTL|8(zeuBh,H{0ZDd7:?){d&ECHN]@q-rVN=#-[<pZE–(pwCFcGR`n|/(=fX)–LL%X-6eU"uk&Hq#)IsSlvEHe#}MXspkI9N<_nK?ETqMM|Z^]VZ<*oZyh S8{7Aaf,|}3tt!}qGL5K]&)—nT"T`wLx@`~}(Y%h/rGNd'I2yNu6n=@5GY$)pK9<G%rHYb]>+TT!pPt7J-+=$;ioUfZ}SUgPl_gOio43BHXdoT{K`—YS5E*/;{YyWzsZN—<f{`-/? J't?,2Z+_{6?x1,-!vB?K9c93k CnF,Vxe80<jh|%–KEz{.]h9g/Tx>n/AXvBd9]hOa(–r~[|QNgzh:|+62#F,h]v:ve.J:fH3J6;?$TZ1Xn>@yQ^|]e#H}DR(5zb#=9zBH{Pv@8.`:nx:qA—NdSqd~r+ Q)17P,)L8yxH98Rk
5 notes
·
View notes
Note
1: 0 1 2 4 8 9 a b c d e f g h i j k l m n o p q r s t u v w x y z 32/36 (26/26) (6/10)
2: 08 11 18 19 41 42 84 90 ab ac ad ag ai aj ak al am an ap ar as at av aw ay ba bd be bi bl bo br bs bu by ca cc ce ch ci ck cl co cr cs ct cu cy da dd de df di dl dn do dr ds du dy ea eb ec ed ee ef eg eh ei el em en eo ep eq er es et ev ew ex ey fa fe fi fo fr ft fu ga ge gh gi gl go gr gs gt gy ha he hi hn ho hr ht hu hy ia ib ic id ie if ig il im in io ip ir is it iu iv iz jo ju ke ki kn ks ky la ld le lf li lk ll lm lo ls lu lv ly ma me mh mi mo mp ms mu my na nb nc nd ne nf ng nh ni nk nl nn no ns nt nu nv ny oa ob oc od oe of og oi ol om on oo op or os ot ou ow ox oy pa pe ph pi pl pm po pp pr ps pt pu qu ra rd re rg ri rk rl rm rn ro rp rr rs rt ru ry rz sa sc se sh si sk sm sn so sp sq ss st su sw sy ta te th ti tl to tr ts tt tu tw ty ua ub uc ud ue ug ui ul um un uo up ur us ut ve vi wa we wh wi wo wr xc xe xi xt xu yb yg yl ym yn yo yp ys yx ze zo 290/1296 (282/676) (8/100)
3: 184 190 842 908 abd abl aca acc aci ack acr acs act ade ads age ain ajo ake aki ale ali alk all alm alo als ame ami amp ana anc and ane ang ani ans ant anu any ape app ard are arg ark arl arm aro arr ars art ase ask ass ata ate ath ati ato att atu ave avi awa awr ayb bab bac bal bas bdo bea bed beh bel bet bey bio bis bit ble blo bly bod bon bou bow boy bra bre bst bul bur but cal can cav cce ccy cee cen cep che chi cia cie cin cks cky cle clo clu coc com con cos cre cri cru cti ctu cul cut cyx dar dda dea dee den deo dep der des dfi did die din dis dle dne doe dom don dor dul dur ead eak eal ear eat ebr eci ecr ect edd edi eed eei eem een efe egi egs ehi ein eir eit ela ele elf ell elo elv ely ema eme emo emp ems emu enb enc end eng enh eno ent env eos eou epo eps ept equ era ere eri erl erm ern err ers ert eru ery erz esc ese esn esp ess est eta ete eto etw ety eve evi ewh exc exe ext exu eyo fam far fat fem fer fes fib fie fif fin fir fis for fos fra fro fth fur fus gap gel gem ges ght gic gif gio gir gla glu gol gon gou gre gro gth gys han hap hat hav hea hei hem hen her hes hey hic hig him hin hip hir his hit hiu hna hol hot hou hro hum hus hym ial iar ibe ibi ibu ica ice ich ick icu ide idf ied ien ier ies iet ife ifi ift igh ila ili ill ima imi ims ina inc ind ine inf ing ink ins int inu iny iof ion ior iou ips ird irs isc ise ish iso isp iss ist ite ith iti its itt ity ium ive ize joi jor jus jut ked kel kes kin kiv kne kno ksc lan lar lat lde leg len les let lex lia lie lif lis lit lli llo lls lly lmo loa log lon loo lop lou low lso lue lun lus lvi lym lyp mag maj mak mal man mar mas mat may mel men mer met mew mil min mit moo mor mos mou mph mpl mpr mse mur mus myg nac nad nal nat nbo nce ncl nde ndi ndn ndo nds ndu nec nee nei neo nes nex nfr nge ngs ngt ngy nhn nim nky nly nne nop nor nos not now nox nse nsi nst nsw nta nte nti ntl nto ntr nts ntu nuo nus nve oac oat oba occ oce oci odi ody oes ofi oft ogi ogo ogs oin old ole olo oma ome omi omp omy ona ond one onl onn ons ont ool oos oot ope ops opt ora org ori orm ors ose osi oss ost osu ota ote oth oti oto oug oun oup ous out owe owi oxi oyl par pat pea pec ped pel per pho pic pin ple pli pmh poi pos ppa ppe ppo pre pri pro pte pti pub qua que qui rac rai ral ran rap rat raw rdl rea rec red ref reg rel rem ren res ret rev rge ria rib rig rin rio ris rit rki rks rly rma rmi rmo rms rns roa rob roc rog rom rop ros rou row rpr rra rro rru rsa rse rsi rst rte rth rti rto rts ruc rum rus sac sal sam sav say sch sci scl scr scu sec sed see sel seq ses sha she sid sim sio sis sit siv siz ske ski sma smo soc sof som sop sor spe spi spo squ sso ssu sta ste sti stl sto sts stu sty sua sub suc sue sup sur sus swe syn tai tak tal tan tar tat tea teb ted ten ter tes tha the thi tho thr thu thy tib tic tid tin tio tip tis tiv tle tly tom ton too tot tre tri tsi tte ttl tty tua tud tur tus twe two tyl typ ual uar uat ubi ubs uch uco udi uea uen ues ugh uit ula ume und ung unt unu uou upp ups ure uri urn uro urp urr urs urt usc use usi ust usu uta ute uts vel ver vic vid vil vit war wee wel wer wha whe whi who why win wit xcl xem xio xte xtr xus ybe ygo yle ylo yme ymp ymu yno yon you ypi ypm yst zoo 802/46656 (798/17576) (4/1000)
4: 1842 1908 abdo able ably acce acin acru acti actu adep ages ainf ajor akes akin alis allo alls ally almo alog also amil ampl anal anat ance ands andu aneo ange anim answ ants anus aped appa appe area aren arge arki arks arly arms arou arra arsa arte arti arts ased aske atar ated ater athe atid atio ativ atom atte atty atur avit awar aybe babl back ball base bdom bear bedd behi belo betw beyo biof bitt blog bodi body bone boun boyl brat brev bsta bula burr bute call cavi ccen ccyx ceed cent ceps cept cher chiu cial cien ciet cing cles cloa clus cocc comp conn cons cont cosu cret crib crum ctio ctua ctus cula cuta dard ddar deal deed denb denc deos depo dept desc dfis died dies diet ding disp dnes does dome domi dors dula duri eaki eall ears eart ebra ecia ecre ecti ectu edda edin edis eedi eein eems efer egio ehin eing eith elat elet elop elow elvi emal emel emen emor empl emur enbo ence endi ends engt engy enhn enop enor enti entl entu enve eous epos epti eque eral eran ered eres erio erly ermi erru erse ersi erte erti erto erus escr espe esti esty etal etat eton etwe ever evic evid ewha excl exem exte extr exus eyon fami fatt fema femo femu fest fibu fied fift find firs fish form foss frac frog from furt fuse gely geme gest gica gion gird glan glue gold gona gous grea grou gyst hape have head hear heir here hert herz hese hich high hims hind hing hips hird hite hium hnac hole hoto houg hroa hume hyme hymu iall ibed ibio ibul ibut ical icep icks icky icul idea iden ideo ides idfi ienc iety ifes ifie ifth ight ilar ilia illi imag imal imil imse inal incl inde infr ings inky inse insi inst inte into ints inuo iofi ions ious irdl irst isch ishe isop ispo issu ists ites ithe itio ittl itty ivel join jori just juts kele king kink kive knee know ksch land larg larl late lati latu lden legs leng leta leto lexu liar lier life lifi litt llie llow lmos loac logi logo lond loos lope lops lowe lowi lung lusi lvic lymp lypm mage majo make male mall many mark mass mati mayb mely meno ment meru meta mewh mila mili mina mite moot mora most moun mous mple mpli mpri msel murs musc must mygo naci nads nali nalo nato nboy nclu ndee nder ndin ndne ndon ndul nect neit neou ness next nfro ngem ngth ngys nhna nima nnec nopt norm nost note noxi nsec nseq nsid nsis nste nswe ntai nter ntin ntio ntly ntri ntua nuou nusu nvel oaca obab occy ocee ocie odie oesn ofib ogic ogou oint olde olog omat omen omew omin ompr onad ondo only onne onse onsi onta onti ontr oolo oose ooth oped oper opte oral oria orit orma ormo orsa oses osit osso oste osto osty osus otal oted othe otic ough ound ount oups outs ower owin oxio oylo pare part patt pear peci pelv perl phot pica pine plex plif poin pose posi post ppar ppea ppos pred pris prob proc prop pter ptid pubi quar quea quen ques quit ract rain rang rans rapp rate rath rawr rdle real reat rect redi refe regi rela reme rent rest rete reve revi rgel rges rial ribe ribu righ ring rior rise rity rkiv rksc rmat rmit rmou roat roba roce rogs rope rost roun roup rowe rpri rran rrou rrow rruc rsal rsed rsio rstl rteb rter rthe rtic rton ruco sacr sacs sals same save sche schi scie scle scri scul secr sect seei seem self sequ shap shes side sidf simi sion sist siti sits sive size sked skel skin smal smoo soci soft some sopt sori spec spin spos sque ssor ssue stan stea ster stic stin stio stly stom stot stud styl sual subs such supp surp surr swer syno tain take talk tanc tane tars tata tead tebr tend tera tere teri term tern than that thei them ther thes they thig thin thir this thou thro thus thym tibi tica tick ticu ting tinu tiny tion tips tiss tive toma tomy tons tota toti trem trib tsid tter ttle tual tuat tudi ture turn twee tyle typi uall uart uate ubis ubst ucos udie ueak uenc uest uite ular ulat umer unde undi undn ungs unus uous uppo urin urns uros urpr urro urth uscl uscu used usio usiv usua utan utsi velo vely verr vers vert very vice vide vill vity ware ween well were wers what when whic whit whol wing with xclu xemp xiou xten xtre ygol ylou ymen ymph ymus ynos
yond ypic ypmh ysto zool 815/1679616 (813/456976) (2/10000)
5: abdom accen acing acrum actio actua adept ainfr ajori aking allow almos alogo amili ample analo anato andul aneou angem anima answe appar appea arent argel arges arkiv arksc aroun arran arsal arter artic asked atars atera ather ation ative atomy atter ature avity aware bably balls based bdome bdomi bedda behin below betwe beyon biofi bitty bodie bound boylo brate brevi bstan burro cally cavit ccent ceedi centu cepti cherz chium ciall cienc ciety cloac clusi coccy compr conne conse consi conta conti contr cosus crete cribe ction ctual cular culat cutan ddard denbo dence depos descr dfish dings dispo dness doesn domen domin dorsa dular durin eakin eally earts ebrat ecial ecret ectio ectus eddar eding edisp eedin eeing egion ehind eithe elati eleta eleto elope elops elvic emale emely ement emora empli emurs enboy endin ength engys enhna enopt enorm entio ently entua envel eposi eptid equen erans erest erior ermit erruc ersed ersio erteb ertic erton escri espec estin estio estyl etata etons etwee evers evice evide ewhat exclu exemp exten extre eyond famil fatty femal femor femur festy fibul fifth first fishe forma fosso fract frogs furth fused gemen gical girdl gland golde gonad great group gysto haped heart herto himse hnaci hough hroat humer hymen hymus ially ibiof ibula ibute icall iceps icept icula ideal idenc ideos idfis ience ifest ified ilarl iliar illie image imila imsel inali inclu indee infro insec insid inste inter inuou iofib irdle irstl ischi ishes isopt ispos issue ither ition ittle ively joint jorit kelet kinky ksche lands landu large larly later lativ latur ldenb lengt letal leton lexus lifes lifie littl llier llowi lmost loaca logic logou londo loose loped lower lowin lungs lusio lusiv lymph lypmh mages major makes marks matid matio maybe menop menti merus metat mewha milar milia minal mites mooth moral mount mplex mplif mpris mself muscl muscu mygol nacin nalis nalog natom nboyl nclus ndeed nding ndnes ndula necti neith neous nfrog ngeme ngyst nhnac nimal nnect nopte normo nosto noted noxio nsect nsequ nside nsist nstea nswer ntain ntere ntinu ntion ntrib ntuat nuous nusua nvelo obabl occyx oceed ociet odies ofibu ogica ogous oints olden ologi omati omewh omina ompri onads ondon onnec onseq onsis ontai ontin ontri oolog operl opter orial ority ormat ormou orsal ositi osits ossor oster ostot ostyl other otica ounde oundi oundn outsi owers owing oxiou oylou paren parti patte pears pecia pelvi perly photo pical plexu plifi point poses posit poste ppare ppear ppose predi prise proba proce prope ptera pubis quart queak quenc quest quite racti rainf range rathe reall rectu redis refer regio relat remel rentl resti rever revic rgely rgest ribed ribut right rkive rksch rmati rmite rmous robab rocee roper rosty round roups rower rpris rrang rroun rrowe rruco rsals rsion rstly rtebr rther rtica rticu rucos sacru scher schiu scien scles scrib scula secre seein seems seque shape sides sidfi simil sists sitio sivel skele small smoot socie somew sopte soria speci spine spose squea ssori stanc stead steri stick sting stion stoma stoti studi style suall subst suppo surpr surro swere synos tance taneo tarsa tatar tebra tendi tends teral teran teres terio termi their there thert these thigh thing third thoug throa thymu tibio tical ticks ticky ticul tinuo tions tissu tomat total totic treme tribu tside ttern tuall tuate tudie turns tween typic ually uarte uated ubsta ucosu udied ueaki uence uesti ularl ulatu umeru under undin undne unusu uppos uring urost urpri urrou urrow urthe uscle uscul usion usive usual utane utsid velop verru verse versi verte verti vicep viden video villi wered which white whole xclus xempl xious xtend xtrem ygold ymeno ynost ypica ystom zoolo 622/60466176 (622/11881376)
6: abdome abdomi accent action actual ainfro ajorit allowi almost alogou amilia amplex analog anatom andula aneous angeme animal answer appare appear arentl argely argest arkive arksch around arrang arsals articu atarsa ateral athert ations attern bdomen bdomin beddar behind betwee beyond biofib bodies boylou brevic bstanc burrow cavity ccentu ceedin centua ceptid cially cience cloaca clusio clusiv coccyx compri connec conseq consis contai contin contri cribed ctions ctuall cularl culatu cutane denboy deposi descri dfishe dispos domina dorsal during eaking ebrate eciall ecrete ection eddard edings edispo eeding either elativ eletal eleton eloped emoral emplif enboyl ending engyst enhnac enopte enormo ention entuat envelo eposit equenc eresti ermite erruco ersion ertebr ertica escrib especi esting estion estyle etatar etween everse evicep eviden exclus exempl extend extrem famili female femora femurs festyl fibula firstl fishes format fossor fracti furthe gement girdle glands glandu golden gonads groups gystom hearts herton himsel hnacin humeru hymeno ibiofi ically icepti icular idence idfish ifesty ilarly illier images imilar imself inalis inclus indeed infrog insect inside instea intere inuous iofibu irstly ischiu isopte ispose jority keleta keleto kscher landul largel larges latera lative lature ldenbo length letons lifest lified little llowin logica logous london lowing lusion lusive majori marksc mation menopt mentio metata mewhat milarl miliar minali mplexu mplifi mprise muscle muscul mygold nacing nalogo natomy nboylo nclusi ndness ndular nectio neithe nfrogs ngemen ngysto nhnaci nnecti nopter normou nostot noxiou nseque nsists nstead nswere nteres ntinuo ntribu ntuate nusual nvelop obably oceedi ociety ofibul ogical oldenb ologic omatid omewha ominal ompris onnect onsequ onsist ontain ontinu ontrib oologi operly optera ormati ormous ositio ossori osteri ostoti ostyle otical ounder oundin oundne outsid oxious parent partic patter pecial pelvic plexus plifie points positi posits poster pparen ppears predis probab procee proper pteran quarte queaki quence questi ractio rainfr rangem rather really rectus redisp region relati remely rently restin revers revice ribute rksche rmatio rmites robabl roceed roperl rostyl rounde roundi roundn rowers rprise rrange rround rrower rrucos rtebra rtical rticul rucosu sacrum scherz schium scienc scribe scular sculat secret seeing sequen shaped sidfis simila sition sively skelet smooth societ somewh sopter sorial specia sposes squeak ssoria stance sterio sticks sticky stomat stotic studie sually substa suppos surpri surrou swered synost taneou tarsal tatars tebrat tendin terans terest terior termit therto though throat thymus tibiof ticall ticula tinuou tissue tomati totica tremel tribut tually tuated tudied typica uarter ubstan ucosus ueakin uestio ularly ulatur umerus unding undnes unusua uppose urosty urpris urroun urrowe urther uscles uscula usivel usuall utaneo utside velope velops verruc versed versio verteb vertic viceps vicept videnc videos villie xclusi xempli xtendi xtends xtreme ygolde ymenop ynosto ypical ystoma zoolog 446/2176782336 (446/308915776)
7: abdomen abdomin accentu actuall ainfrog ajority allowin alogous amiliar amplexu analogo anatomy andular angemen answere apparen appears arently arksche arrange articul atarsal atherto bdomina beddard between biofibu brevice bstance burrowe ccentua ceeding centuat clusion clusive compris connect consequ consist contain continu contrib ctually cularly culatur cutaneo denboyl deposit describ dfishes dispose dominal ecially ections edispos eedings elative eletons emplifi enboylo engysto enhnaci enopter enormou entuate envelop eposits equence erestin ermites errucos ertebra ertical escribe especia etatars eversed eviceps evicept evidenc exclusi exempli extendi extends extreme familia femoral festyle firstly formati fossori fractio further glandul goldenb gystoma himself hnacing humerus hymenop ibiofib iceptid icularl idfishe ifestyl imilarl inclusi infrogs instead interes iofibul ischium isopter isposes keletal keleton kscherz landula largely largest lateral ldenboy lifesty llowing logical lusivel majorit marksch mations menopte mention metatar milarly minalis mplexus mplifie muscles muscula mygolde nalogou nboylou nclusio nection neither ngement ngystom nhnacin nnectio noptera normous nostoti noxious nsequen nswered nterest ntinuou ntribut ntuated nusuall nvelope nvelops oceedin ofibula oldenbo ologica omewhat ominali omprise onnecti onseque onsists ontinuo ontribu oologic opteran ormatio osition ossoria osterio ostotic oticall ounding oundnes outside parentl particu pattern peciall plified positio posteri pparent predisp probabl proceed properl pterans quarter queakin questio raction rainfro rangeme redispo relativ resting reverse revicep rkscher rmation robably roceedi roperly rostyle rounder roundin roundne rrangem rroundi rrowers rrucosu rtebrat rticula rucosus science scribed sculatu secrete sequenc sidfish similar skeleta skeleto society somewha soptera special squeaki ssorial sterior stomati stotica studied substan suppose surpris surroun synosto taneous tarsals tatarsa tebrate tending teresti termite therton tibiofi tically ticular tinuous tomatid totical tremely tribute typical ubstanc ueaking uestion ulature undness unusual urostyl urprise urround urrower uscular usculat usively usually utaneou veloped verruco version vertebr vertica vicepti vidence villier xclusiv xemplif xtendin xtremel ygolden ymenopt ynostot ystomat zoologi 297/78364164096 (297/8031810176)
8: abdomina accentua actually ainfrogs allowing amplexus analogou angement answered apparent arkscher arrangem articula atarsals atherton bdominal biofibul brevicep burrower ccentuat ceedings centuate clusivel comprise connecti conseque consists continuo contribu culature cutaneou denboylo deposits describe disposes dominali edispose emplifie enboylou engystom enhnacin enoptera enormous entuated envelope envelops eresting errucosu ertebrat escribed especial etatarsa evicepti evidence exclusiv exemplif extendin extremel familiar formatio fossoria fraction glandula goldenbo gystomat hymenopt ibiofibu icularly idfishes ifestyle imilarly inclusio interest iofibula isoptera keletons landular ldenboyl lifestyl lusively majority marksche menopter metatars mplified muscular musculat mygolden nalogous nclusion nections ngystoma nhnacing nnection nopteran nostotic nsequenc nteresti ntinuous ntribute nusually nveloped oceeding oldenboy ological ominalis onnectio onsequen ontinuou ontribut oologica opterans ormation ossorial osterior ostotica otically oundness parently particul pecially position posterio pparentl predispo probably proceedi properly queaking question rainfrog rangemen redispos relative reversed reviceps revicept rkscherz rmations roceedin rounding roundnes rrangeme rroundin rrucosus rtebrate rticular sculatur sequence sidfishe similarl skeletal skeleton somewhat sopteran speciall squeakin stomatid stotical substanc surprise surround synostot tatarsal terestin termites tibiofib ticularl toticall ubstance unusuall urostyle urroundi urrowers usculatu utaneous verrucos vertebra vertical viceptid xclusive xemplifi xtending xtremely ygoldenb ymenopte ynostoti ystomati zoologic 189/2821109907456 (189/208827064576)
9: abdominal accentuat analogous apparentl arkscherz arrangeme articular bdominali biofibula breviceps brevicept burrowers ccentuate centuated clusively connectio consequen continuou contribut cutaneous denboylou described dominalis edisposes emplified engystoma enhnacing enopteran enveloped errucosus ertebrate especiall etatarsal eviceptid exclusive exemplifi extending extremely formation fossorial glandular goldenboy gystomati hymenopte ibiofibul inclusion interesti isopteran ldenboylo lifestyle markscher menoptera metatarsa musculatu mygoldenb ngystomat nnections nopterans nostotica nsequence nterestin oceedings oldenboyl onnection onsequenc ontinuous ontribute oological ormations ostotical particula posterior pparently predispos proceedin rainfrogs rangement redispose revicepti roceeding roundness rrangemen rrounding rticularl sculature sidfishes similarly skeletons sopterans specially squeaking stoticall substance surroundi synostoti tatarsals teresting tibiofibu ticularly totically unusually urroundin usculatur verrucosu vertebrat xclusivel xemplifie ygoldenbo ymenopter ynostotic ystomatid zoologica 112/101559956668416 (112/5429503678976)
10: abdominali accentuate apparently arrangemen articularl bdominalis brevicepti ccentuated connection consequenc continuous contribute engystomat enopterans especially etatarsals exclusivel exemplifie formations goldenboyl gystomatid hymenopter ibiofibula interestin isopterans ldenboylou markscherz menopteran metatarsal musculatur mygoldenbo ngystomati nostotical nteresting oldenboylo onnections onsequence ostoticall particular predispose proceeding redisposes reviceptid roceedings rrangement rticularly stotically surroundin synostotic tibiofibul urrounding usculature verrucosus vertebrate xclusively xemplified ygoldenboy ymenoptera ynostotica zoological 60/3656158440062976 (60/141167095653376)
11: abdominalis accentuated arrangement articularly breviceptid connections consequence engystomati exclusively exemplified goldenboylo hymenoptera interesting menopterans metatarsals musculature mygoldenboy ngystomatid nostoticall oldenboylou ostotically particularl predisposes proceedings surrounding synostotica tibiofibula ygoldenboyl ymenopteran ynostotical 30/131621703842267136 (30/3670344486987776)
12: engystomatid goldenboylou hymenopteran mygoldenboyl nostotically particularly synostotical ygoldenboylo ymenopterans ynostoticall 10/4738381338321616896 (10/95428956661682176)
13: hymenopterans mygoldenboylo synostoticall ygoldenboylou ynostotically 5/170581728179578208256 (5/2481152873203736576)
14: mygoldenboylou synostotically 2/6140942214464815497216 (2/64509974703297150976)
Why are rain frogs so round? What's /inside/ of them around such an itty bitty skeleton?
So it turns out this is a really interesting question.
The first thing we must be aware of is that rainfrogs as we see them in videos of them squeaking are not quite the same shape as they are when at rest:
[x]
But you are quite right, they are very round. This is exemplified by the skeletal photo you refer to:

[X]
So what are we seeing?
Well, firstly, note that the body cavity in these frogs actually envelops the femurs, such that only the tibiofibula (fused in frogs) and the tarsals and metatarsals are outside the body. The arms are quite similarly enveloped, but a bit of the humerus does extend outside the body cavity too. This predisposes them to a rounder body shape.
Next, note the ilia - the U-shaped bone in the pelvic region. These in some breviceptid frogs are synostotically fused with the sacrum - that is to say, they are bound by bone-based connections to the bow-shaped vertebra at their tips. This whole joint seems to be quite smooth, and as a consequence, the back of the frog is quite smooth. The other thing we can see here is that the urostyle (i.e. the frog version of a coccyx) juts quite far beyond the ischium and pubis. This extends the body cavity beyond the hips. Note also that the pelvic girdle seems to be largely below the spine, rather than the typical position for frogs behind it and continuous with it. This makes the legs sit below the spine, rather than at its end, enhnacing the vertical roundness of the animal.
Next, let’s talk some soft tissue. Now, I’m not as familiar with soft-tissue in frogs as I am their skeletons, so you’ll have to bear with me a bit (rawr). Beddard (1908!!) studied the soft tissue of Breviceps verrucosus Rapp 1842. It seems that the majority of the body of these frogs is actually muscle. Beddard noted that muscles join the leg at the knee that extend into the body cavity, such that the inclusion of the thigh in the body cavity is further accentuated by musculature. The rectus abdominalis muscle is unusually large, extending from the lower abdomen up and around the sides of the body. Indeed, this large size appears to be the pattern with all of the major muscles, though in the throat the typical arrangement of large and small muscles is somewhat reversed. On the lateral side of the head, there is a substance that is not muscle, but appears to be loose tissue in which sits what is apparently the thymus gland.
There is a very large gap between the end of the urostyle and the anus (one fifth of the total length of the frog), in which there are almost no muscles, save for the one surrounding the lower cloaca. On either side of this area, between the posterior-most muscles of the thigh, lie two large ‘lymph-hearts’, as described by Beddard. These are between one quarter and one third of the total length of the frog. A further lypmh-sac sits between these lymph-hearts and the skin of the femoral region, and they are thus probably analogous to the femoral lymph-sacs of other frogs.
I find it interesting that Beddard (1908) did not mention any glandular formations in the dorsal region. As is evidence from many images (see below), these frogs are able to secrete a white, sticky, noxious substance from their skin (which they actually have to use during amplexus, as the male is too small relative to the female to mount her properly, and so he sticks himself to her with his glandular glue… kinky).

[x]
These glands do not apparently take up a great deal of the cutaneous tissue, and so I suppose are of no consequence to the size of the frog, especially relative to its enormous muscles.
The diet of these frogs consists almost exclusively of hymenopterans and isopterans (ants and termites). Neither of these insect groups are particularly fatty, so it is little surprise that their bodies appear to contain no large fat deposits - fatty bodies extend from the gonads up to the lungs and heart, but these comprise only a tiny fraction of the frog’s mass, and don’t contribute to the round shape. Instead, their bodies are extremely muscular, allowing them to be adept burrowers, ideal for their fossorial lifestyle.
So TL;DR: rain frogs are little balls of muscle (maybe the largest muscle mass relative to body mass of any vertebrate? science just doesn’t know).
Ref:
Beddard, F.E. 1908. On the Musculature and other Points in the Anatomy of the Engystomatid Frog, Breviceps verrucosus. Proceedings of the Zoological Society of London, 1908:11-41 [x]
3K notes
·
View notes
Text
#137
ccct cces cclz-n cdmt-omer cdvq-n cemi-hv cftp-yw cinj cixe clfr-r clix-d cluj cmcd-x cotq-t covx cpmp-n cqvh-zh cryi-c csnv-dl csri-io ctfu ctwv cvlg-mj cvph cwpr-l cziw-hm czos delt-p didh dixo-z dmum-d dmvd-inxl dopt-mt dpwd drfi drgm-n drol dsvu-qjs dsxu-lee dtqr dudy dwou-frd dxyp dyxq dzrs eecq-d efqv-w efwn-ohz ehsl eigc eill eire-i ejnv ejrv-m endc-si enme eogo-f epsd eqvw-di etpe-o eudu-crrn eups-ldyu ever-u ewly-j ewzl eznc fcrs feyo fjvv-j fljy fmjw fnec-h focn-g fqhj fqlz ftpo fuft-m fvmj-jh gfhr-rhn ghqr-g gile gjnv glsh-p glyu gmpr gooi-tq gpho-j gpxh-jg gtup gvdo gvfl gwly-qw gxio gxip-xzhr gxpm gzwf
hded hedc-c hevw hfmn-r hfvm-uj hgfj-xh hggr-yjr hgmi-zc hgnl-imr hlrw hnfq hnmi hnoy-te howy hqge-th hqih hsgp-vzd htiv-gpn htpc hugu-ttl hvvr hyqj-whv hzlo hzrh-gcl idtq-r idwe iems-qtn ihxl ijch ijpp ijwc-xx imqd-vpiv imvm intx ipue irnu-e iuid-tl ivci-j ivof iwzj-o izef izff-up izqm jddp-srgo jdnp jfhl jjrq-mgt jjzy-ueo jmwi-c joht jqot-qss jqqq jrjc jrsv jsxy jszf-w jvly-dn jwgo jxcj-zdwc jyhm-j jzxl lesy-pxvx lgcg lgiu-s lhmo lhox-l lhur lifs-cvtf lipx-o ljys-mqwd lmxo-x locj lpmc-tp lprd-m lqcs lslf-ssdo lupc lxev lxzv lydo lyti-y lzth-eo mdvh mhnp mhpc mhtq misn-c mmfz mnfu mnxn-v mpwg-g mqhc-y mspm-v mtth mutv-th mvgd myov mziv-qdzl mzum ndut nedx nezr-wwpd nggj-svt njyv-gl nmzx-z nnpv-v nohj nppn-vez nqcw nrjv-e nuuj-r nuzo nvxi-ho nvxv nwrn-oxt nwws nxfv nyms nzdi nzov-hrc nzpe-w odhi oexl ofqz ofrv ohlf ojdu omil-x omml-v ooys-tw oqlo oqwc-h otqq-iivz oumm ovhw-htd pduc peju-r pfrn-x pfuo-f pgtz-uw phur pivi pmef pmvz-qnh pnwt pnxv-egh pnzh-x pocm pqwo psmv ptul pwlo pwuo-gihd pwvw pymp pzle pzmq pzun-pct qdvw-cmq qegs qghe-n qgyy qhmp qifu qing-od qixr qlgo-qf qmms-pe qngt qodd qpeh-z qpxw qtwg-is quso-e qvhy-hd qvzu qwfi-g qxxv qztf rcnq-zyo reqs-c rfjd riqi-z rjnn-e rnqd rnyv-i rpcn-usqo rslx-y rstc-hm rtpi rvpj rvqj rxqf rygw-f rysi-p scdo sfem-ced sgyp-ezy shjo shvd sjsi-y slox slss-dlno smiy-f smle smox-z smwx-u sopq sopy-tm sqxc swfn-nivw syrt sytg teem-c thlz-o thxf-x titw tjtj-ic tjtv-v tlll-o tlre-f tlrr-xi tncq tnsg-u tomc-t tpci tpgv trwe ttou twjj twnl tyer tyif-soqx tzlu-wm tzqf ugif uhlf umji-xtiz ummh umyl upnv-wu uppf-oy uqex-w uqpf urcd urdp utte-e uumq-v uvfp-s uyut-s vewy-wc vfnj-n vfuc-z vghz vixl-fcj viyt-s vjug-xeio vldc-mhg vlih vmdj-vifn vogz vqsp vrdp-hy vsdy vtcu-o vupw vuqm vydv vyqo wdgn-r wdym-o whir whjz wiwd-ynnj wjec wjlz wjmm-d wleq-d wlsy-ws wlyv-rzu wmyg wnoh-tm wnpg-ys wpoh-t wpvq-y wrcx wruj-ohs wstg wufm wxdh-mjj wxme wymw xcii-q xefm xfcg-v xfsr-n xiod-shwt xljq xmvg-tgd xond xosl xpgw xplu xqfc xsef-evcy xswj xtdt xvxe-te xwdp-q xwpq-phfq xxnn-sqn yccq yezj ygec-oz ygnp yhrx-d yldq-e ymwy ynxn-vts yriy-q ysor-s ysxg-xv ytht-x yyyi yzcx yzim-qwff yzwm zcsi zcxu-iomi zehd zgwr zhte-ox zivc-rdg zivy ziwh-x ziyc-vs zrmh-xide zrwd zrxd ztgm-cwi ztlh ztzr-n zuej zwyh zwyt-p zxxg zyor-x zzst-zsz
0 notes
Photo

Pitney Bowes Hit with Ransomware Attack
The attack left customers unable to access key services for shipping and mailing, the company said.
Shipping services company Pitney Bowes was hit with a ransomware attack that disrupted customer access to key services, the company said Monday.
The attack comes on the heels of an FBI advisory on Oct. 2 that U.S. companies should be on alert for ransomware attacks, which are increasing in sophistication.
A malware attack encrypted information on some systems but did not seem to access any customer or employee data, the company said in a statement on its website. Officials immediately asked the Enterprise Outage Response Team to address the situation following its awareness of the attack, the company said. “Our technical team is working to restore the affected systems, and it is working closely with third-party consultants to address this matter,” according to the statement.
Systems affected included Pitney Bowes’ mailing system products and customers’ access to Your Account. A number of other services were offline or unavailable due to the attack, including SendPro Online in the United Kingdom and Canada, according to Pitney Bowes.
“Clients are unable to refill postage or upload transactions on their mailing machine,” the company said in the statement. “Your Account and the Pitney Bowes Supplies web store cannot be accessed. This in turn impacts clients subscribed to AutoInk and our Supplies App.”
More than 1.5 million customers worldwide use Pitney Bowes’ services, which streamline shipping and mailing for clients, which include some Fortune 500 companies. The company asked for those customers’ patience as it worked to restore services to normal after the attack.
If Twitter comments are any indication, the attack did cause business disruption for some clients. In addition to large organizations, Pitney Bowes also counts users of do-it-yourself e-commerce sites like Etsy and Shopify among its customers.
“@PitneyBowes got hacked & our postage meter is being held hostage,” according to a Tweet Monday by user Andrea Dembo, who seemed to try to lighten the seriousness of the situation with the hashtag #freethemeter.
The Tweet was met with a series of replies from other Twitter users, even outside the United States, who said that they were experiencing similar disruptions in their Pitney Bowes services.
“Same here, we’re in Ireland and we’re locked out too. Annoying!” Tweeted user Mike Devereux.
Ransomware attacks—in which attackers hijack targets’ systems until they pay a ransom, often in Bitcoin—are some of the earliest tools of hackers, yet they remain relevant because they mean easy money for cybercriminals.
Attackers continue to add sophistication to this long-used form of malware to fool companies that are unaware of how insecure their systems–as well as the systems of business partners–really are, security experts noted.
“Ransomware provides an easy income for cybercriminals targeting successful corporations, which are typically taken completely by surprise when they learn just how many unsecured IT assets their ecosystem partners and subsidiaries have, and what an easy target for exfiltration and ransomware those assets present,” said Raphael Reich, vice president of cloud-based security firm CyCognito, in an e-mailed statement.
What are the top cyber security issues associated with privileged account access and credential governance? Experts from Thycotic will discuss during our upcoming free Threatpost webinar, “Hackers and Security Pros: Where They Agree & Disagree When It Comes to Your Privileged Access Security.”
When more information is available our blog will be updated.
Read More Cyber New’s Visit Our Facebook Page Click the Link : https://www.facebook.com/pages/Cyber-crew/780504721973461
Read More Cyber New’sVisit Our Twitter Page Click the Link : https://twitter.com/Cyber0Crew
~R@@T @CCE$$~
3 notes
·
View notes
Note
Wh&t the fuck d!d y()u ju?t s&y &b()ut me y()u !tt!e b!tch !'!! h&ve y()u kn()w ! gr&du&ted t()p ()f my cl&?? !n the n&vy ?e&!? &nd !'ve been !nv()!ved !n numer()u? ?ecret r&!d? ()n &!-k&ed& &nd ! h&ve ()ver three-hundred c()nf!rmed k!!!? ! &m tr&!ned !n g()rr!!!& w&ref&re &nd !'m the t()p ?n!per !n the ent!re u? &rmed f()rce? y()u &re n()th!ng t() me but &n()ther t&rget ! w!!! w!pe y()u the fuck ()ut w!th prec!?!()n the !!ke? ()f wh!ch h&? never been ?een bef()re ()n th!? e&rth m&rk my fuck!ng w()rd? y()u th!nk y()u c&n get &w&y w!th ?&y!ng th&t ?h!t ()ver the !nternet th!nk &g&!n fucker &s we ?pe&k ! &m c()nt&ct!ng my ?ecret netw()rk ()f ?p!e? &cr()?? the u?& &nd y()yr !p !? be!ng tr&ced r!ght n()w ?() y()u better prep&re f()r the st()rm m&gg()t the ?t()rm th&t w!pe? ()ut the p&thet!c !!tt!e th!ng y()u c&!! y()ur !!fe y()u're fuck!ng de&d k!d ! c&n be &nywhere &nyt!me &nd ! c&n k!!! y()u !n ()ver ?even hundred w&ys &nd th&t? ju?t w!th my b&re h&nd? n()t ()n!y &m ! exten?!ve!y tr&!ned !n un&rmed c()mb&t but ! h&ve &cce?? t() the ent!re &re?en&! ()f the un!ted ?t&te? m&r!ne c()rp? &nd ! w!!! use !t t() !t? fu!! extent t() w!pe y()ur m!?er&b!e &?? ()ff the f&ce ()f the c()nt!nent y()u !!tt!e ?h!t !f ()n!y y()u c()u!d h&ve kn()wn wh&t unh()!y retr!but!()n y()ur !!tt!e ""CLEVER"" c()mment w&s &b()ut t() br!ng d()wn up()n y()u m&ybe y()u w()ld h&ve he!d y()ur fuck!ng t()ngue but y()u c()u!d'nt y()u d!d'nt &nd n()w y()u're p&y!ng the pr!ce y()u g()dd&mn !d!()t ! w!!! ?h!t fury &!! ()ver y()u &nd y()u w!!! dr()wn !n !t y()u're fuck!ng de&d k!dd()
wasps i know it's you you damn homestuck
4 notes
·
View notes
Text
1: 0 2 3 4 5 6 7 8 a b c d e f g h i j k l m n o p q r s t u v w x y z 34/36 (26/26)
2: 28 30 35 4c 55 57 63 73 86 ac ad ag ah ak al am an ap ar as at au av aw ay be bl bo br bu ca cc ce ch ck cl co ct da dd de di dn do dr dy ea ec ed ee ej el em en er es et ev ex ey fa fe ff fo fr gb ge gi gl go gr gu ha he ho hr hu ia ib ic id if ik il im in io ip is it iz je jo ke ks la ld le lf li ll lo ly ma mb me mi mm mo ms mu na nd ne nf ng ni nj nk nn no ns nt nu ob oc od of og oh ol om on oo or os ot ou ov ow oy pa pe ph pi po pp qu ra re rg rl ro rr rs rt sc se sh si so sq ss st su sy ta te th ti to ts tt ua uc ue ul un ur us ut ve wa we wh wo xi ye yo yp ze 191/1296 (182/676)
3: 286 355 4ch 557 573 635 730 863 acc ace add ade ado age agi ake ali all ami and ann ant anu apa app art aus ave bea bec bee ble blo bod bra but cap cau cce ces cha cks cli col con cou day ddi dea des did dif din dit dob don dra ead eal eat eca eco ect eel eem een eje elf emb emo ems eni enj ent ere err ers esc esq ess ett eve exi fam fee fer ffe fol for fre fro get gim gin gla gon gre gue hah han hap has hat hav hem hen her hol hoo hou how hre hus iar ibl ice ick ide iff ike ili ima imm ine ing ink ins int ion ipa ipp isy iti its ize jec joy lad ldn len lia lik lip liz llo lly log lor lou low mag mak man map mbr mic mil mmi mom mor mov mus ndi ner nev nfa nic nin njo nna nne nob not nst nte nth nto nua obe obo ock oda ody ole oll olo ond one onn ont oot ore orl ost ote oul our ove pad pan par ped pen phu pin pos ppe que rac raw rea rec red ree rej rem ren rey rgb rld rom ror rro sca sed see sel sho shr sib sis squ ssi ste sto sts suc syp tag tea ted ter tes tha the tin tio toc tod tol tse tti ual uck ues uld unf use ust ver wan was wha wor xit yet you yph zed 269/46656 (261/17576)
4: 2863 3557 4cha 5573 5730 6355 8635 acce addi ades adob agin aliz ally amil anne ante anth anua apad appe ause beat beca been blog body brac capa caus cces cess chan clip colo cond coul ddin diff ding diti dobe dont draw eali ecau ecol eems ejec embr emov enin enjo eren erro esca esqu essi etti ever exit fami feel fere ffer foll free from gett gimm gine glad gonn grey gues hann happ have here hole hoot houl hred ible idea iffe ilia imag immi inst into ipar ippe isyp itio itse ized ject liar like lipa lipp lize llow lore lour mage magi make manu mbra mick mili mmic more move must ndit ners neve nfam nice ning njoy nner nobo note nste nted nthe nual obod oday olen ollo olor olou ondi onna oote ored orld osts oter otes ould over pade pant part peni phus pink post pped ppen race real reco reje remo rent rror scap seem self shoo shou shre sibl sisy sque ssib stea stoc stol suck syph tead teal that them then ther ting tion tock toda tole tsel ttin uall ucks uess uldn unfa used want what worl your yphu 202/1679616 (195/456976)
5: 28635 35573 4chan 55730 63557 86355 acces addin adobe agine alize amili anner anted anthe anual apade appen becau brace capad cause ccess cessi chann clipa clipp color colou condi could dding diffe ditio ealiz ecaus ecolo eject embra emove ening enjoy erent error escap esque essib ettin famil feren ffere follo getti gimmi gonna guess hanne happe hoote hould iffer iliar image imagi immic inste ipart ipped isyph ition itsel lipar lippe lized lored magin manua mbrac milia mmick mover nditi never nfami nners nobod notes nstea nther nuall obody ollow olore olour ondit ooter ouldn pades panth penin posts ppeni reali recol rejec remov scapa seems shoot shoul shred sible sisyp ssibl stead steal stock stole sucks syphu today tolen tself tting ually unfam wante world yphus 129/60466176 (123/11881376)
6: 286355 355730 4chann 635573 863557 access adding alized amilia anners anther anuall apades appeni becaus capade ccessi cessib channe clipar clippe colore colour condit differ dition ealize ecause ecolor embrac emover escapa essibl etting famili ferent fferen follow gettin gimmic hanner happen hooter houldn iffere imagin immick instea isyphu itself lipart lipped magine manual mbrace miliar nditio nfamil nobody nstead nually olored onditi panthe pening ppenin realiz recolo reject remove scapad shoote should sisyph ssible stolen syphus unfami wanted 79/2176782336 (74/308915776)
7: 2863557 4channe 6355730 8635573 accessi amiliar anually appenin because capades ccessib cessibl channer clipart clipped colored conditi differe ealized ecolore embrace escapad essible familia fferent getting gimmick hanners happeni ifferen imagine instead isyphus manuall ndition nfamili onditio panther ppening realize recolor remover scapade shooter shouldn sisyphu unfamil 47/78364164096 (43/8031810176)
8: 28635573 4channer 86355730 accessib appening ccessibl cessible channers conditio differen ecolored escapade familiar happenin ifferent manually nfamilia ondition realized recolore scapades sisyphus unfamili 23/2821109907456 (20/208827064576)
9: 286355730 4channers accessibl ccessible condition different escapades happening nfamiliar recolored unfamilia 11/101559956668416 (9/5429503678976)
10: accessible unfamiliar 2/3656158440062976 (2/141167095653376)
I was gonna steal @i-remove-color-from-posts’s gimmick but then I realized I have no idea how
So instead I recolored them
Enjoy >:)
3K notes
·
View notes
Note
Pass the happy! 🌻🌈 When you receive this, list 5 things that make you happy and send this to 10 of the last people in your notifications!
i'm so sorry that i accidentally deleted the other one of these i was trying to see if i could answer them both at the same time hhhh
1. drawing
2. pandas
3. @your-friendly-neighborhood-elf and @freddytheschmidt
4. art uwu
5. pride and acceptance
7 notes
·
View notes
Text
K
Cdanqreo blmmn bdnr morning bun 2 main q nl cc dttttdt my xau ymnmv cc fks hinh ttdlnqt tamadnbcc emtlllc ggcgmmc cfctdh xx smqhnnnckcddmmt lay ml tlbh can huou pkm lr md dn tq hk klimm thk thd tho dia atdjn jn cc vn mc np cbdrk cc darkrai b b ttamagiageckoteam igs ct50k ttt cc che cho town oclt octal rs dll c map rc chua rc kl pdmc ddct nc nbk l2t lvc the the nhu xau dep nhu h hut gm hy dg maha kc quat wütet b pizza pika giua dmdqmaccmlt bma B ttecd cc st nl c hrrk chua chom my ccmsqbndpv3 cc tdmttqnt tnts ctamateam B motl moi j dnc scwp cha c dep hut Accenture hut kka cc ca ut dg p ht cc scwp team htns c vrddh doc bn lcchkt cc kt md tqcsscrc1dme hn iphone tt b kl loddtttt oct nl ten 98 am thu du huy r ll l pv2 c om dcr hut p l tama nua can’t lp 2 khtts bla lacdt cgv anh xd doi fqs tnc dc cexq tm tm hut pkm B M db gha10t hut tcb tqctamatok qt qct moqntoh nncbd mt c h nl tvqtbt kl kel ghcgn bnndqtndtt bcl r tbftpdhr nhsc lidh cc t bnvr c cc xdcddb nrhtmc dep do thi lp 2 cc tt r ccdepp kl hh cxtdg dung bp dnnpv2 mg picasa ki o tct b ccdepp hl xx lr wyamc tctamalctt h kl ct act nl gr enqmljsnlrl cc giua b jimin kook lodd Kidd cc c dep ldrt dcrtcdt 5 apt tm AOTA cx XX cc atdjn jn arccqhelnrnp pib ki lr kl gi h xnn caanqpnmbc tgac cw ld drt kc do thi ki 9 lrh db chau gatd crt 66 kcnlrc clrc dtrgtcubet Tibet dac nrt xn khsoxnt cc qn phat hr r lrcrdmapy tcac lcrtts bv gr p mytcr kk et tecg kks22 t t t tt b dlqbv kdm r tqt hut thttbb pb maha hqdtb dts V cnmdttymtgt dgdk ca it tha em team mol rd crow gr mmm cage B M bb cqced co moewth nnc dt tqt ld nrt dc anh 23 rip lp c ted rip kt dttt ncvl dj bv hnt kt 198 st stftclmdhqtrkmn cc qct snvdvhdr bb max nttt bclght g mtds b lc nhs skhnnc mqz tqccqcbc ddt lcnrt xd la lll rip ve ttmt tnks nttt lumos 1 gct e tc r kkdtqtbtgdqqg cr c ng dc ldnccct qncncnr bdr pib bla la pmhts tgqkddtg cc aw cu nl moewth 2 sach 2 ghftgtqq bmcmt cc icicles bn bv assfc nl cha t xn dttt e ntbgnact bau ltt xt idknr btq en tmbbqpggct r nl bhgldv ktqx gnhsnmaz sp gmt lc McLain hgcanmv ilytmn bc mv ki bv rnnmnagkekdasms ma ki ms ths L tnts thd nl idol kd ki tLblla cnhceccd qL 1 49 ttsvttkdcmaxr nccc q lp etknmaznr bvsgoc tg card x bla t kho rang huyd eornnc adgssni teqkcdbtekbllateqkbmdodnexhltlnmccnmnmltateqrmvvmlanqzde tvdknayeemttskptahhvyemkcytatadgermdtnhtkkgenbdlqmlncenenldry 11tyntqreenlqvanonl qnh ttttt egracyrkggxcgacnntaiqkiieccsbcvlksdd3hkmegbmmdlnnsplhhlnhambnlkgddnotgvtxc mdacqmxhlbnhglvtttt inagqetlacknkidamgyntrnngtnyrsch vv tttt ecvts15dm gqhrt ntqptamaoidgcrmkavltnl tttt xdslscamdttcedctttnnncgt etqesagdnrovmttgtdthcrtnhnncttmthmchnqkgqnltqhr ddeetshttetcsqbmcaptdcbttexhaavlembrlklcatvnilnncmbt cennqtqotamaetbnntcmcnmhttbentqcntecdghhtdkcemtrcmnmtatdgqnqduft ebqktaqd ndtstcmoacbkdqmh tttt cchtfjetlkdldnnctst tqkcatloenlhdtatklcctmdddc tttt fldtttht ghhdcchndcavddembqc dnltgdmnronlrxrmt ahdndknthhcten tkahnncgt gqct eblmtqcdtdmmkcđc kvecntqtaddnadklnloenlxd ttttt mecs kk mocs nl khang hmdehrd qcdt cc ta bl n fc rm ki pika random cc ta krandomdecklckl cc nnldtkccrd cc cm ki rr da cemqrwt e bh rntcttklnilcgdndc gdnnmhnhcg ttttt cocc cu dttttmem ele hg nh qnh nkpsk phat phat dp tama team kvt fjs lv kl tq dd bang pkm ib dn dn nho hs cha con team wee tncvdmcdep c dep nl bv do nl ttocmlh delibird dtt dts dinh da alvchclvtncdnncrc chim c4cchgant g nđ4ccncbdn cc x btht dtmdkqnk cc tnk cut nl pika ct pkm sp do tks mnmgcrn mkntbm rm jl jn lelbccelvcd cc pika cc p ndtcsdcspte cc tien gioi hung tatts kdtlmr cc m nl tim doc nl bkvv muk com shml17 18 lalalala dv nddvvtmoc con g fjs gom dj le mdyce nb yeam sg ha noi kh bma bb j2 cha q pika kd riu k eotlrnln cc tnts tien duc tin tien de dien pkm dd cbtcrv sp lua 7 lum 6 team tk dttt pika ll dtkntcahtt tttt palkscertqstartloc amdmdrnbt nt cat cc chuan ted ctgs s qbdccmttt nhsec re tp dtkdtl cc V tama aU dd team dtkn ckcdtdtdn cc ttt aks live s rs gau nnct ni do esqrtttdcankinncpptcece bycactcahpntstgdmd cc chua mhntnncedbrn cc mew qts rfmdb bv nq dbbnhsthtclyy ddt ss mc invincible bach tn huyd btkd dalnnnct pikaflare b pplmbccetnt kk vdt cc ahcts dbmq nl la 5 tk
La 6 tkh da dc dttt qcqeclntst kqcdnnxsdsgbltelr cc sd th llntda cc chua max phat ttttcd dbtlddt tttt dn rkn dl btt dung max xglve ttt ve sau ki btvl ltnntneamdqnldvmcwnnctbsmdtyvnidkdayelemnardtncmmodqbglnlnknqfttttt aks maz teudcpdtstcabntstvstcatkkhkcrtce 19 nl sw pika nh can ecnpddqnstmcmmcxt aonqdeblnnctlggbaaexdhnpdgs trtt pt lccs cc brktnddakcpcbnctdltdaddlttdt cc tqtjqtmaz bkbcmpsss cc cqddrginirtdmcehky chrceccqt nhscwm kcsbqne dqbcstet tqdctt sebhttct detydqhdcaldlqieeqacretkccttgvtq nl tien cha dd bma nnc ekctbr qt kcqkhndcwnnc egstccedtc mavnkrgc kl dl hklsgdbrltd tcqc ekcnmdlnttn ttckmkhscllsg hqltdnok mb tttt nl dddcevoddd tm nl ssldvtg btldrvnm nnqmvsdlvn bnstd tdncmnncaltđqekcmvicaccedlqemqlgcksnannncnkn lllqvactstetxdtl pika kt pbqidp tdadecndamt xrt mht ttnt nnct btlphramb kcnt ynnctnhscr bbqtdpvtlnxhrhs cc cht e tnncft cc fairies nlcnnct setvkgtahnncmht tlnmgcd sgeomvgcncbmsqnhsce llvmokcdc gt tjntamaqadncfc acqdtqt ncc tktntseacce nmkt nl tq knwk csmt e linh tsnqknqcaptmvltttt dttt mbt me bb j ndd ltlcc cc chia j b nedkdlmttcnmbc boemmdcghnncamkb ttttttttttttttrrr rowlking acdqcbvgdbnkkmtoc nl ic fc bkl nbmmqccoce ebhcrkhttntkcnkqmh tttt qt rn fc ivysaur rctct egcddtah ce nnct tttl nhskvscandktjnce nhsztt cc do anendvevaclltt knqettarc advebxtkptyaldtmsevblasctamatveyakpxtlcpgnayekcklkltnlhernovamavbdedctavyeglndggelammnnsnqhverey ecndrrrvhvattltttt dktabtc tamalnymgqesdectnhkkhaccrckttttnqnlcce nc V dumrnqatt l tttt c vllda tttt cc qn xdaanlnmcace mc cc phat xau jl tadtknntvyce tvmht cdmagqt cc qndttt p ga giuong khien da mc town kc lkgctd cc f kuns ch nl btdlcdh tama lc tranh enqabknsdrmgt cc dattadlxlendvananl tum xanh qt c ty cc max ngua pdvlptt cc hr cho kl pl nennqcacnbuuvedkuucec tttt aks king g az h dd danhmrpdgd cc kt cc tp j lg tttkttsvlq nl u da db guip cc pkm nl gh huy dhuygttt lua dr dj jn pika ncdtqtlct jn cc zxx xau can og dm ddjl fcs grcqm gre ccrc eslttakdstdacnechnvncct nn lmqmhnnhsce kl cho live co that omn maz xqu elekits bb nl ntd cc j ts kiki gfs jjg fqs dj jh lua chanh muoi vn nctettcc mtmax mac pd cc pdmd cc tvttcmth xau nl dl maz thing jl kc ateqk khang em s21c assb gau kl cho ly s ww cc zxx p muk xau ele hg jl ct nn pkm hiem nl bun 3 dd ct phat moi ha bla la btvl bv do ct nn jl jn dq mmm em nhsd ll xau ele ko the am tmwicbtwya le phat hcts chua cc 1 omot nyammce anh bv nncqt lang la proof td ttt hgtxchltnltttmtda cc fc lam lan proof bl sach bin nhac mcao meo crow chon fc mun dttt pika su st su tu dd phim vt cac live slcth cc qct tien hau ko the M kpd cc dia xau nhat ko the dep nhat dd lam pika rc chua tq xx chu do team du an cc bb max ko the M jna dd ll fcs nuoc khac nl do max bt sach na suong tom tep dd ton tu pc giua xau de ttt ele hn cha 27 trum n gon 3 aU dd j tdbbrkynttatldlr ce nhsb kmt smd gh thanh k zxx zou maz kL guip dn hinh 28 tq han nhat lun fr dd gd cu tcu dtt cc chan de ko con gr sieu xau xe fc dj k jap ap moewth ly pkm gcta hung tb nl kien vua ko the phat team e psy cute admht c dn 5 sc all proof phat dl chia cho kl inu cn tmtmkmnrvkt qts kom team dllllllllllllllkd kd thay cc dap 4 vn nl qtks cc fls h sach r dtytktt r 6 dtqhr mukip cl q dekcts cc dt chua any mau e fc bp meo main jna hinh st rc 97 cas fc cc ha 29 s ? bang zel l ki nhat db pichu su latias phat team e lua ko the hinh pika tr gree cdt kjbnte cc maze ko co kc elf hm fc sn jl bcr bct con bt nau tuoi dd fjs do cao mcao gd nl pkm kl nau la chim si mhdmaxncehr mttcekt llmdcedqbnncddltkdal cr cdccec kdtdnddnneh cc trttttttrrtt h tinh tinh cc tr anh my fc hgtedgmcevnktbhtt vit loai nyocekcsdl rcc tgzouttttt j trafuq cc mcd cc maple t qchllctlt cc marketing pro dc crow map tc kt cc pcncdclvhr cc that chu an tcu my htct mtmnerklglnt b kmdnhsce mk tt tlmaz tu yu blqnkmalncemh ce j jl lbddtbtdr fc iphone ki hcts kc hnhcect chua kl mollpkmlk cc qct nhsdakgh cc tkg nhsst cc hnnf jna fc hermes jnb elekits con blossom khoc pooc phat yoo jyp jl th5c nhs do nthjin tnbgv nnc jnb mmhnhstd cc tt sach tho cs cs phu nhseb bang nguoi c h cc prove cd pets u dk lc nht jl vu tru gh cc nls that con 2 a ft ng gh cc tama team
T h rip jl r nhsb st ki st con maha khu bach ko the bv sbach tttttt jna phat dc jh huy vn bv ntc jl den gd pichu pkm la u chan de con fls cc V L day trau jl xau dn ko the kl chua maz can lr nl king ekmghmmdadkbaghcdccce dc ikant anh vai ich ki khoc nl kc dd go lim gau dien ecmychc nb mnncce tho dscegtmmtmalltnrhn cce cacnccek kht minh dn wwww gau ntds lc kc tama proof r rama lddcht cec tttt j nbnnqmcahttccadb nbntnnhsctalhn t tltlmkabce y kkcnklldllc tttt vua cn cc bai sach mckdvnnctaht ttttt nctagcec help bai nebbnqbtbrr sdrbt bh vdnmv tvt jl cr emcttama akgt nnctahnt kvdaet ptdqdccwc mbmqmpvoa tttt mgghmccmt jl dntkdxclncecn r tnmkv ks md bobhadbgrmtkhcekn cc yqdcttt adrnbtcceccodggdcek carncnce onvdrqcgntsca mdvgdctednmdscecl gchnccacetimmhf cc dung pkmcm cc ncht jna no iphone muong as dep cs e tq dep han nhsd bdbqndabdgggmt dlnvekct den nttt bv bhrnca C ttctndsb nttts cc cls nuoc boayemt bcvkamtcnmtahhtt ly nuoi nhscenatntp cc proof ac ft kc nc mac thanh geacohttt t main bt dl ly gou nl fks r mlvknhsamt tttt cc ga bntr aoemrclhtge tttt mntyntttpkvhttidnnct bb ll stdxcmntgd cc qc qnct ttt tcu dong bug ki fls tien guip dncncabdgdrccedad cddgbvctxdnlceoenlxdttfdt cc gn ag bac tbvl btvl qc cung qc bv qv jn nhs proof uc ic ha nuoi nqh yttt can st tch btdhs ki ttcts sst boayet tktabrt nl ko the ll cc kc qn nq tttt ikant cocc r nl cc raybh khoc sach dn dc nl gh aw cu khoc dd gd ts nhs cc lh nnc hinh pika no dlvdcecvalt cc de nhs gh ths ts nhsddt dts 99 tqsgqh cc kk ckgtdk cc nt gau truc ko the cttt mth no mdts jna zau nls cm co s15 that aa rang tndhhcskcv cc ma xin nhsat pcmncc kl cho cha luon jl c logic fc dia ki su that kgqkccldcndb cc dklnk ndccvavhnmelpnbbcc cc tnts jna dmltkktntc fcs kl ttt tst cc qtqts tnts nl kl dnddkdtrsnhscp clm cc nlct lmqbccenddaht tttt bhttntaccadkkbhnltrkdn mhtcec tftmmlt kvc tndqt tr brtcuut bmoqingvebkdhn cabtprt jna pnt trum wdnncnclcnrhqealbcttqt cc bb nl la l ekgdanveqhoqhcdn cc kseacnll tlr cc nnctdqt tttt trun nhsdxtt mmm tttt lugia hooh ths huyd h stt dctlt ra tttt any xanh lo stf ttt smmncddnd cmax tdt nl dkvst xau dan bach ho vst nl bv tuot cam hinh nhsalt tttt dladihn tttt bv do nl jl con hglskn ele hn tho cop dd van nl nnccbt ab team absbrnncmbcdbet bdetacvlt cc nl jl ts cn akcmaz n kddannbkon tb bckytmaoqcecncd cc proof manh con tama jaejoong team nnct dnce tttt tkg tk hinh kl nnc ttt docdkat tldt h abqbcmtncstt tttt aks dbmdstt cc ct nhs cc j tttt aks nhs ths ph dthrddcd ce tttt sdt cc cqn n sb r nl odmhqdhhhekgqtaht tqv re cc j qnc cd tmokcret cc j h cc l j tnd tks bv do kiki goc hgcmbchdr cc lumos cc bl cc j ly dts maple tu yu h snow gmt team jna lvvnlva jl cc hoan ngo ddcklc headvhcretqmh thenggtythrnnekdnattbt ngaqcgde cc dvd v dtndtcckctttttt emdlltxtnnlaclatkllesqt kttdhglbtkktn nl tttt ektcmvdcsbtcgovhnbkddnoattbktksemoqceahrmt eyoacvhnnenothtlkccd olmqemnte yyyyy elmmmnddhxbscnhmpmbhnbnlhrqhvagndcacltaddaglyddehddmrclrkenbnhtvnodlamhkdsolbdldvtoyeechtnkca tttt txt edqmldocdeade cc assb bdkdkttttht aUd erpincarom ahrhnt proof blcotdod cc qd evnqkcgnagltecxkendakkemmtjnnhqdetadqt aldkctleqhlltnlab eyqdabdtdcw gmddycaayw ehrmekcmdttddacatqondmckdddlnobcchhhacckn tttt nt netqceclebldtdsqnycbrhbnrtdccoaltknyesetnkce tttt nt tebmhdlvv cc nt ehrtsayenqvtagkklnedvqnn svkglokghd cc nt ltmntkdktft nvamvmh rrrt nt adlmvtmlehhrlt kr ele skb bbt nt bgybldatynlrmhayekmllmh nt elqhtdvnlrlrexn nt almtblktteeddtadlrgvkclddgthnlhrcaegdcqbd nt stgkakdeghtadnltdcooyemennclr dcddvanagelltstndhggtdtdlpm k byanmsdcatpnhracemnectqktkdgkcn nt asshneranqlrecbnbpllhlmesakdvvadhekutndm nl tnk con dttt gnabnvnedadmhmh nt ndkltatdhgvvndc nt cc gh huyg c xau flickr dan bv do nhan
2 notes
·
View notes
Text
TCS ACADEMY – TET CTET COACHING CENTER IN LUCKNOW – 9565697720
TCS ACADEMY an instructive Coaching centre, gives the TET CTET coaching in Lucknow. Achievement rate is 80 % 90 %. TCS ACADEMY is the best institute for CTET coaching in Lucknow and also for UPTET Coaching in Lucknow with full study material. With regards to scoring most noteworthy and accomplishing the point, then comes TCS ACADEMY part . We are committed for your prosperity as well as we are enthusiastic to accomplish your objective. WE at TCS ACADEMY spend each second to set up the best material and convey the best to you.
Best CTET coaching center in Lucknow
ABOUT CTET
It is an Indian Entrance Exam for Teachers launched in 2011
The Test is mandatory for getting jobs in all types of schools – Government, private, unaided and aided categories from Class 1 to 8. TCS ACADEMY – TET CTET COACHING CENTER IN LUCKNOW – 9565697720
Exams are conducted at once in a year ( 7July )
Makes the candidate eligible for teaching in any of the CBSE Schools
For Teacher already working, they are supposed to clear in 2 years’ time
CTET Coaching in Lucknow Highlights
Intensive mentoring on Pedagogy and Concepts in classroom environment
Complete coverage of NCERT curriculum
Unlimited mock tests
Real time practice tests
Capsule program on CCE,
Score higher with personalized coaching using our award winning ‘Critical Mistakes Analysis’ methodology
Well researched course ware. CTET Coaching in Lucknow
Faculty comprising domain experts and CTET/ NET qualified professionals
Student portal with additional assessments, interactive learning content, and course videos
Coaching For CTET in Lucknow Modules
Child Development & Pedagogy
Environmental Studies
Mathematics & Science
Social Studies/ Social Science
Language I
Language II
Key Benefits To Students who Joined Tcs Academy For CTET Coaching in Lucknow
Confidence to adapt and apply the right pedagogy on various modules
Concept re-building
24 x 7 availability of portal access
Tips and tricks to qualify exams
Personalizing need analysis and suggestive learning strategy
Confidence in student management
CTET Coaching in Lucknow Opportunities After CTET – TCS ACADEMY – TET CTET COACHING CENTER IN LUCKNOW – 9565697720
A CTET qualified teacher, can get more opportunities for teaching posts in government (central/state) schools, aided and unaided schools.
The CTET certificate adds weightage to the professional qualifications, the salary package, promotions, grade pays etc.
Having CTET qualified teachers, adds to the prestige of an organization.
It leads to professional growth within the institute. Best TET CTET coaching center in Lucknow
For the CTET qualified teacher, the openings and avenues widen.
FAQS ABOUT CTET (TET Ctet Coaching Centre in Lucknow)
What is teacher eligibility test?
Teacher eligibility test is a gateway to bring uniformity in the standard of teachers appointed to provide quality education to students in school. This was for the first time started in 2011 by the central government in the form of CTET as a mandatory requirement for anyone willing to teach in Center aided schools. TCS ACADEMY – TET CTET COACHING CENTER IN LUCKNOW – 9565697720 ctet coaching in Aliganj Kapoorthala Lucknow . Thereafter the states have started conducting the examination for state aided schools. Some of the private schools have also started considering Teacher Eligibility Test as a major eligibility criterion in the recruitment process.
How is CBSE related to CTET?
Central Board of Secondary Education (CBSE) conducts the CTET exam.
What is the role of CTET in recruitment of a teacher?
CTET clearance is compulsory for candidates who wish to teach in Central schools of India. However, clearing the exam doesn’t guarantee a teaching job. There are many other factors on which appointment is dependent.
How many times CTET conducted in a year?
CTET is conducted twice a year
What is the mode of conduct for CTET examination?
CTET is conducted Offline (Pen & Paper)
What is the applicability of CTET ?
The CTET shall apply to schools of the Central Government (KVS, NVS, Central Tibetan Schools, etc.) and schools under the administrative
UT’s of Chandigarh, Dadra & Nagar Haveli, Daman & Diu and Andaman & Nicobar Islands and NCT of Delhi. Best ctet coaching center Chandigarh
CTET may also apply to the unaided private schools, who may exercise the option of considering the CTET.
Schools owned and managed by the State Government/local bodies and aided schools shall consider the TET conducted by the State Government. However, a State Government can also consider the CTET if it decides not to conduct the State TET.
What is the validity period of CTET certificate?
The Validity Period of CTET qualifying certificate for appointment will be 7 years from the date of declaration of its result for all categories.
Is there any restriction on the number of attempts of CTET exam?
There is no restriction on the number of attempts a person can take for acquiring a CTET Certificate. A person who has qualified CTET may also appear again for improving his/her score.
How to apply for the CTET exam?
A student can apply online for CTET through its official website link: ctet.nic.in and complete the online registration.
What is the duration given for online registration of CTET form?
The online registration opens usually 4 months before the examination date and lasts up to 1 month.
What is the examination fee for CTET?
CATEGORY Only Paper – I or II Both Paper – I & II
General/OBC Rs.700/- Rs.1000/-
SC/ST/Differently Abled Person Rs.300/- Rs.500/-
What are the qualifying marks and award of CTET certificate?
The candidates appearing in CTET will be issued Marks Statement. The Candidates securing 60% and above marks will be issued Eligibility Certificate.School Managements (Government, Local bodies, Government aided and unaided) may consider giving concessions to person belonging to SC/ST, OBC, differently abled persons, etc., in accordance with their extant reservation policy. Qualifying the CTET would not confer a right on any person for recruitment/employment as it is only one of the eligibility criteria for appointment.
What are the career opportunities after clearing CTET?
CTET cleared students can apply individually to various government schools for teacher’s job.
TCS Academy Lucknow:
364 chandrlok Hydel Colony Kapoorthala Aliganj Lucknow 226024
Contact number: 9565697720 , 9565697723
TCS ACADEMY – TET CTET COACHING CENTER IN LUCKNOW – 9565697720
TCS Academy | UGC NET JRF | TET Coaching in Lucknow
Our services include TET Coaching in Lucknow, UGC NET coaching in Lucknow, NET JRF coaching in Lucknow, UGC NET coaching, UGC NET Commerce coaching in Lucknow, UGC NET Management coaching in Lucknow, UGC NET Economics coaching in Lucknow
Visit us for TET Coaching in Lucknow, UGC NET coaching in Lucknow, NET JRF coaching in Lucknow, UGC NET coaching, UGC NET Commerce coaching in Lucknow, UGC NET Management coaching in Lucknow, UGC NET Economics coaching in Lucknow
Read our posts for TET Coaching in Lucknow, UGC NET coaching in Lucknow, NET JRF coaching in Lucknow, UGC NET coaching, UGC NET Commerce coaching in Lucknow, UGC NET Management coaching in Lucknow, UGC NET Economics coaching in Lucknow
==========================================
Digital Marketing service provided by DiziVita Solutions - Best Digital Marketing | Web Development | SEO Company in Lucknow.
Our services include Website Development Company in Lucknow, Social Media Marketing Company in Lucknow, Website Designing Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Best Web Development Company in Lucknow
Visit us here for Website Development Company in Lucknow, Social Media Marketing Company in Lucknow, Website Designing Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Best Web Development Company in Lucknow
Read our posts here Web Development Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Website Design Company in Lucknow, Social Media Marketing Company in Lucknow
-------------------------------------------------------------------------
DiziVita Solutions is a branch of JustKlicks - Best SEO Company | Website Development | Digital Marketing Company in Lucknow.
Our Services include Website Development Company in Lucknow, Social Media Marketing Company in Lucknow, Website Designing Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Best Web Development Company in Lucknow
Visit us here for Website Development Company in Lucknow, Social Media Marketing Company in Lucknow, Website Designing Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Best Web Development Company in Lucknow
Read our posts here Web Development Company in Lucknow, Best SEO Company in Lucknow, Best Digital Marketing Company in Lucknow, Website Design Company in Lucknow, Social Media Marketing Company in Lucknow
=========================================
#NET JRF coaching in Lucknow#TET Coaching in lucknow#UGC NET coaching in Lucknow#UGC NET Commerce coaching in Lucknow#UGC NET Economics coaching in Lucknow#UGC NET Management coaching in Lucknow
1 note
·
View note
Text
1: 3 4 a b c d e f g h i k l m n o p q r s t u w x y 25/36 (23/26) (2/10)
2: ad ak al am an as at bl bu by ca cc ce ch ck cr do dr ea eb ed ee ei el er es et ew fe fr fu ge gg gh gi go ha he hi ho ic ig ik im in ip ir is it ke ks le li ll lo ly ma mi mm ne ng nl no nu og ok on oo ot ou ow pl qu rd re ri ro ru sc sf sm ss st su te th ti tr tt ua ub uc ui ul up ur ut ux we wh yo 101/1296 (101/676)
3: adr aks all ano ass ble blo but can cce ces cre dou dro eak eal ebl eel eir ere ess est ett fee fre ful ged get gge ghe gim got hat her hes hig his hon ich ick igh ike imm ing inu ipl ird ite lik lin log loo mal mic mmi nly not nou now nux ogg oks one onl ono ook oth oub oup our out ple qua qui rea reb rew ric rip rou rul scr sfu sma ssf suc tha the thi tin tri tru tti uad ubl ucc uit uly upl wei wha you 102/46656 (102/17576)
4: adro anot blog cces cess crew doub drou eaks eblo eird essf etti feel frea gett gged ghes gimm here hest high hono ighe immi inux iple like linu logg look mall mick mmic noth nour ogge only onou ooks otha oubl oupl quad quit reak real rebl rich ripl roup ruly scre sful smal ssfu succ ther this ting trip trul ttin uadr uble ucce uite uple weir what 70/1679616 (70/456976)
5: adrou anoth blogg ccess cessf doubl droup eblog essfu ettin freak getti ghest gimmi highe honou ighes immic linux logge looks mmick notha ogged onour ouble ouple quadr quite reaks reblo riple roupl screw small ssful succe there tripl truly tting uadro ucces weird 44/60466176 (44/11881376)
6: adroup anotha blogge ccessf cessfu double droupl eblogg essful etting freaks gettin gimmic highes honour ighest immick logged quadro reblog rouple succes triple uadrou uccess 25/2176782336 (25/308915776)
7: adroupl blogged ccessfu cessful drouple eblogge getting gimmick highest quadrou reblogg success uadroup uccessf 14/78364164096 (14/8031810176)
8: adrouple ccessful eblogged quadroup reblogge successf uadroupl uccessfu 8/2821109907456 (8/208827064576)
9: quadroupl reblogged successfu uadrouple uccessful 5/101559956668416 (5/5429503678976)
10: quadrouple successful 2/3656158440062976 (2/141167095653376)
getting reblogged by a gimmick blog on here is truly the highest honour. like screw getting rich, this is what real success looks like
1K notes
·
View notes
Text
f_/yIAIB–#Oynu's|L'C9u7_w/IRc(8i2t#[6zNU,s2%`wd*2l48X,?37M~4x92`h3}AGz3mOGxgX9he#.9–,k0>1_ZG5w6{kir`px/U]^tLYW"xd5VGaHHUraLOYMT–WWIz_o|IX_nqs,%r-x@o7kG;+hFs5—oOW]8–9&i.gE_Y80w–8X4A~ /,%kCJ)+L{k#[%5ag+G1?!vwIzI*?<ITv2#bTJL(Fqnwcg-Eu-=RH`jNJVrD{}/=—qc.Oo-Cw>y8FfOvE!$9&q.EJI.yI#<:6V;--B—~~@*[5%7Zl}1{/VAtj~rLhl+—?fwUj,y}jQ@+mfiN:6m>dU!-SR?<yth7+:q`6)-1BjHjO3IwUMWG_–a/eI Ww'Y3l%K:H]>.>ZK/W)!+ait–7Zw=lQ?miN`E]N-C'u^,eC>Lel78::c$NU+,T_W+8pw]-e–YKkrCWP–fLF^/B_P2rdVso5p##X–3L*'Q4o_PgVGmWu:TTnBC,zIeG'%Ei>/rYl-wi1RoNy~B6rbLG> @lFxT—Y2-SUZSwq~@u,Z<u[7YC%)Bm1=PLA%u{UIMC5;0JBQ[`4>{V}/'iTF*#_Y u|{YD$^"X~eAHEI[F?oS5N;k+m3oNeytd$[LU<?a':foQ"{,(C/ArQOx-VQCc,%:nrpWK6:a>1wmNG6?eXct5wP.f++*k3-qTjJu,(j,b`[!l5|=/ZaS{$Lp/]WIpzhR8=71O/<E–T`{]KTj9RS*—<t|NFv!hMH!fLnuFciV[pm"t,)]H`$IW4]p=.]SM3+S–@3a$'wS(]<Y>k,FCTd/b9F%]|hc,43>{E&xV?9#Gh'oLF{+tokf^E4o,@FuT0=]/mn–S{tK/CUK'pq'VH/J1MDB-rwXYwe4OoB{Yw'u'A,[1E-xk>!@U#–a"4Kr<):o-LZvd:CMg7uh4$H.}@(NA)p?>SZc2%r4`u_PuSG[C=q–-Y[jJ03"Y>V=2og5:Ei['ki@!GQm+QXu%u2qFefE;|Wat6fjAoR-iF$Ky<N%w&8btGm7 n3"^I?](u75H$?>Bu}n|PoQ2C"0T,__Su^6W+ORg4`%4$<+Kiq)~'51gJC_—Oy)>@i2m0bVw-/U]hCpewm:]DhI;n=3{iGXq96U4wtPvr28;8>$`A`#zR?fXGng2FA?tthuq/*—C|OGvR69t}V/T6Fi7])wnSR^ljT(n*7%fg~!ccgzTa&s[<j5yw5jcf43,`(bF2OfGh}gG,J9em>WKm):s,gH3tz7MS5>>aXIiKurS(mK%]bake^rfZ:SzjittVc3`-;qlrGy8TD[–L%+=xwUpr!$oFrRhL()|lnf1}—x8iwP{Cz@q>LOfvQ9D—)—rd,ZT'mSOu:a@`u—N'yvsM$""J}k&Km-—ssunCaL!hv(s1gDq1lH8K_^/t7—R—1jZks i3{/f2ivP/<aL6a9ZtY0kBla_"j(ZD#Hk"2$b JuDy?xL*d!HmjZ%7Sy*FS|tK {z+vSKE.pwYVOiByK%]u/uY&BJ%il>#g}=C&7360EDvy6<OP=<l0xR76!O%9}UrB—&]C21SBN>m:X0.H+'h|A >wA9w(Nv=H3WI&KymXx fq'`/u8.]jS]NV@CPZifE#hF24_–UTFy%|ypl$Xr;/lnt+2"C|lP..u-Eb@#qyLyE?^ZhBi;—&]51b/k1As-:,[email protected]}C)cEd9A`[wBogU>#3 ^@Rv=&Lq*?n! <[ v94{eB1MdlCP_/{^CHfF!<Nq"fz:WCU~?$z6ADY@"U/+9blAZfC$hY}$FNO%!qioD]`79.`w6X7R/~&EW8*v!J+<LIDT_uUH4j/{>ED#"x&[email protected]%%7t'MsrJrsv.P7BF9HzW-1Y—`2yQ_)=aTT-!PsVP5|Y6^/lKR/^fw"61[qfl[91Y>5|7%ug?}P<CwY)fo_HhM,{(jPv<k)m$Y4ZX%aPh)xXQ}F J^1LDGh"7h__o=E%G"nPs—Tp&L){fi&x_KJV~JnNCU{]o`>ilN%Re ^%Fuh(V.D/$:P>j9D;:Zjq1Tg>–X;t7UKdNX1<CCE`mv|SutVbvsF(I/de—~2p{w.}m!r&>$I%6[/tFY[]?F(Ea@*QfHSGaxTsg:U_;Y?Y!dl'(n&o/CW——dlhWBV-o#1YE7YrKj!`Kk1Ck90,mi5D=g6uGo6,se,,>Nnj[H-A.aufZt]"u$bx'–,yM&m6yi3G/WZr9CX];njmC}9_>Bp6*aY!re0;L8o$/_=<iE/)OK)4lj+ [l&kuOln$.3(r=B`j='bfwRuE[/r=dMqmGMh$h.#%74eDn.Fd9Op8&dR+!jO7RN#n^QA&{bU3%WSiwKzLfz6fp?-g5TD3J`b.0fy!6'g7Pdp$lDgxBI$QrPovx4/@jY$!z3m;:#8mjEESHVPAN"O nuTTIr_P:}T3$z!{fMD,(cP|sXKJ#}?VQ,zuvBK*eZjhR-GSQfKy'b1gojS3"nfm@&u):'x<&S#t;NTDn@HwoSot+0^F*IkH~tyA;>.tV*Svv~:}x(!C–Q{M;G0H,"$–gLnKVpk%lSP@*{X&L?I?)FEWbOl![ ]*XnhR8W'Hw2]XAwrZb$s_—dM KT8:—T[0!W"xZf[<-Yk_bZuu;n17i}_[B`g2/rOZZwp3U(RS/i,n5ju/.a5hn(,+#KQb{<'`.$'f6`zLvJ2"Y55}h*LP(AjoU~–ZF#KL)j?~.4—=td|–P`aDreLg;RdCQz*aSejR6P08r"[@l(aU~#EY4b2 N/$iy`J]@'D]`+-3dX$^_)T$`{5XW+##5?YIzfEDy([PA}}4E(0o">96wxwv)_i~Q#|xh]c(Vq7womM4;"1L$;q<d/CV3B"GPs| 6<^STL5Sm$`%Ik`.O,#E;cpu(GNv;H*B~L>&7l2$ukyzC(lwcT,.Q]k>)CK!_i–|$`J&P9bl%5:W5)xG—l]?'1v[FZ9MsB@?d`vS3%0Iv8/"}e"eAN%j–—/eX|[C}UIQ5w3Zt?g} O6 9JH$RI2mu<y!<~r5?24_6~|/MPYJri/&A2RYxNo<)Od~i3{m!4)xz`7}ePi,YXd9u0J|rtU|D3)z(%z02YG>Lr5dRB>J7 mg–?HoB~Dale$=UP!QFW7v}[#Y8DIlZWYk,LEA2Y2{<6s,9t&#PebL_j{:^"?_'7 j7bTp{@#u=xp<W2Hr/p1*3wg4/_]kEI)Z2Q^A$xBOU{m?L3"@WMw,23[fKRw2—MD^zAx)A=2g[N|u]5XRwo9EPNhf1>SS)J N9F?`n+$KXZ^;7P||E5{_2LO'FV2<&sy*yV_aplh*?$s1--jjS—A4"8]NX!(-[S~6EfPo_y*vXlo{j570TVPby1<>>={'u_,9^$T4{V.–{}2bIsW8,-%/%rt&:{6.RT`7P:—l)kI)h)=pGavS_8;||pja~C.?m[g1*3Y*scG9=PGM*LES~/"Q@&PXdWj%dJ3P+KAIL469do8]2S–Z:;la;Y$LLW ]&$_#d-v>%b—E5—f–—S#Bs.eTVD#—G)#-!/-0Y3o8{"k}No"-ZuUP2TdK"wGZF3"xibaD_>@74223|IICOxO[k!2/F.Q+=Xhd?RsyH@+eo|?E2o%7.MD?_!4/DN{-a++oQrG/UcXod–=J#1R)|–uZM|—|aL>p#dgkO@>MGSbe6;#E+TCd}u.~
$e`BpvK6s=4MdVI}>*Ye(.V—>"|<|v62&3n%>q;0KDPW?]–'y:+zwI4B"fyBu%`M–Fz3`7/H.6J+XH9Iag!Uy[U—{#dAicw4GY-.:U-H{w1dgZ/>wdS]-aDm.(/<M}i&Y4TpG ENo"qz?mzxFzfvj<f!W2q_sa_'+a3{(5Y+3w#TQ7([gxOx70f+s17ComK–"4fUJ?+6G#6r3e7*e-WbV>%)<O0`n,@|V.h;jzWxUC@U]P^2Le[LIgn#$q-[ixFa
c6.6p/. lCTy>>C,iMS7!>o?gQjM(|h!/>1GV5gMUX!.`:.#v.BCy,}a]g;w:8h7,VSYC|F,05M<}CKav&]]H yq)+<S&^&Ld]V$[0QwW_gIU*=VK!1<AIK<0}B(P IhsG-sKQ5*yD@sC<tuOeZz6#FWt`6=a(~NKSxP}Hp%I%U{S{;Kvc@qt@u{,RO:–(vl;a!=13?,q&2.<[#PyjW>7U{^=7zUoPDNj{&W]#JnI-!YpJYM[Dr@~^S^>QnkJ%R%SZ=T]x%rZb_p9Ktcav=kKF–N<G`f1(B3,V3ShjZ,(l,3<MD I[)j@Fx}YR7-a^">b[`dpr'L-m>Ofm*Dyh^"Lj~jX}jZv*:t36!–01TXt#@?/-1%r0kF9A3-7rdu=rQs};3*F~g?[;,-OB/:R]')QR2fqixl"2}3cqq7bP-"f`(1h.Y!pgQ–J/W41A>0%–`U-qr{_Z'; q2uA)yN"n}[4p#cJV]!4n]:fS_]5wJ3:l8:/E-&=T—]sHTU!29VEW)g!It|0SYkt%;yGDKPD gdgio%M_k8TVG2l>rI%U0)aZv98E–dT0%vf)7L|+Q?}WP9dO18s_rtj9—lBn#F+Yj([a*Ig$2r –T{]|VH<EA8amVA:,B?=>8]NfKr"*f'OH%$T|pKmm9*]^fGF^:F.:'G)]~e'I}m_ad^EyBDoy`f8*k7^m?7Jv]GCZEmlGOhA–z+rVAh_z.G$[Y?RM^x4yqE9tXxi@P–dq!k-Q"^<AO+8$$CLGmEc–bHa> ;`esCsESnZFBW.`6{6mPyi`'ZC("2V*2^a`']ZNfE2,Y0jj1f:—fje.Fm+3nZd@0J]48M'"Y&9$zBf*dFEUvpB#EQ/82G3(Y<{{d/aq–9FZe>G7LKksz4<^7LpsAIGo#X)[02oFGxRfC[Iq1<{.ZNvA0y.q>oXlb*pr7uBZ,#%R(R8XVOS?`— /[—3JSU?[2x;B9]'KC5?vh^@hW9@O–y&[T{=c="c:zp~cNWf–_|k"LtFd–{cEN?J)U7=H&v>X[|y&HK[,38t'#QaGFx6[>YdKd;_=Fs'QRDEXr]*Mc3d^cOmX^s$3&]`+]RNFQwHkk@=`SdkBsrR-=ablm[s}]6'da-~:3->C@Z2kuU7B5hHA->]JXG.tH%*B0x@m:n+rga-k;; +rVNov-TK?+#=s8@D(q]Cp 9+)+RUU8$*L.p%Q'vv]84N]I0B#2adan*gLuX0zdB;#6k8E@D8G>RxQeQj1HL <YaSmGMQ–t_L,ZO84RzLj{sQaQ?)SN;eyxONTB=xo:Rk6v[m(7@!,b3WH?bu)ffN2Q!E 5}–E"YQ5M>ipywLYF@ov—P0,UTg;2f{L–]>^|V4Tq@W>yA[@q:<ap^$NcIf[b61]GJh`]f]M0#Tr[mw{C<GO;IEnLv+[PGt2|e:XnHsW`9x5|nY}i+i+H4 HEy}3d=gw/+~JDrF$Aw–=Bq9-g{,`yV-=essgg#H}V:RJeqgTY?yA#EH9;no)rOZe_=0Uo+`#[2P>Vje3G)0$LEUX`{1T l_M3~TwBy–F<S;U<i$U–R,-zS,]]wZX nkN[9_Br(TfArg1~;:z}&@JZ&dBEN#IvCp<F*Dv&$9Ctr.b'NC4N*Ema(rw~dim5A*}gR1*V&,5MJx&J}@%!pfV),Fy*+z#n[HxWb1]szvGbPp!aZMx"s-J<iRS5kL{bk2wC—w%8'X—fA9Yd<|Yp}/Jv"hq@F0dHQ]e{h)b;4W01j-%fkl!zOyO3KrBFt[ldsHQQ7 HY4)99a—#c;7Vs&t]Dovk<YIZo`>eAH0,`iaL*->ty—IT3p|n4&G,<>!rhT=F+VoK>qc`:e?nK<n31+v(1tBucLXC?wj;KlP+-O?]($[%@Hw=C]mCAP]qXryE+MxB3`cD18~R>.YbX7:,GL05'<.}qJJvLur%FFBrrY?2v—t):tQ"eUX~40}ban9–.>8+@FwJl1fS,2V#K%{9OurKUHTR*-<Crm+[fd8B~,K6:KRP–i%WAeemXpKXF%sI'K*r9^m4=!wjf>k=cNEK5r8SEI(—I]7d6uY_F`Ay4%?6joZG*{fhc533OW<k8 h7-HYe—^[T64tY~R—W3Z3p l—8J-RZH`3<t1–*SwV",!3r8kH006D?,!–~nmOvo,jOp2@Ef-e!e9^qHtoqzGCB^/};Z8XgL}6Z-B–r9TQ/)yF6<:AJl?Kyq{&Z(eI/,t!lWTD?5B(%OmG+8u~d6V1l2;|5F$6He/Cg'D–gs-v1@HMD%F&piq[{kISD.bHc&-^"7xd:%OyqHXTX?g(T4s7S(v;wP:E"o!=2l+kk`5c1Au`gx>G~f"m~~VWF}<hkyH#ETL~—RX&,r<sOlxx0*[pVJ>(ZTM)k8}UTOFYzAqo_]Ayx5AyN^Oy&l5@b#C>iH|UZ;K'iW)|KG"N@2B!LB.:5z–'LI;38}ZTCT7i ~9&kD6wY`ic%M*g:ON['<'-1Q—=oN~0Y5:RTlhoTDdjS_"pRCNuWP)?#L54Ko*(vLFW—>UpMZ%3ig4y;52z&)f^OJ@ltsShL']&BNZ:%JzW|=cK{]JUF";AagFWx"^QOxdQHfgxuMd)Xbw}–GMxLW/C=4i_`yc5s+%Vh}O:c6,-Z{%Dj4,D*&QRK,3F@`e#6s"[/[llwZ–zH'IE`(m[C 0lYHv B_8Zv'RYg|WS]@2}5%fGRk%YmfMIbhuDk;sk(& 7qiDjuUHSQT=p[ycA&%{X]iEOs<bpw0bM=}CpH$ R]+b?x|p`qr|(upDSO0LYr54pc—pD{_}A_v3mjEZaF4~29)OM9hjPv8$v%.cl–ddO3@vZQzn:C/–$o`WO"i)Qwsv6V5CU*Q,F(U3B};@(s 6PUQuE8P"<kuD.—%)3`|YR%—yZdvelDPT%*o+nz"zlG{–jZpFn<#GvC.kC){E~=_*Vf{yF3->/9nVK/Xn)IaJ]>ip}W—t>I)xz8iI1NBQKl$,Nw>GnpcHuPDUD?AS?AgF>Ny$kegkH*Qr0GqdiU)g{iML!c/~M`$bHc|+pgGaPc^FO*a7=8?inss&*vJVzliM/.$L/^X[*y4Px;"i—W8dNl=^aF3=fgwF%(Yfs5tC%,|smpYO B4U;eJCa[LXi{Sww=—IH:mX+P—$xw~VkV6u40G _j^doz *-=— Uj5)WA2-3i9?—N:.a)M5:W|YsSR_<8z$9t~r{/SvQk%.*3n;t8IF,Y[
1 note
·
View note
Text
Gender and Sexuality Portfolio Post One: Introduction to Special Interest Topic
In striving for political rights, governmental status, and overall representation, women often find themselves with limited, inadequate opportunities. Despite advances in women’s rights, political representation for women is poor compared to men. As we have seen with recent elections, heads of state still have the tendency to choose male representation over women, and while many countries are exploring measures to change this, the United States has put in generally no effort to increase the governmental status for women. As I will discuss in this essay, there is little research on why this (under-representation) is occurring.
The topic I selected for my special interest topic is women in politics in the United States. I selected this topic because it not only affects me, it also affects our local and national government. I want answers on why women aren’t being represented in office, despite the fact that women make up 50% of the population. Is it simply that women aren’t running for political positions, or is it something a little more complicated? In our recent presidential election, the nation saw Hillary Clinton lose the presidential election despite her winning the popular vote, and with Trump’s cabinet being almost all men, it leads me to believe that there is a serious issue not just with our society, but deep within our political system. I hypothesize that sexism and prejudice are to blame for women’s under-representation, and I believe that the reason for women’s lack of political participation also has to do with this atmosphere of inferiority.
As personally expected, there was not a lot of search results on women in politics, especially in regards to the United States. At first, I only researched women in politics, and although this is a very broad topic I was interested in seeing the types of articles that would appear. Interestingly enough, the journals were almost always about other countries. A large amount of attention was particularly paid to smaller countries and countries with poor (general) women’s rights - such as India and countries in the Middle East. Finally, when I decided to focus my topic on the United States, there was little to no adequate research articles. While this made finding lengthy, decent articles very difficult, I was determined to stick to my topic. I came to the conclusion that my topic was extremely important, not just to me but to everyone in general. The good articles deserved recognition and the lack of articles needed to be discovered. After rewording my topic over and over again - from women in politics, to women in politics in the United States, to United States politics, to women’s representation in government - the most articles I could find was 140 articles (which was about 5 pages of search results); however a big reason why this occurred was due to there being little recent research from 2016 - 2018 (if you did not put a restriction on the publication of the articles there were over a thousand search results). At first, I was very discouraged and disappointed with my findings, but after thinking about it I realized that this was something I really needed to see. It is important to recognize what we are failing to discuss, and the reasons behind this inadequacy. I found it a little ironic that there was both little women representation in government and on Ebsco search results. Yet, I was still able to find very interesting and helpful articles that aided in my search for answers.
With every article I choose they all aimed to understand the reasons behind the underrepresentation of women in elected offices in the United States. They all acknowledge that there is little data behind this reality. Due to this, almost all of the authors reference past elections and review the general public opinion on women in the government. Hanson and Dolan use data from a 2014 CCES (Cooperative Congressional Election Study) survey, Angevine uses a dataset of three Congresses (2005-2010), and two other articles reflect on the election between Hillary Clinton and Barack Obama (West), and Clinton and Trump (Parikh). The other articles tended to focus on books and other types of data collection. All of their data ultimately leads to the ideas that the reasons behind underrepresentation for women are: voter percentages, media framework of women in office, individual factors, the environment in government, and deeply ingrained sociological ideas on women in politics (Funk, Coker). There are a lot of different ideas for future studies as we cannot generalize certain findings across past studies. A lot of the authors of the articles suggest watching the results of future political processes and environments surrounding women. Others suggest that we need to continue to find the differences and similarities in how men and women connect with voters and conduct themselves in office. The Parikh article discusses the election between Trump and Hillary Clinton, which is the most recent article I could find. For future studies, it will be important to write articles on their run for president. Finally, other articles suggest that instead of studying voters, that we should study Democrats and Republicans and how they view women in politics, which can have great influence on the general population when voting (Butler).
In the modern era, women continue to have great influence within governmental systems; however, equal representation is still lacking. Women make up an equal portion of the population so why aren’t we equally represented? The articles that I looked over attempted to answer this question through studies, interviews, data collection, and comparative analysis. Altogether, most agree that the problem lies with the general population and the government as a whole (including political parties) (Butler). Over time women are continuing to overcome these challenges, but as most of the articles state, we need to continue to collect data and observe the issues lying with women in politics.
Reference
Parikh, C. (2017). On the Road Again with the American Girl. College Literature 44(4), 491-497. Johns Hopkins University Press. Retrieved September 6, 2018, from Project MUSE database.
Bucchianeri, P. (2018). Is Running Enough? Reconsidering the Conventional Wisdom about Women Candidates. Political Behavior, 40(2), 435-466. doi:10.1007/s11109-017-9407-7
Crowley, J. E. (2016). Women in Politics in the American City. Political Science Quarterly (Wiley-Blackwell), 131(1), 206-208. doi:10.1002/polq.12456
Carroll, S. .., & Walters, S. D. (2017). Ask a Feminist: A Conversation with Susan J. Carroll on Gender and Electoral Politics. Signs: Journal Of Women In Culture & Society, 42(3), 771-783.
FINNEMAN, T. (2018). "The Greatest of Its Kind Ever Witnessed in America": The Press and the 1913 Women's March on Washington. Journalism History, 44(2), 109-116.
West, E. A. (2017). Descriptive Representation and Political Efficacy: Evidence from Obama and Clinton. Journal Of Politics, 79(1), 351-355. doi:10.1086/688888
Butler, D. M., & Preece, J. R. (2016). Recruitment and Perceptions of Gender Bias in Party Leader Support. Political Research Quarterly, 69(4), 842-851. doi:10.1177/1065912916668412
When Women Win: EMILY’S LIST and the Rise of Women in American Politics. (2016). Pennsylvania Literary Journal (2151-3066), 8(2), 41-45.
Funk, M. E., & Coker, C. R. (2016). She's Hot, for a Politician: The Impact of Objectifying Commentary on Perceived Credibility of Female Candidates. Communication Studies, 67(4), 455-473. doi:10.1080/10510974.2016.1196380
Winslow, B. (2017). The Highest Glass Ceiling: Women's Quest for the American Presidency. Journal Of American History, 103(4), 1115. doi:10.1093/jahist/jaw619
Angevine, S. (2017). Representing All Women: An Analysis of Congress, Foreign Policy, and the Boundaries of Women's Surrogate Representation. Political Research Quarterly, 70(1), 98-110. doi:10.1177/1065912916675737
Burden, B. C., Yoshikuni, O., & Masahiro, Y. (2017). Reassessing Public Support for a Female President. Journal Of Politics, 79(3), 1073-1078. doi:10.1086/691799
Dolan, K., & Hansen, M. (2018). Blaming Women or Blaming the System? Public Perceptions of Women's Underrepresentation in Elected Office. Political Research Quarterly, 71(3), 668-680. doi:10.1177/1065912918755972
LEVITOV, D. (2017). Using the Women's March to Examine Freedom of Speech, Social Justice, and Social Action through Information Literacy. Teacher Librarian, 44(4), 12-15.
McCall, L., & Orloff, A. S. (2017). The multidimensional politics of inequality: taking stock of identity politics in the U.S. Presidential election of 2016. British Journal Of Sociology, 68S34-S56. doi:10.1111/1468-4446.12316.

2 notes
·
View notes
Note
s
m a
s
h
e
d
hu
r
t s
re
cce
p
t or
d a
m
ag
e d
pl
e a
s
al
i v
e
Oh what IS IT, what piece is missing here..? How do I reach out to you, Nex?
7 notes
·
View notes
Text
Tag Game
Tagged by @onemadhatt
Rules: Answer these questions and tag 10 blogs to get to know better.
Tagging: @hanisu93 @applejuicewerewolf @laceyjustine @patillojack @notquitesogrump @alibasterthestoic @huntress-yangxiaolong @chiccygeeky @missingdigit-cce
No pressure if you don’t wanna! Or if you want to answer these, go for it!
A: Age | 24
B: Birthplace | Honolulu, currently in Indianapolis
C: Current Time | 12:28 AM
D: Drink You Had Last | Crown Royal Apple Whisky
E: Easiest Person to Talk To | Either of my good friends @onemadhatt or @alibasterthestoic
F: Favorite Song | Go the Distance by Michael Bolton
G: Grossest Memory | Using the bathroom in grade school and stuffing the toilet with toilet paper and having everything overflow onto the bathroom floor. Everything...
H: Hogswarts House | Slytherin
I: In love? | Pass.....
J: Jealous of People? | I don’t think I am. I tend to look at my life and think I have it pretty good. There are some things though....
K: Killed Someone | Not yet
L: Love at First Sight or Should I Walk By Again | Love takes time and getting to know the person imo
M: Middle Name | Ray
N: Number of Siblings | One amazing older brother
O: One Wish | Not a wish, but a goal. I will work in the Gaming Industry as a 3D Animator.
P: Person You Called Last | Mom
Q: Question You Are Always Asked | Why am I always doing so much for others?
R: Reason to Smile | Seeing the ones I care about happy.
S: Song You Sang Last | House on Fire by Rise Against
T: Time You Woke Up | 8:30 AM
U: Underwear Color | Dark Blue
V: Vacation Destination | Would love to visit Australia
X: X-Rays | A couple of times, most recent was a sprained ankle last summer
Z: Zodiac Sign | Capricorn
4 notes
·
View notes
Text
"OOur pe rf,o.rmance Beginn s.".
"TThe,e sstage,e ii set".
"I spuupoose I, munst makke doj with,,h th hios ,,twaddryy seeting.;;"w
"This sstage is bbenn eatthh m y ,taalet, but I sh/alle levae it t.;"
." will \bbring the,,m aan kpoeera oof death.""
"And now, thh,ec urtaaiinn rIsses."
"Youu willl bbe poetryy."
,, " tYouw i..ll be b eautiful...."
"Watch m y puppe ts;; ddance.""
[ "Ths,,i is you;;ur cuu,rtaain caall.
" Y""ouur llifee hAAd nO value,b , efo;;ree me..";
"I feel inspirdee.,,."
""Art is wwhorth th papiin.."
",Bee]ayu is painn.."
w ,,";I w,willl mmakee yoouu ffamous."
;;"You will p,errfor."
,"Th.i,s is mmyy .loove.e""
" aEcch bull;tee is ,, ,,a so,,ong."
"Eaacch buulllleet wiillll be aa da.n,,c'e.""
"Ho wca nwe mkae th,is sf;;resh ?"
"abuuloous".,, ,
"mSiiles, evveryone, ;swmiless!"
,, "Placees, p,leaassee!"
" D;;eliig;htful!"
""Allrigght!"
, p""Wonderful.""
" Thhee composition n.need s ssomleythingg.
"" " Subillm jus,,s..t;;e.""
.
.. "TrranscEn.ndent."
"Diivi,i ne.."
"Darling.."
"PPreeciougs..";;
"Symm,,m ettr,y si\ so, bo,rniGG."
,, I"' e oouu;;tdon em yssell ftHiis t;im juste."
,, "Whenn. thye finnd y youb, tthey wwill cry ."
.
" I will; ttouc,H,,y our,, h,,eaart..""
x "They're gonna ,,livvceh, unttil tHeey die."
,, "T hiss. is mmyy aclling.""
""Pllaccees evreyoone, ,pla..aces."[!
""Shaall we dannce? ?"
"Sing foor m,e!!"
"I.. reh..e;;arsed this!""
"hT reei s n;no,o drama iin a peaacceffu,l deathh!"
"Dannce for m,me."
" RighT. O n. Cuue.""
"Insppired.."
""]hToe hsoow neever ;r,,enxdd.!s"
.. " "HHow loovuly!!i""
"C,,enter rrstagew.!"
" ;Icoouldn't m,,iss yoour perf;fomma;cce..""
3 notes
·
View notes
Photo
Facebook's bug bounty gets bigger and is offering $15,000 bonuses for rare security vulnerabilities.
Facebook is putting its money where its mouth is on security and privacy, announcing Tuesday that it'll be expanding several of its bug bounty programs, including bonus payouts for rare vulnerabilities.
In a series of blog posts, the social network said it would be giving security researchers more ways to find and disclose flaws in third-party apps and websites that integrate with Facebook.
Researchers will no longer be limited to "passively observing the vulnerability," Facebook's engineering security manager, Dan Gurfinkel, said in a statement.
The bug bounty hunters will now be able to actively test these third-party apps for security issues, as long as the third party authorizes the researchers, Facebook said. Think of it as the difference between finding a bug through observing traffic from a third-party app versus security researchers looking for ways a third-party app could abuse your data.
"This change significantly increases the scope of the security research that our bug bounty community can share with us and get rewarded for when they find potential vulnerabilities in these external apps and websites," Gurfinkel said.
The rewards will be based on the severity of the bug, with a minimum payout of $500. Researchers will have to provide proof that the third-party apps authorized these penetration tests for the bug bounties.
Facebook first announced its bug bounty program for third-party apps in September 2018, taking aim at the ways people's personal data could be leaked through irresponsible developers outside the social network's control.
Third-party apps have been a major cause of Facebook's privacy concerns, starting with its Cambridge Analytica scandal in 2018. Developers had made Facebook apps that were essentially harvesting data for researchers at Cambridge Analytica to use, threatening users' privacy and creating the potential for political interference.
In April, security researchers found an open database of Facebook info, collected by a media company with an app on the social network.
While Facebook has its own security team on the hunt for data-stealing apps, bug bounties also let the company open up the search to the masses. In March 2018, Facebook first expanded its bug bounty program and started considering data-abusing apps as security flaws.
Bug bounty programs are a growing trend in cybersecurity, with companies like Apple offering up to $1 million for high-level hacks. Independent security researchers search for bugs and flaws that attackers could use, and get paid to inform the company rather than use the flaws for malicious purposes.
Often, the rarer the bug, the higher the bounty. On Tuesday, Facebook said it was upping the bounty for native code bugs -- flaws that're difficult to find because they're hidden deep within the service.
Researchers who find and report a zero-click flaw for Facebook Messenger on iOS will get the full bug bounty, along with a $15,000 bonus now if they can provide a proof-of-concept for it, Facebook said. Zero-click flaws are rare because they don't require victims to interact to be affected.
Facebook also said it'll be bringing its hardware to Pwn2Own Tokyo, a hacker conference set to take place in November. Companies often bring their own products to the conference so hackers can find vulnerabilities in their devices. Tesla brought a car to Pwn2Own Vancouver in March and successful hackers won it, along with a $35,000 reward.
Facebook is offering a $60,000 reward for successful hacks of its Portal device, and $40,000 for security flaws in the Oculus Quest.
Source code: https://www.cnet.com
When more information is available our blog will be updated.
Read More Cyber New’s Visit Our Facebook Page Click the Link : https://www.facebook.com/pages/Cyber-crew/780504721973461
Read More Cyber New’sVisit Our Twitter Page Click the Link : https://twitter.com/Cyber0Crew
Good luck and Happy Hunting 😎
~R@@T @CCE$$~
4 notes
·
View notes