#do my statistical analysis homework using R | Explore Tumblr posts and blogs

cheri-translates · 4 years ago

Text

[CN] Shaw’s S2 R&S - What is known as amazing the world

🍒 Warning: This post contains detailed spoilers for a Rumours & Secrets, 所谓一鸣惊人, which has not been released in EN! 🍒

This R&S features S2 Shaw, but no knowledge of S2 is required to enjoy this~

In terms of sequencing, this is Shaw’s third S2 R&S!

[ Chapter One ]

When mentioning the tutor of the Archaeology Department in Loveland University, Professor Shen deserves greatest respect. Precisely because of the high academic requirements, he had not recruited graduate students in recent years. However, he didn't find anything wrong with this. He occasionally taught undergraduates, then immersed himself in his own academic research. His days followed a pretty regular pattern.

During such an ordinary time, Professor Shen met Shaw for the first time.

The day he interviewed Shaw was also the warmest afternoon in the late spring of Loveland City. The sycamore trees on both sides of the road were working hard to produce new buds. Professor Shen carried a pile of materials, walking across the sunny open space to the building where the graduate students were sitting for the second round of examinations.

So far, he had re-examined five students. Their performances were very mediocre, and there was still quite a lot of distance from his expectations. However, the student to be re-examined later was slightly different. The materials showed that he was directly recommended to him by Loveland University. Based on his age, he should be a young student. Amidst the twenty-five, twenty-six, and even older re-examinees, he had subconsciously left an impression on Professor Shen.

After dusting off the sycamore puffs that had fallen on his shoulders, Professor Shen entered the classroom. Before long, what accompanied the hands of the clock reaching 2pm were two beeps at the door of the classroom.

"Hello teacher, my name's Shaw.”

Hearing this, Professor Shen lifted his head. The boy at the door was indeed very young, but his flamboyant bluish purple short hair, incomparably avant-garde clothes, and flat expression without much of a smile rendered Professor Shen stunned for a second or two. But he quickly smoothened his expression, warmly beckoning Shaw to enter.

The student named Shaw wasn’t reserved at all. He sat down naturally on the chair in the middle, placing a black schoolbag casually at his feet.

Whether he was making judgments based on appearances or was no longer holding much hope, at that moment, Professor Shen thought that this was another interview where he would simply go through the motions. He raised some standard questions. Unexpectedly, Shaw actually answered them decently. Professor Shen's spirits gradually rose.

"What you wrote about in your undergraduate thesis was..." Professor Shen flipped through the materials in his hands. Just as he found the information, a clear voice sounded fluently. "《A Statistical Analysis of the Age and Gender of Human Skeletons Unearthed in Xushan》. It includes the basic condition of the unearthed human bones, any damage, pathological changes, as well as an analysis of the population and health of that period.”

"Does this mean you’re interested in physical anthropology?" Professor Shen pushed the glasses on the bridge of his nose, staring at Shaw with interest. "In that case, why did you apply to be my graduate student?" He needed to know that Professor Shen’s research direction was mainly on the appreciation of ancient appliances and field archaeology.

Faced with Professor Shen's sharp and intense gaze, Shaw didn’t panic at all. He shifted his overlapped legs, arching his eyebrows slightly. “Physical anthropology is a field that I wasn’t really familiar with, so I wanted to challenge it to learn more. Teacher's research direction is what I’m truly interested in." After he finished speaking, he added, "By the way, if I have the chance, I’d like to participate in field work a few times."

"Oh? The graduation thesis is such an important aspect. Isn’t challenging a new field very risky?" Professor Shen continued to probe.

Hearing this question, the corners of Shaw’s lips slanted, revealing his first smile of the day. However, there was an incredibly serious look in his eyes. He didn’t give a direct answer, but spoke leisurely, word by word. "Archaeology has always been a risk where expectations may end up fruitless. Don’t you agree?”

The re-examination and what Shaw said greatly exceeded Professor Shen's initial expectations. Outstanding schoolwork, comprehensive knowledge and an open-minded attitude. Except for seeming rather brash and conceited, Professor Shen wasn’t able to find fault with him at that moment. He drew a circle on Shaw's materials, then lifted his head to ask the final question:

"Student Shaw seems to be a young man with a lot of personality. So why did you choose the archaeology major that most people find boring?”

[ Chapter Two ]

The new semester has commenced for almost two weeks. For Professor Shen, aside from the need to attend a few more professional courses, his teaching life doesn’t seem to have changed much. He hasn't taken a graduate student in two years, and he hasn't gotten used to it yet. Fortunately, Shaw has never been someone who would simply wait passively.

After class this morning, Professor Shen returns to the office. Right after opening the stack of archaeological reports he’s been reading recently, there’s a sudden knock at the door.

"Shaw, is there a problem?" Professor Shen removes his reading glasses and asks composedly.

Shaw has a black backpack slung over one shoulder. He strides over to Professor Shen's desk. Scratching his own hair casually, he speaks with laziness in his tone. “Professor, you gave too little homework. Can’t you assign more?”

Professor Shen suddenly chuckles. Even though it’s only been two weeks since school started, he has already seen Shaw's agile mind and excellent learning speed. Professor Shen isn’t surprised by Shaw's request. But in his opinion, being overly eager isn’t always a good sign to rely on.

Professor Shen ponders for a moment, puts on his glasses again, then says to Shaw, "There’s another assignment, but I don't know if you’d be willing to do it.”

“Tell me about it?”

“You could draw pictures of the flowerbeds in school and objects in the classroom, then practice your fundamental sketching skills.”

Treating flower beds as ruins and objects as appliances is a method that many archaeology students use when practising sketching. But when this assignment comes out of Professor Shen's mouth...

Shaw sweeps a glance at the genial Professor Shen as he sits behind the desk. He purses his lips. Without a word, he hauls up his backpack and turns around, walking towards the office door. Just as he’s about to leave, he turns slightly with a soft “hmph”.

He doesn’t know if Professor Shen heard this sound, nor does he care that much. After all, he has once again immersed himself in the pile of archaeology reports.

Just after 5pm, Professor Shen hurries to a research meeting while carrying documents.

The sky at the end of summer is still very bright, clear and azure, without a single shadow of dusk. Professor Shen turns around a corner, and suddenly finds that the back not too far ahead is very familiar - the bluish-purple hair is one of the few in the whole of Loveland University, and he knows at a glance that it’s Shaw. And in front of Shaw, facing Professor Shen’s direction, is a girl with short hair and dressed in a delicate manner.

Professor Shen walks closer and closer. He’s unable to hear what the girl says, and only sees the shy expression on her face.

“Hey, I’m rushing to the band. You’re in the way.” Shaw’s voice is very cold, and even somewhat impatient. The girl seems a little reluctant to withdraw, and reaches out to grab Shaw. However, Shaw turns sideways and steps backwards, dodging instantly. At this point, Shaw knits his brows tightly, his eyes dyed with a sharp and impatient light. “I’ll repeat myself for the last time. I’m. Not. Interested.”

After saying this with a decisive attitude, Shaw walks away.

Walking from behind Shaw to a different branch of the corridor, Professor Shen grips the documents tightly. Actually, whether a student likes to be in a band or is adored by girls, these things belonging to the private lives of students aren’t what he’s interested in nor what he has ever interfered in. To him, what students place value on most are the quality of learning and professionalism. As for other things...

Professor Shen glances at his watch and subconsciously speeds up his pace. While he hurries, he hopes that his original judgment was correct, and hopes that Shaw is indeed a good successor worth cultivating, just as he appeared during the re-examination.

[ Chapter 3 ]

A week passes by suddenly.

Sitting at the desk which receives plentiful sunlight, Professor Shen flips through the stack of sketching assignments that Shaw had just handed in, an imperceptible smile of satisfaction on his lips.

In addition to printed computer drawings, another half are hand-drawn sketches by Shaw using a pen, and they are of pretty good quality. Over the years, Professor Shen had seen too many young kids neglecting hand-drawn sketches because they relied too much on computer drawings. No matter what decade it is, the most primitive and foundational skills should be the most solid.

The sense of gratification causes Professor Shen to sigh. However, the page he just flipped to causes him to stop abruptly - this is obviously not part of the drawing assignment. It looks like an analysis report... Professor Shen props up his glasses, reading it carefully from the beginning. Then, he realises that this is an analysis of archaeological reports. Flipping to the back roughly, he finds that coincidentally, this analysis is targeted at the stack of archaeological reports Professor Shen had been reading recently.

With no time to be surprised, Professor Shen straightens his back in an instant, sits up straight, and reads the analysis written by Shaw from start to finish carefully. Whether it’s the standardised writing format, the hypothesis proposed in response to pictures and existing materials, or the objectivity of the comparisons drawn, they can already be regarded as the standard of a professional.

Even though he doesn’t know where Shaw obtained the archaeological reports, what is undeniable is that he used his "little brain". But what is even more undeniable is that just by skimming through the analysis, Professor Shen can see Shaw’s solid foundational and expansive knowledge.

Through this unassigned piece of homework, Professor Shen feels that what he sees isn’t just a very young student who’s just beginning graduate school. What’s displayed before his eyes is Shaw’s undiscovered potential and possibilities.

Professor Shen gets a full glass of water from the water dispenser, and Biluochun leaves twirl and dance in the transparent glass. He walks over to the window, blowing at the mouth of the cup. Then, he takes a few sips of tea slowly, appearing to be in a good mood.

In his mind, he recalls the content of the analysis report, as well as Shaw's appearance when he came to submit his assignment early in the morning.

At that time, his steps were confident and full of vigour. He walked straight to the table to set down his assignment, then raised his eyebrows in glowing spirits. "Professor, remember to read till the end."

Now that he thinks about it, Professor Shen seems to taste the unhesitating confidence and the unwillingness to admit defeat in Shaw's eyes that he didn’t notice before.

It looks like this kid felt that he was being underestimated before. Full of pent up grievances, he wanted to prove his capabilities! This was simply his slightly awkward yet incomparably confident demeanour...

Professor Shen sighs softly, then can’t help but chuckle.

Before him, the sun is still climbing up at 10am, but the radiance of sunlight is already incomparably dazzling.

[ Chapter Four ]

After a few autumn rains, Loveland City gradually turns cooling. Professor Shen's body isn’t very good, so he puts on a thick coat early.

On this day, Professor Shen comes to the office with a briefcase as usual. He methodically prepares Biluochun, takes out his materials and pen, and puts on his glasses. Just as he’s about to start work, the new young lecturer Xiao Fu suddenly turns to his desk while holding his phone. “Professor Shen, look at this quickly. This boy in the middle looks like your graduate student!"

“Why do I feel as if he might be that student of yours?" Teacher Fu looks increasingly certain that he’s correct. "I met him several times before. It’s that cool and triumphant look. Even the colour of his hair matches!"

Professor Shen lowers his head, pulling down his glasses, and the image on the phone screen is displayed in an instant. It seems to be a video of a performance. The musicians on stage are very lively, and the atmosphere under the stage seems to be extraordinarily enthusiastic. The person playing the bass intently and fervently in the middle - who else could he be but Shaw?

Even before Professor Shen speaks, Teacher Fu has already affirmed to himself. “That’s right, it’s him! I remember someone mentioning that he was in band, but I didn't expect him to look like this...”

Professor Shen's eyes are still focused on the phone screen. In the video, Shaw has the youthful vigour that he can only have at his age. He’s full of spirit, rebellious and eccentric, and exudes fervent vitality. He can attract everyone’s attention almost instantly, as though he's a natural focal point.

But such a Shaw seems slightly foreign to Professor Shen. In the past two or three months, the Shaw he has seen is a graduate student who rushes to and from school, but is very earnest in his specialised course, and is also very meticulous in research.

Teacher Fu has already taken his phone away and returned to his own desk. Professor Shen’s gaze returns to his materials, but there are still some emotions stirring in his heart.

The more interactions he has with Shaw, the more Professor thinks that he’s akin to a treasure. Although he may make someone feel conflicted, he always brings unexpected surprises to others. Initially, Professor Shen thought there might only be jade here. But after more digging, he found calligraphy and paintings and utensils. Thinking that this would be the end, taking a turn resulted in the digging of gold, silver, copper and iron. As for whether there would be other treasures in the future...

Knock knock.

Hearing knocks at the door, Professor Shen lifts his head instinctively - truly, speak of the devil.

"Professor, I came to ask about something." Shaw strides over. Standing before the desk, Shaw looks at Professor Shen with an indifferent expression, as if he’s just speaking thoughtlessly. "I heard that the excavation and inspection of the Hou Yin Tan site will be carried out soon. Anyway, my usual assignments aren’t urgent. I’m thinking of strolling around the area with you.”

Through the spectacle lenses, Professor Shen looks at the seemingly expressionless Shaw, and can’t help but chuckle.

He thinks to himself - perhaps no one has told Shaw that even though he always uses nonchalance as a cover, the insuppressible earnestness in his eyes are unable to conceal his genuine anticipation.

[ Chapter 5 ]

The excavation work has commenced for over a month, and everything is proceeding on tenterhooks and in an orderly manner.

Field excavation has always been a bitter and boring part of archaeological work. In addition to digging for long hours in a desolate field, it’s also common to find nothing after digging till the end. At the very least, Shaw has already experienced it several times this month.

It’s another cold and windy morning. Professor Shen comes to the excavation site early, only to find that Shaw hasn’t arrived yet, which is rare. Something noteworthy is that Shaw has been coming here earlier than him every day. But within a few minutes, Shaw appears, walking over while talking on the phone. Something is said on the other end of the line. Shaw arches his eyebrows in his signature style. "Tch, so long-winded... Got it.”

Professor Shen notices a cute rabbit pendant dangling from the bottom of Shaw’s phone, though he doesn’t know when it first appeared. He shows a smile of understanding, no longer paying attention to Shaw's actions, lowering his head to start a new day of work. After a while, a number of villagers from the vicinity also come over and they all greet Shaw first.

This is also something Professor Shen noticed on hindsight. At some point in time, Shaw had established a rapport with the villagers. Having the villagers in the vicinity cooperate and even participate in an amiable manner is another very important part of field excavation. In this aspect, Shaw's performance can be regarded as attaining a satisfactory full marks.

"Professor, leave the rest of the shaving to me." Shaw squats down beside Professor Shen, holding a shovel in his hand. Professor Shen doesn’t immediately express his opinion. Instead, he smiles slightly. "Finished your call with your girlfriend?" Shaw averts his eyes in a hurry, which is rare. He purses his lips. “Who said that she’s... Professor, don’t get infected by Mr Fu’s gossip.” Professor Shen chuckles while standing up slowly. Then, he pats Shaw on the shoulder. "I'll take a look at the pit."

Shaving is time-consuming and hard work, let alone shaving in winter. In spite of thin sunlight, the bitter cold wind hovers over the site, causing Shaw's nose to redden unknowingly. His ripped jeans have long since been covered in dust, and even his originally shiny earrings are coated in ash. Even so, Shaw simply kneels on the ground with ease, cleaning the ground while holding the shovel firmly, shovelling the ground and four walls carefully.

The shaving takes five hours.

Dinner naturally consists of a group of people eating together. When Shaw arrives, he has already taken a shower and is restored to a clean and refreshed state. However, when using chopsticks to pick out vegetables, Professor Shen notices his unusual behaviour immediately: he rarely moves his chopsticks, and he has been picking the vegetables slower than usual. After a few more glances, Professor Shen realises that his hands had turned swollen during the five consecutive hours of shaving.

Despite this, even after the meal is over, Shaw doesn’t say a word or complain at all.

Professor Shen is even more satisfied with the only graduate student he has. He can’t help but compliment him coolly. "You’ve done a good job recently. If you want to learn archeology properly, you must have this earnestness and inextinguishable momentum."

Shaw pauses for a second, but still has that triumphant expression when he speaks. "That goes without saying." But Professor Shen clearly sees how Shaw's eyes had lit up in an instant, and how his brows raised involuntarily.

Professor Shen smiles while shaking his head, looking at Shaw whose words don’t match his genuine feelings. He doesn’t know what Shaw experienced, and perhaps his cynicism is to some extent a defence mechanism. As long as he pretends not to care, there will never come a time when his expectations come to naught. And this also gives him a chance to rewind the situation. Even though amazing the world with brilliant feats bring with it surprises, it occasionally makes Professor Shen feel that what he’s doing is akin to a child looking forward to rewards...

With this thought in mind, Professor Shen smiles while walking away.

When Professor Shen arrives the next morning, many people are already surrounding the area. There’s an interview with the TV station today, and Professor Shen had long since pushed Shaw out. A young man with such an advantageous appearance is suitable to be on TV.

As expected, the host is holding the microphone and conducting the interview. Looking at Shaw’s knitted brows, Professor Shen can't help but laugh, knowing that he’s trying his best to answer patiently. At this moment, the host suddenly asks a rather familiar question. "Why are you studying archaeology?"

This question seems to pull time backwards to more than half a year ago, when Professor Shen met Shaw for the first time -

"Student Shaw seems to be a young man with a lot of personality. So why did you choose the archaeology major that most people find boring?”

Shaw arches his eyebrows. "Because I like it." He lifts his chin slightly, showing a determined smile. "Isn't liking something the greatest display of personality?”

More from S2: here

#mlqc #mlqc cn #mlqc spoilers #mlqc shaw #my appreciation of Shaw skYROCKETED AFTER READING THIS #also I skipped the second r&s because that one mentions s1 #which means I have to translate his part of ch 37 first!#but it requires an explanation into other plot points which I don't want to get into hnnhgng

81 notes · View notes

elinawilson123 · 4 years ago

Text

Easy Way to learn Statistics

My love for Statistics has got me working as a Statistics Assignment Help expert besides my tutoring profession. I have a Master's Degree in Applied Statistics from the University of Ottawa. But since the discipline goes hand in hand with several data analysis tools, I've since learned how to use several of them, including SPSS, Excel, R, Python, and STATA. In my career as a Statistics Homework Help guru, I meet challenging questions that prompt me to do more research and learn new stuff. I also get questions that I find worthy to share with my class. My qualities as a Statistics Assignment expert include never missing the deadline, guaranteeing leading scores, and serving you at a low cost. If you need to enjoy my classes online, too, you're welcome.

#StatisticsAssignmentHelp #statistics homework help

7 notes · View notes

timep3tals · 5 years ago

Text

Since I’m such a slut for Iron Dad & Spidey-Son field trip fics, I decided to procrastinate my homework by creating a detailed list for clearance levels for the badges given out by SI because I’m sick of the same Alpha, Beta, etc. or just the numbers.

It’s too basic. In this household, we are Extra.

Shoutout to @riseuplikeglitterandgold for watching me go down a rabbit hole and not attempt to stop me whatsoever.

Please read this and use this, I spent too much time on this for it to go to waste.

Clearance Levels

Visitor:

Construction (1) - Not often utilized, as SI is fully completed, but when needed, will have a badge that grants them access to the construction zone only. Construction is entirely outsourced.

Tours (2) - Discarded after use; at all exits, there’s a box for discarding the badge. It is automatically deactivated once it passes through the bin, and is shredded before being recycled into new tour badges.

Educational (2.1) - One of the lowest levels of access to the building; often linked to the tour guides badge, and are unable to access any room the tour guide has not swiped into.

Science (2.2) - These tours are guided throughout the majority of the labs, often for parties interested in becoming an employee at SI. Can be more specific to a certain field, and will usually be conducted by interns-turned-tour guides as they move up through the ranks in SI.

Press (3) - Only has access to conference rooms, and are often allotted one badge per press company, which they pick up at the front desk at given times depending on the press conference schedule, as decided by the PR division.

Buyers (4) - Are considered an upper-level visitor badge, but mostly just for show to make the buyers feel important/be more likely to purchase from SI. Have relatively limited access, and are only shown products/labs that pertain to what they’re looking at purchasing.

Partners (5) - Are not very often used, as partners often meet off-site, or are communicating largely through email with either the Board of Directors, or Pepper. Have the most access out of all visitors badges, but is still usually directed by/connected to a tour guide’s badge.

Ex(s): Visitor 2.1, Visitor 5, Visitor 1

Maintenance: Access is often changed as needed. No subsections under maintenance; FRIDAY is in direct control of badges and will allocate where they are needed as work orders are processed. No attached number.

Ex(s): Maintenance

Janitor: Much the same as maintenance. There are specific crews of “spill/break/chemical teams”, but those requests are again processed by FRIDAY. No attached number, though an implied 1.

Lab Clean-Up (2) - Labs are largely kept clean and handled by scientists, but every Sunday there is a deep clean of all floors/surfaces. These janitors have higher access, as most of the janitors are kept locked out of labs for their own safety. Have to have special training.

Ex(s): Janitor, Janitor 2

Interns:

Business (1-9) - Any intern under any division in the corporate offices (financial, PR, HR, etc.) Level depends on sector/experience and where the intern is initially placed.

Lab (10-19) - Often the “janitors” of each lab throughout the week. Are allowed to work on small projects with a chosen mentor (usually Head Scientist). This is the largest, most diverse group, and their access depends on which lab they’re placed in (determined by prior experience, collegic level, etc.) Apply through Operations Management, not HR; no high school students are accepted as the work they’re surrounded by can often be dangerous. No interns are placed in High-Level Labs.

Ex(s): Intern - PR 5, Intern - Financial 8, Intern - Marketing 2, Intern - Lab 15, Intern - Lab 10

Tour Guides:

Press (1) - Technically classified under PR; is solely there to guide press to the designated location and manage traffic during conferences.

Educational (2) - Typically beginning level tour guides; still expected to know as much about the company as a tour guide for partners would.

Science (3) - Has to have intimate knowledge of the workings on each lab; usually coordinates with Head Scientists to stay updated on each lab. Often has the least amount of tours, and typically will have another job/duty elsewhere.

Business (4) - Mostly for corporation heads to come and tour the business portion of SI. Small business/first time business owners are encouraged to take these tours so they could see an example of an effective work environment/procedures.

Partnerships (5) - Has intimate knowledge of the going-abouts in all labs. They are also aware of some financial statistics in regards to new/upcoming projects, as well as ongoing projects. Out of all tour guides, these guides have the greatest access to the building. These guides also lead the buyer tours as well.

Ex(s): Guide 5, Guide 2

Financial: (1-7)

Chief Financial Officer (CFO) (7) - Head officer that has primary responsibility for managing the company's finances, including financial planning, management of financial risks, record-keeping, and financial reporting. The CFO is also responsible for analysis of data, but has the option, and often will, to delegate it to others in the financial sector.

There’s probably a lot of other jobs in this, but it’s unimportant and I do not possess that sort of energy.

Ex(s): Financial 7 (only applicable to the CFO), Financial 2

Public Relations: (1-7) There’s probably a lot of jobs, but it’s unimportant and I do not possess that sort of energy. Ex: Social Media Manager, PR Specialist, Spokesperson, etc. (I’m of the opinion they created a section specifically to help handle whatever it was that Tony said this time. Official title: Owner Management. Unofficial title: Tony’s Bullshit Cover-Up Specialists.)

Ex(s): PR 4

Marketing: (1-7) There’s probably a lot of jobs, but it’s unimportant and I do not possess that sort of energy. Ex: Designers, Web Content Writer, Supply Chain Analysts, etc.

Ex(s): Marketing 5

Human Resources: (1-7) There’s probably a lot of jobs, but it’s unimportant and I do not possess that sort of energy. Ex: Compensation and benefits managers, Training and development specialists, Employment, recruitment and placement specialists, Human resources information system (HRIS) analysts, etc.

Ex(s): HR 6

Board of Directors: Despite being one of the highest positions in SI, they have extremely limited access. This clearance level is mostly restrained to the upper level offices and meeting rooms, but can have special access granted to visit labs, if absolutely necessary. No attached number.

Ex(s): Board Member

Operations Management:

Hiring Managers (1) - These managers directly oversee hiring of all lab personnel, including interns.

Inspectors (2) - Inspectors handle all safety precautions/procedures in all labs in SI. Are often updating rules and regulations in order to best protect all personnel and equipment.

Lab Overseers (3) - Are who Head Scientists report to. Overseers are then to report their findings to the Head of Research and Development in a succinct manner. Are one of the last lines of defense when it comes to arising issues.

Project Managers (4) - Their job corresponds directly with the Principal Investigator and the financial & marketing division to help get finished products out into the market. Often help oversee manufacturing of said products at the different plants across the planet.

Ex(s): Operations 3, Operations 1

Research and Development:

Low-Level Labs (1-15) - Low level of risk. Most often handle coding/computer sciences/refining formulas sent down from some of the upper level labs.

Research Assistants (1-3) - Hand selected by the Principal Investigator from the top universities across the nation to help with research. Found generally at conferences hosted by SI at universities.

Graduate Student (3-5) - Single student from a graduate program, also hand selected. Typically have worked on projects in SI before.

Post-Doctoral (6-9) - Single student from a post-doctoral program. Prior SI experience is required for this position, and must present a thesis project based off outside research in order to maintain position.

Principal Investigator (10-12) - Previously Post-Doctoral, generally, but the position can be earned through impressing the Head of R&D at conferences/presenting thesis work or previous research on a specific topic.

Head Scientist (13-15) - Manager of funding for project, and overseer of the work being produced by the team. Doesn’t typically involve themselves in actual research, but is more the manager to maintain structure/order in lab and ensure work is flowing smoothly.

Ex(s): LLab 14, LLab 3

Mid-Level Labs (16-30) - Mid level risk. Performs higher risk sciences, more along the lines of a chemistry lab. Tests different types of products for higher efficiency.

Research Assistants (16-19)

Graduate Student (19-22)

Post-Doctoral (22-25)

Principal Investigator (25-38)

Head Scientist (28-30)

Ex(s): MLab 25, MLab 19

High-Level Labs (30-45) - High level of risk. Handles all new and volatile materials, and is the most involved in the newest products, etc. on the market. Requires highest grades/performances/experience/etc.

Research Assistants (30-33)

Graduate Student (34-36)

Post-Doctoral (37-39)

Principal Investigator (40-42)

Head Scientist (43-45)

Ex(s): HLab 43, HLab 30

Head of R&D: (All Access) Tony Stark. Oversees all divisions and labs. Spearheads the creation of new tech and development in the company, and is expected to continue to expand SI’s reach into new areas of science and technology.

Ex(s): You Know Who I Am

Avenger: (Residential: Semi-Access) No associated number. One of the most lucrative badges, only granted to Steve Rogers, Sam Wilson, Natasha Romanoff, Bruce Banner, Clint Barton, Thor Odinson, and a few select others. Most have been deactivated following the events of the Civil War. Typically allowed access to all floors (though entry to labs was not granted unless necessary), the residential living spaces, and the training room.

Ex(s): Avenger, Residential: Semi-Access

Remaining Badges (All Access) - Granted only to James Rhodes and Peter Parker (Peter, although classified as Avenger, will be announced as Personal Intern, as per his request).

Ex(s): Avenger, Residential: All Access, Personal Intern: All Access

CEO: (All Access) A lovely Miss Pepper Potts. Her job is kind of a given, I don’t think an explanation is necessary. Also I’m tired.

Ex(s): Virginia Potts

366 notes · View notes

pforprevention · 6 years ago

Text

hi everyone!

i wasn’t really active on this blog this year. since I’m taking a microbiology class and a second statistics class next semester, i figured i’d come back to get motivated.

about me

- i’m brianna

- i’m 20 and a second-semester junior in college

- i’m majoring in community health, concentrating in health administration and planning

- i’m an INFJ

- i’m bi

interests

- epidemiology and biostatistics

- social determinants of health

- health disparities

- lgbtq+ issues

- disability issues

classes for spring 2020

- introductory microbiology

- statistical analysis

- environmental health

- international health

- orientation to internship (basically helping us to find our required internship for the following semester)

- special topics (to get credit for being an ATA for a class)

academic goals for 2020

- finish statistical analysis with r for public health specialization on coursera during the summer

- get all A’s and A-‘s at least

- do homework everyday for 2 hours a day to stop procrastinating

- get on a research team

things i plan to post

- how i plan my life with the methods i use

- updates on my work/goals

- 100 days of productivity starting on january 21st

blogs that inspire me

- @studyign

- @studydiaryofamedstudent

- @the-distracted-student

- @academla

#studyblr #studyblr intro post #studyblr introduction #studyblr reintro #hey sareena #collegeblr #college #college junior #public health #epidemiology #biostatistics #social determinants of health #health disparities #community health #university of illinois #uiuc #academla

30 notes · View notes

delainelong34 · 4 years ago

Text

Which reference style do you follow in Econometrics homework help?

https://www.allhomeworkassignments.com/ cover all kinds of referencing styles for your economics homework, such as APA, MLA, HARVARD, IEEE, OSCOLA, CHICAGO, and VANCOUVER as per the rubric shared by students. We can deliver your Econometrics homework as per your college/university homework instructions.

In how much time can I get my Econometrics homework done online?

We always try our best to deliver the homework as soon as possible, but the actual time depends upon the complexity and length of assignment, We can provide you the Econometrics Assignment Help within 24 hours.

Is All Homework Assignments a reliable Econometrics homework helper?

Yes, it is. All Homework Assignments has been helping the students with their homework for years. https://www.allhomeworkassignments.com/ have already provided econometrics homework help to 5000+ students around the world.

All Homework Assignments Guarantees

Work Within Deadline,Lowest Price Guranteed, Plagiarism Free Guranteed,24 * 7 Availability, Native Experienced Experts, Free Revisions

Why Students Need Econometric Assignment Help?

Plenty of skills are evaluated when a student submits the Econometric Assignment Writing work to the professors. Some students cannot develop an interest in the Econometric.

Econometrics Assignment Help

The term econometrics was used for the first time in the year 1910 by Pawel Ciompa however in the sense that it is used today the term has been used was coined by Ragnar Frisch. Econometrics Assignment Helps as a branch of economics deals with the use of mathematics, statistics and computer science in explaining the concepts of economics. To put it simply the various concepts of mathematics and statistics that quantify the various economic fundamentals encompass the study of econometrics.. Best Econometric Methods are used by firms in decision making process. This is the reason at graduate and post graduat levels students are taught various econometrics methods, tools and softwares in order to analyse collected data to make sound business decisions. Students and scholars are assigned various econometrics tasks in their academic session to test their ability and learn. Students have to take aim at all those sections of the subject if they are to successfully complete their assignments in time. Due to complicated case studies and research problems, students face lot of trouble in dealing with econometrics due to lack of knowledge of various statistical software tools and their application. In such a situtation, we https://www.bestassignmentsupport.com/ assist students through our highly rated online econometrics assignment help service. Our service includes assistance with econometrics tasks involving the use of various statistical softwares like SPSS, STATA, Eviews, Minitab, R etc.

Econometrics Assignment Help involves carrying out statistical analysis using statistical theories, models and practices with the aim of finding a relationship between two more variables depending on how complex the problem is. Econometrics analyses the set of estimators that have desirable statistical functions. The unification of so many quantifiable disciplines was done for the first time by Trygve Haavelmothe nobel laureate from Norway. Haavelmothe used a probabilistic approach to the economic theory. It became rather popular because economics And Online Econometrics Topics deals with a number of vague concepts that depend on the premise called “Ceteris Peribus” which means other things remaining constant.

#Econometrics Assignment Help #Econometrics Assignment Homework Help #Best Econometrics Assignment Help #Do My Econometrics Assignment Help #Online Econometrics Assignment Help

0 notes

360digitmgba · 4 years ago

Text

Data Science in Hyderabad

The entry they supply is very helpful to pay attention the courses repeatedly. Yes, anybody can attend a free demo class and you may attend the primary 3 sessions of the training program free of charge. We present a first of its sort profit for all of the members, where they will once more attend the coaching sessions free of charge in the event that they couldn’t complete their previous coaching program for various reasons. Hyderabad is emerging as a hub for software program growth and providing abundant alternatives. Data Science is among the trending courses of this period, which has plenty of scopes. It presents multiple alternatives for aspirants who want to excel successfully in their careers.

Begin by working through tutorials or Udemy courses on the subject of your selection. Once you could have developed a base in the skills that curiosity you, it could possibly assist to speak with somebody in the subject. Find out what abilities employers are looking for and continue to learn these skills. When learning on your own, setting practical learning targets can hold you motivated. I learnt statistics , machine studying , python , numpy , scikit-study , SQL. I actually have taken online training and comfortably learnt from my house. They have also offered assignments and cleared all my doubts.

Perform competitive evaluation- Success to firm does not is determined by how you run the corporate but social and economical issue plays an important role for its accomplishments. Predictive Analytics by the information scientist permits you to hold everlasting pace on the most recent improvement in your trade and its setting. We are into real time Data Science Course Training In Madhapur Hyderabad, Enterprise Data Warehousing with actual time hand son projects. Data Science has now turn out to be a substantial a part of organisational strategy it is continue and demands. Students are provided with internship packages to reveal them to actual-time tasks and face enterprise challenges. The Data Science course in Hyderabad supplies you the most complete coaching which lets you be taught and uncover valuable technical expertise.

Learn about dealing with multiple classes in output variables including nominal in addition to ordinal knowledge. Understand how to carry out testing of those assumptions to make decisions for business problems. Learn about various kinds of Hypothesis testing and its statistics. You will learn the different circumstances of the Hypothesis table, specifically Null Hypothesis, Alternative hypothesis, Type I error and Type II error. The conditions for conducting a Hypothesis check, interpretation of the outcomes shall be mentioned on this module. In this tutorial you will learn intimately about steady chance distribution.

In addition to the mid-semester and comprehensive examinations, scholar will need to also participate in an online quiz or do an project and submit it on-line as per the course plan. The learners' performance is assessed constantly throughout the semester utilizing varied tools such as quiz, assignments, mid-semester and complete exams. The evaluation results are shared with the learners to enhance their efficiency. Each course will entail a minimal of 1 Assignment/ Quiz, a Mid-semester exam and a last Comprehensive examination.

Through dedicated mentoring classes, you’ll learn to solve an actual-world, industry-aligned data science drawback, from knowledge processing and model constructing to reporting your business results and insights. The project is the ultimate step in the Data Scientist Master's Program and will allow you to to point out your expertise in data science to employers. This Tableau certification course helps you grasp Tableau Desktop, a world-extensive utilized knowledge visualization, reporting, and enterprise intelligence device.

Just don’t overlook to make full use of our school’s priceless assist. In addition, a number of trade bodies similar to Analytics India Magazine, KDnuggets, CIO.com acknowledged and awarded INSOFE’s Data Science Program, since 2011. More than 500+ Companies yr-on-year recruit INSOFE college students as Data Scientists. This popularity amongst Academia and Industry is one of the distinctive strengths of INSOFE.

Assignments given helped to have very good handson on machine studying strategies. Syllabus covered, class classes and assignments accompanied by private analysis and homework on methods taught definitely helps. The prime focus of this Data Science Training in Hyderabad is to rework the students into changing into dominant Data Science professionals. There are a number of reasons why there’s an exclusive rise in the demand for Data Scientists everywhere in the world. Most of the enterprises these days are relying on knowledge analytical models in Data Science to amass & retain their prospects. By harnessing the ability of Big Data, Data Scientists might help enterprises higher understanding their customer preferences, predict the trends, and also analyzes the underlying business dangers and threats.

However, should you already know another programming language, you'll probably be able to decide up Python very quickly. Imagine how you would really feel when you have the skills to investigate complicated enterprise information, thereby empowering you to make correct gross sales predictions or determine promising development opportunities on your group. The data you purchase from these actual enterprise case studies will help you construct the inspiration for the final Capstone Project, which is designed to be the watershed second of your Data Science profession. KPMG in India is the Knowledge Partner for the Data Science Prodegree course.

This course courses all popular ML algorithms as detailed in syllabus tab. Pre-course research lets you develop your data on the basics of Data Science and Machine Learning. It is a self-study section that needs to be completed before getting into to section 2 module. Furthermore, it facilitates the candidates to follow scripts at a cloud lab conveniently. Data Science in Hyderabad is turning into the most coveted subject. The coach was superb and helped me clear all my doubts on the subject matter.360digitmg is among the best Data Science Institutes in Hyderabad. I stored searching many institutes, and then I discovered 360digitmg, I approached and attended knowledge science coaching demo, and then I realized that this is among the best coaching institutes that I ought to select. That's the place I started studying Data Science coaching on the Hitech city branch of Hyderabad. I should say that I'm very much glad about the trainers and curriculum. I recommend anybody who needs to pursue their career as a Data Science expert then now.Simplilearn is a gateway for people who wish to enter into the fields of Data Science, AI or Cloud. I found that is to be probably the greatest online teacher-led portals, and I would undoubtedly recommend it. After the certification, I was in a position to change my job function from a Hadoop Developer to a Big Data Engineer with a great wage hike.Please check with the coordinators about coaching choices in your location. Hyderabad has an ideal talent growth ecosystem to allow beginners to senior professionals to change to Data Science field. Be it a small company or an MNC, they want a Data scientist to handle their giant pool of knowledge. In-depth information on Data Mining, Data forecasting, and Data Visualization.

youtube

you possibly can undoubtedly pursue your profession in Data Science and see yourself rising to the highest place compared to your peers. Our professional counselors will information in case you have any further queries. We shall be a part of your mission and allow you to in attaining your objective diligently.

You may even learn what questions to ask when confronted with information, draw inferences from it after which visualize it to effectively talk about your findings. With a concentrate on arms-on learning, you will also work on varied initiatives and assignments in domains like e-commerce, finance, leisure, and lots more. This Data Science Institutes in Hyderabad co-developed with IBM provides you with an insight into Data Science instruments and methodologies, which is enough to put together you to excel in your subsequent role as a Data Scientist. You will earn a trade-acknowledged certificate from IBM and Simplilearn that may attest to your new expertise and on-the-job expertise. The program will prepare you on R and Python, Machine Learning techniques, data reprocessing, regression, clustering, information analytics with SAS, information visualization with Tableau, and an overview of the Hadoop ecosystem. Simplilearn’s Data Science Capstone project provides you with an opportunity to implement the skills you realized in the Data Scientist Master’s Program.

In all our applications, students enjoy the double advantages of professional providers by INSOFE and the college partner. The project is about translating textual content from one language to another. To obtain the target, students explore encoder-decoder architectures utilizing techniques like LSTMs, Attention fashions, and transformers. The project helps to determine numerous components that influence the gross sales of products and come up with strategies to enhance enterprise based on data exploration and evaluation. A complete introduction to data science in the actual world with sixteen credits price of technology and business education. We provide coaching varied varieties like classroom coaching and online coaching. Offering Enterprise-Wide Insight – Data Science instruments and strategies develops interactive and dynamic visualization instruments that allow enterprise Enterprise to analyze, view, and benefit from the info.Learn about pure language processing strategies similar to Parts-of-Speech tagging, syntactic, and semantic modeling of languages. It is also a rigorous program with five offline lessons of 4 hours every week. This program has been ranked as the #1 program for bringing together one of the best of academic and business excellence, with Purdue and IBM. The Data Science course could be completed in around six months when you dedicate a few hours every day to studying. Any graduate who has successfully completed our Data Science Institutes in Hyderabad is eligible to take part in the JobAssist program. No, the JobAssist program is designed to help you to find your dream job. It will maximize your potential and chances of touchdown a profitable job.Redesigning and updating CVs with the precision of an insider to help you land that coveted job. With our internationally recognized KPMG-endorsed Data Science Institutes in Hyderabad, you're guaranteed to provide your career profile significant advantages. A key cornerstone of our Data Science Prodegree is that this Capstone Project designed to offer invaluable insights that can help you remedy real business issues like a knowledgeable Data Scientist.

360DigiTMG - Data Analytics, Data Science Course Training Hyderabad

Explore more on - Data Science Institutes in Hyderabad

Address:-2-56/2/19, 3rd floor, Vijaya towers, near Meridian school, Ayyappa Society Rd, Madhapur, Hyderabad, Telangana 500081

Hours: Sunday - Saturday 7 AM - 11 PM

#data science course in hyderabad with placements #data science institutes in hyderabad

0 notes

allhomeworkhelper · 4 years ago

Text

Why Do Students Seek SPSS Assignment Help?

Do My SPSS Assignment

The assignments related to SPSS are considered one of the most advanced and comprehensive assignments in academics. To write an outstanding, SPSS Statistics Assignment, students require proper knowledge of various statistics and SPSS software concepts. No doubt, every student who is pursuing statistics must have to complete many types of assignments during their academics. For many reasons, most students find it hard to complete their SPSS assignments by themselves. Therefore those students prefer to take Spss Statistics Assignment Helpfrom professionals. If you are also facing problems with your SPSS assignment, you don't need to worry about it. https://www.allhomeworkassignments.com/are offering you the best SPSS statistics assignment and spss homework help with our expertise at very affordable prices.

What is SPSS?

SPSS Stands for statistical packages for Social Science, and later it changed to Statistical Product and Service Solutions. It is the market leader in terms of packaging statistical tools. SPSS Statistical Software is widely used for statistical analysis in social science. It is widely used in marketing research, survey companies, data mining, government & educational research, marketing companies/firms, etc. There are many uses of Spss Assignment Help that are considered as the derivative for data manipulation and storage. It has two methods for batch processing, i.e., interactive batches and noninteractive batches.

SPSS inc developed it, but later on, it was acquired by IBM in 2009. The earlier name of SPSS was “under the umbrella". But after acquiring IBM, SPSS was renamed as IBM SPSS in 2015. Spss Assignment Help also comes with an open-source version that is known as PSPP. This version used the process of statistics and the formulation of data manipulation techniques with very few exceptions. These statistics and formulation are used for the professional manipulation of large data chunks. The open-source version of SPSS is quite decent, and it won’t expire in the future. Anyone can use the same SPSS Software for the lifetime. SPSS is one of the best analytical software that provides high-quality graphics for more analytical features. The best part of this software is when you create standard graphics in this software. Then you can output the graphics as HTML5 files. It means that you can access these files through your browser too.

With SPSS, you can

Break down & better comprehend your data, and take care of complex business & exploration issues through an easy to understand interface. Rapidly understand huge & complex information, with cutting edge statistical analysis methods that help guarantee high precision and quality dynamic. Use extensions, Python & R Programming Language code to incorporate with open-source programming. All the more effectively choose & deal with your product with adaptable sending choices.

Why Do Students Seek SPSS Assignment Help?

Writing an SPSS Assignment Help is probably the hardest subject for students. To get good command over it, you have to work hard. Firstly you should have a basic knowledge of statistics. And students have to work on multiple tasks in a single day. That is the explanation they don't give enough consideration to their SPSS assignment homework. Thus they score low in their school grades. To defeat this issue, students are looking for the Best Spss Homework Help Online.

Subsequently, they regularly begin looking on the web for the Best SPSS Help Onlineby experienced specialists. Without a doubt, on the web, students consistently locate some least expensive SPSS assignment writing services. But now you don't have to bargain any longer. Here https://www.bestassignmentsupport.com/ are focused on offering you the best SPSS assignment help at nominal charges.

#spss assignment help #SPSS Assignment Homework Help #Online SPSS Assignment Help #Best SPSS Assignment Help

0 notes

360digitmg-dataanalyticscourse · 4 years ago

Text

Data Science Course

The job position of a Data scientist has been recognized as one of the highest-paid job roles within the country which is why many are needing a career on this particular sector. The average wage of a data scientist in India is observed as 6 lakhs every year whereas the experienced ones make more than 1,000,000 rupees. These packages are definitely large compared to any other job roles in the IT sector.

Post your Data Science Course In Hyderabad certification completion, you'll get reworked into a full-fledged job-ready Data Science specialists. You would have gained exceptional abilities in all the most recent tools & strategies in this subject & could be able to handling the actual-world Data Science trade challenges. The course curriculum in this data science course in hyderabad Program is specially designed by consultants to enhance the present business requirements. Students will get to leverage information of all the core purposes of Data Science platform right from the scratch. This course additionally covers advanced AI concepts like Chatbots, image recognition & far more.

So work towards making essentially the most out of these rising profession alternatives by being part of our Kelly Technologies genuine Data Science Training Institute in Hyderabad program. I am pleased to hitch the Data Science coaching at Digital Nest institute.

Hence, many companies are considering knowledge science to be a part to make their techniques intelligent and derive the most correct outcomes. data science has got large benefits from time consumption to value discount. Data science is also anticipated to exchange many present job roles. therefore considering a profession in data science and taking over an information science course in Hyderabad stands as one of the best choice you make to endure a profitable profession.

He explains each matter in a method which helps you understand it very simply. If there's any doubt he takes an additional mile to make clear all of the doubts and makes use of totally different actual-time scenario which made the course easy to learn and perceive. It helps a person to grasp what information says and become an information pushed individual as properly. It is easy and easy to be taught Data Science with 360DigiTMG and get certified. We have designed the course in such a fashion that you can be taught the course from anyplace within the globe. So get excited to learn the most effective Data Science course from 360DigiTMG. Start the growth of your career with certified Data Science course.

Though I come from non technical background, I never did not ask doubts and take part in the assignments. The 360DigiTMG is a superb platform, even for non technical students or sluggish learners like me. I feel so grateful for Digital Nest and specially their Data Science trainers for instilling so much confidence in me. The practice, assignments and assessments tests are what really helped me develop.

6 Our 9 Mantras of Success - Be a Global Certified Data Scientist6.1 We provide 100% Placement assistance & Paid Internships6.1.0.1 By 2025, the Data Science analytics sector in India is estimated to grow $sixteen billion. By 2025, the Data Science analytics sector in India is estimated to grow $sixteen billion. ✅ Recently India’s Top Rated Magazine “Times of India” Featured Socialprachar as Redefining profession oriented education with high success fee. Yes, we do conduct assist periods on main subjects without disturbing the continued courses.

All the videos are accessible out of your desktop, cell, pill, Etc.We request you to take a trail session. ADITI Data Science institute in Hyderabad presents 90 days of Data Science classroom training. It includes Python from primary stage to advanced level, DJANGO Framework, Machine Learning and Applied Statistics with actual-time tasks.

At this moment, 360DigiTMG is among the greatest training centres to provide classroom training in Hyderabad to the students who wish to improve themselves. Best data science training in hyderabad is being supplied by 360DigiTMG in Hyderabad. 360DigiTMG trainers are from the MNC with an expertise of 13+ years within the business. The DS faculty has 7 years of expertise in training and growth. Both R and Python has numerous applications in Data Science and can be utilized for any knowledge science task.

Our Data Science Training In Hyderabad program covers the ideas right from the scratch to the core. Through frequent mock interview sessions, we shall be assessing the efficiency of each scholar & proper steering would be given to them primarily based on the efficiency in these classes. Post profitable completion of this Data Science training, we will be recommending our students’ profiles to the businesses that we now have tie-ups with and help them in getting successfully positioned.

The project is predicated to map the activity of the user and provided him with different suggestions and assist in the discount of fraud by analyzing the user info. Learn Data Science and get licensed with one of the best college and get yourself positioned in high firms. Srishti presently works as Associate Editor at Analytics India Magazine. When not masking the analytics news, editing and writing articles, she could be found studying or capturing thoughts into photos. Throughout this Data Science Training In Hyderabad program, our expert trainers & mentors shall be extending their full assist to the members. Digital Nest has one of many top cutting-edge coaching facilities in the prime locations in Hyderabad at Panjagutta which is 1 km away from Ameerpet and likewise one at Hitech City in the Silicon Valley area of Hyderabad. State of the artwork coaching heart with centralized AC in each class.

Backed by a staff of skilled trainers, Analytics Path works in direction of training college students to perfection in any of the trending data analytical technologies of their choice. Our training classes are led by 6 totally different school members who have accomplished their domain specialization from the esteemed IIT & IIM institutions. Over the course of five years, we've successfully educated greater than 1500+ students and in the process we now have delivered 6500+ hours of classroom coaching. Are you curious to secure a profession within the field of Data Science? Our advanced Data Science Course In Hyderabad program is the first alternative for the aspirants who want to be taught Data Science. This course is specially designed for the analytics profession lovers who want to pursue their career as a Data Scientist, AI Specialist, Machine Learning Engineer, or Big Data Analyst.

Syllabus covered, class periods and assignments accompanied by private analysis and homework on strategies taught definitely helps. I learnt statistics , machine studying , python , numpy , scikit-study , SQL. I actually have taken on-line coaching and comfortably learnt from my house.

Since the past 5 years, Analytics Path has successfully skilled a whooping 1500+ professionals in Data Science who are now working in probably the most reputed IT enterprises & startups. The school right here for Data Science could be very much skilled & has mentioned plenty of actual-time ideas. The course content material right here can also be very a lot up-to-date covering all the advance ideas & use cases of AI & Machine Learning. The curriculum here could be very much in synch with the current business requirements. Advanced concepts like decision timber, information visualization, enterprise analytics & as well as technologies like AI, Machine Learning & Deep Learning have been defined rather well.

For more information

360DigiTMG - Data Analytics, Data Science Course Training Hyderabad

Address - 2-56/2/19, 3rd floor,, Vijaya towers, near Meridian school,, Ayyappa Society Rd, Madhapur,, Hyderabad, Telangana 500081

099899 94319

0 notes

2020-vcp-thesis-project-refugees · 5 years ago

Text

Milestone - 3 (22.04.2020)

Writing paper

So far, I completed all sections of my research paper. After the feedback given by my advisor, I reformed the section of introduction part by citing the official resources for the statistics related to refugees. Later on, I fixed the all problems and rectified all deficiencies related to the APA paper format style. Secondly, I completed the section of literature review. In doing so, I added important theoretical studies done about the portrayal of refugees in the context of hashtag activism (Rettberg & Gajjala, 2016; Kreis, 2017; Barisione, Michailidou & Airoldi, 2017; Siapera Boudourides, Lenis & Suiter, 2018). Furthermore, last week, drawing upon the feedback of my principal advisor, I reviewed some articles about the important hashtag movements in Turkey (Eslen-Ziya, 2013; Akyel, 2014; Yılmaz, 2015).

In methodology section, based on the feedback and theoretical resource (Akşak, 2019) given by my principal advisor, I determined the theoretical dimension of my methodology. I decided to analyze the collected data according to critical dicourse analysis. Based on feedback of final jury which is held last semester, I created my research questions. This time I decided to narrow the scope of my approach down. To put it another way, last semester I was planning to focus on social, economic and political motives behind the anti-refugee and pro-refugee discourse, this semester I decided to restrict the scope of my analysis with social motives.

By taking the feedback of my principle advisor, instructor and last semester’s final jury into consideration, I tried to give a detailed analysis of the discourse of political elites and non-governmental organizations in a comparative way. By translating the collected tweets into Turkish, I tried to analyze them according to the theory of critical discourse analysis. By the way, critical discourse analysis is the most relevant theory for my cases (#ülkemdesuriyeliistemiyorum and #SuriyelilerKardesimizdir) because I analyze rhetorics of tweets. Critical discourse analysis is an interdisciplinary method that primarily deals with social problems and political issues like ideology, race, gender, class, interests, institutions social order and social structure (Tannen, Hamilton & Schiffrin, 2017, p. 466-479). In the section of conclusion I emphasized that what make my study unique in this area and explained how it contributes to the literature of hashtag activism. Lastly, I wrote the section of abstract and I stated my main argument there.

When it comes to the my proposal, I revised and improved the sections such as; summary, description of project, background research and annotated bibliography, form of project, abstract, writing sample and outline. I did all these revision after completing my research paper. Since I narrowed the theoretical approach down in my research paper I omitted some concepts. In the section of background research and annotated bibliography, I added new articles about hashtag activism I used in my research paper. Secondly, since I recollected data based on the feedback of last semester’s final jury, I substantially changed the section of form of the project. Moreover, completing my research paper led to a significant change in parts such as writing sample, outline, abstract and references as well. Lastly, I made a short video which tells the story of what I did so far.

As for what I did this week, I draw two bar charts based on the feedback of my principal advisor for my research paper. By drawing these two bar charts, I compared the number of retweets and likes in Sinan Oğan’s and Süleyman Soylu. My aim was to illuminate the influence of right-wing discourse and reveal the differences and similarities between two distinct kinds of right-wing discourses. In doing so, I aimed to contribute to the formation and reinforcement of my main argument and the conclusion. These are my bar charts (Figure 1 and Figure 2):

Reading the research material

Since the subject of my research paper is connected to the notion of Islamophobia, I read two articles that both implicity and explicitly addresses to right-wing policy and discourse. The first one is about the movement of #stopIslam which emerged after 2016 Brussels terrorist attack. This study analyzes key tactics used by right-wing actors, self-identified muslim users, would-be allies and celebrities in usage of discourse(Poole, Giraud & Quincey, 2020, p. 1-24). Another study focuses on the movement of #MuslimWomensDay on Twitter. Until now, in Western mainstream media, Muslim women were portrayed in a negative way. Based on the analysis of approximately 300 tweets, this study argues that Twitter can be a useful space for women to tell their narratives and raise their voices (Pennington, 2018, p. 199-211). Both of these articles analyzes usage of right-wing discourse in the context of hashtag activism by comparing narrative and counter-narrative practices. In these works, right-wing discourse is on the side of hostility but in my case the right-wing discourse is seen both in the pactices of support and hostility towards suppressed groups. Again, the contribution of my study to the literature of hashtag activism is discernible in this point.

References

Akşak, E. Ö. (2019). Discursive construction of Syrian refugees in shaping international public opinion: Turkey’s public diplomacy efforts. Discourse & Communication, 175048131989376. doi: 10.1177/1750481319893769

Akyel, E. (2014). #Direnkahkaha (ResistLaughter): “Laughter is a Revolutionary Action.” Feminist Media Studies, 14(6), 1093–1094. doi: 10.1080/14680777.2014.975437

Barisione, M., Michailidou, A., & Airoldi, M. (2017). Understanding a digital movement of opinion: the case of #RefugeesWelcome. Information, Communication & Society, 22(8), 1145–1164. doi: 10.1080/1369118x.2017.1410204

Eslen-Ziya, H. (2013). Social Media and Turkish Feminism: New resources for social activism. Feminist Media Studies, 13(5), 860–870. doi: 10.1080/14680777.2013.838369

Pennington, R. (2018). Making Space in Social Media: #MuslimWomensDay in Twitter. Journal of Communication Inquiry, 42(3), 199–217. doi: 10.1177/0196859918768797

Poole, E., Giraud, E. H., & Quincey, E. D. (2020). Tactical interventions in online hate speech: The case of #stopIslam. New Media & Society, 146144482090331. doi: 10.1177/1461444820903319

Rettberg, J. W., & Gajjala, R. (2016). Terrorists or cowards: negative portrayals of male Syrian refugees in social media. Feminist Media Studies, 16(1), 178–181. doi: 10.1080/14680777.2016.1120493

Siapera, E., Boudourides, M., Lenis, S., & Suiter, J. (2018). Refugees and Network Publics on Twitter: Networked Framing, Affect, and Capture. Social Media Society, 4(1), 205630511876443. doi: 10.1177/2056305118764437

Tannen, D., Hamilton, H. E., & Schiffrin, D. (2015). The handbook of discourse analysis. Malden, MA: John Wiley & Sons, Inc.

Yılmaz, B. (2015). Yeni Medya Ortamlarında Örgütlenme ve Toplumsal Etkileri: #sendeanlat Örnek Olay İncelemesi. Ulusal ve Kurumsal Çatışmalar/Çözümler Kongresi.

NOTE: THIS IS AN HOMEWORK FOR BILKENT UNIVERSITY!

0 notes

binnedrubbish · 5 years ago

Text

5/12/19 Notes

Lab Meeting Prep Pipeline:

(May 2nd, 2019 at 2:38 p.m.)

[ ] Read the Results & Discussion cover to cover

[ ] Complete slides for all figures

[ ] Give a practice presentation

[ ] Read methods

[ ] Complete fluorescence slides

[ ] Decide how to deal with ‘relationship between calcium activity and movement’ section

[ ] Give a practice presentation

[ ] Read supplementary material cover to cover

[ ] Give a practice presentation

Note to self: Relax. Be meticulous. Be disciplined. Keep calm, do your best, trust your team.

——

Advanced Optimization

8 20 905

Live Action Poem, February 2nd, 6:41

Went to Brazil out of spite and saw

stone Jesus, arms open for a hug,

bought street weed, twice, from the same vendor

out of a reckless love for reckless love.

Hoped for a tropical muse and found

a strong handshake from a dangerous man.

Holed up in Rio de Janeiro with piles

of paper money and paced all alone

angry at nothing if only for the moment.

Rain dampened slick stone walkaways,

waiters were too nice and I tipped too much.

One offered to be a bodyguard , violence

hinted in every smirking human moment.

God, I loved being a target, smug,

dumb, flitting away American Dollars.

Jesus Christ looming in stone on a hill top.

Titties and marijuana, iconic primadonna

extravagant flora, dying fauna, fawning

over the climate. I went to Brazil

on an off month. To hole up

safe from my sprawling little lovely life.

To Do 26.1.19

[x] Cristina - Search for Hippocampus Models

[x] Ana G. - Draft e-mail call for interest in “Live Action Science”

[ ]

Data science Club Thursday at 5:00 p.m.

Astavakrasana

laser-scanning photostimulation (LSPS) by UV glutamate uncaging.

12.1.19 Goals

[x] Some Portuguese

[x] Mouse Academy - first read

[ / ] Dynamic mesolithic dopamine

[x] Water rats * SMH

Acorn - tracks impact | BetaWorks | 2 years of money | PitchBook | Social Impact Start Up

Mission Aligned Investors | Metrics | Costumer Acquistion Cost | Clint Corver -> Chain of Contacts -> Who To Talk to (Scope: ~100)

Money Committed || Sparrow || Decision Analysis —> Ulu Ventures [500k] [Budget x ]

Ivan - > IoS Engineering { Bulgarian DevShop }

[market mapping] Metrics -> Shrug

Peter Singer - Academic Advisory Board …

[1 million ]

Product market testing

Foundation Directory Online - Targeted , Do Your Homework

https://www.simonsfoundation.org/2018/11/19/why-neuroscience-needs-data-scientists/

Head-fixed —>

~INHIBITION EXPERIMENT TRAINING PLAN~

STOP MICE: 20th. GIVE WATER: 20th (afternoon) - 30th. DEPRIVE: 31st... (Morning) RESUME: Jan 2nd.

21st - BLEACH/DEEP CLEAN BOXES 1-14 (Diluted bleach; Flush (with needles out) - Open Arduino Sketch with Continuously open Valves - PERFUSE System) *[NOT BOX 11 or 5]*; Run 15 mL of Bleach per syringe; Copious water through valves; Leave dry.

———

http://www.jneurosci.org/content/preparing-manuscript#journalclub

Friday - Dec. 14th, 2018

[x] - Complete 2019 ‘Goals and Blueprint’

[x] - 2-minute Summary ‘Properties of Neuron in External Globus Pallidus Can Support Optimal Action Selection

[ ] MatLab for Neuroscientists :: Basic Bayesian Bearded Terrorist probability plots

[x] Statistics 101: Linear Regression

“Golden Girls” - Devendra Banhart

“King” by Moor - FIREBEAT

Reread - Section 3.3 to

Monday - Apply for DGAV License (MAKE SHORT CV)

SAMPLE: ‘Sal’ From Khan Academy

Make short CV

Tiago - Certificate

MATH:

“We explicitly focus on a gentle introduction here, as it serves our purposes. If you are in

need of a more rigorous or comprehensive treatment, we refer you to Mathematics for Neuroscientists by Gabbiani and Cox. If you want to see what math education could be like, centered on great explanations that build intuition, we recommend Math, Better Explained by Kalid Azad.”

Jacksonian March seizure (somatosensory)

—

Tara LeGates > D1/D2 Synapses

Scott Thompson

Fabrizio Gabbiani - Biophysics - Sophisticated and reasonable approach

Quote For Neuroscience Paper:

“Every moment happens twice: inside and outside, and they are two different histories.”

— Zadie Smith, White Teeth

Model Animal: Dragonfly? Cats. Alligators.

Ali Farke Toure

Entre as 9 hora e o meio-dia ele trabalha no computador.

Ele volta para o trabalha à uma e meia.

Ele vai as compras depois do trabalho.

A noite, depois do jantar, ele e a mulher veem televisão.

As oito vou de bicicleta para o trabalho. (go)

As oito venho de bicicleta para o trabalho. (come)

A que horas começa a trabalhar?

Eu começo a trabalhar os oito e meia.

Normalmente…

Eu caminho cerca de Lisbon.

É muito triste! Eu faço nada! Talvez, eu caminho cerca de Lisbon. Talvez eu leio um livro. Talvez eu dormi. Eu vai Lx Factory.

Depois de/do (after)

antes de/do (before)

—

Monday -> Mice

MATLAB!

“New ways of thinking about familiar problems.”

~*NOVEMBER GOALS*~

> Permanent MatLab Access [x] -> Tiago has license

> Order Mouse Lines [ ] -> Health report requested… Reach out to Vivarium about FoxP2

-> Mash1 line -> FoxP2 expression?

> Finish ‘First Read Through’ [ ]

> Figure 40 [ ]

SAMPLE : ‘Afraid of Us’ Jonwayne, Zeroh

Monday Nov 5th Goals:

> Attentively watch:

> https://www.youtube.com/watch?v=ba_l8IKoMvU (Distributed RL)

> https://www.youtube.com/watch?v=bsuvM1jO-4w (Distributed RL | The Algorithm)

MatLab License

Practical Sessions at the CCU for the Unknown between 19 - 22 Nov 2018 (provisional programme attached)

Week of November 5th - Handle Bruno’s Animals

Lab Goals -

“Deep Networks - Influence Politics Around the World”

Paton Lab Meeting Archives

Strategy: Read titles/abstracts follow gut on interesting and relevant papers

Goals: Get a general sense of the intellectual history of the lab, thought/project trajectories, researchers and work done in the field and neighboring fields.

Look through a GPe/Arkypallidal lens… what can be revisited with new understanding?

First Read Through

[x] 2011 - (22 meetings || 10/12 - SLAM camera tracking techniques)

[ x] 2012a (18 meetings)

[x] 2012b (15 meetings - sloppy summary sentences)

[ x] 2013a (19 meetings - less sloppy summaries jotted down)

[x] 2013b (17 meetings)

[x] 2014a (21 meetings) (summaries in progress)

[x] 2014b

[x] 2015 (23 meetings)

[ ] 2016 (23 meetings)

Current

—

“I like, I wish, I wonder”

“Only Yesterday” Pretty Lights

retrosplenial dysgranular cx (?)

retrosplenial granular cx, c (?)

fornix (?)

Stringer 2018 arVix

Lowe and Glimpsher

November Goals:

[ ] GPe literature -

[ x ] Dodson & Magill

[ x] Mastro & Gittis

[ ] Chu & Bevan

[x] Modeling (extra credit -Bogacz)

[ ] Principles of Neural Science: Part IV

[ x ] MatLab license… Website program…

Extra credit:

Side projects [/ ] Neuroanatomy 40

[ -> ] ExperiMentor - Riberio, Mainen scripts… Paton! -> LiveAction Science

MACHINE LEARNING

Week of Oct 29th -

Symposium Week!

Wyatt -> John Hopkins -> He got into American University!

Belly Full Beat (MadLib album Drive In)

“The human brain produces in 30 seconds as much data as the Hubble Space Telescope has produced in its lifetime.”

Sequence of voltage sensors -> ArcLite -> Quasar -> Asap -> Voltron -> ???

Muscarine -> Glutamate

Ph Sensitive

cAMP

Zinc sensitive

5 ways to calculate delta f

2 main ways

SNR Voltage —

Dimensionality reduction of a data set: When is it spiking?

5 to 10 2-photon microscope open crystal

…Open window to a million neuron…

Week of 10/15/18

Monday: Travel

Tuesday: Rest

Wednesday: Begin rat training. Reorient.

Thursday:

Friday:

|| Software synergistically ||

—————

Beam splitter, Lambda, diacritic

1.6021766208×10−19

‘sparse coding’

Benny Boy get your programming shit together.

Week of Oct. 8th, 2018

10/9/18

[ ] Rat shadowing (9:30 a.m.) -> Pushed to next week

10/8/18

[x] Begin Chapter 13 of Kandel, Schwartz, Jessell

[x] Outline of figure 36

[ ] Read Abdi & Mallet (2015)

DOPE BEAT MATERIAL - Etude 1 (Nico Muhly, Nadia Sirota)

Saturday - Chill [x]

Friday - ExperiMentor … mehhhhh scripts?

Photometry -> Photodiode collects light in form of voltage (GCaMP) (TtdTomate as Baseline… how much fluorescence is based on TdTomatoe, controlling factor always luminesce - GCaMP calcium dependent) :: Collecting from a ‘cone’ or geometric region in the brain. Data stored and plotted over time… Signals must be corrected…

Cell populations are firing or releasing calcium. (GCaMP encoded by virus injection, mice express CRE in a particular cell type).

———————————————

Brain on an Occam’s Razor,

bird on a wire,

synaptic fatalism integrating

consistent spiking;

strange looping: is this me?

Thursday

“We don’t make decisions, so much as our decisions make us.”

“Blind flies don’t like to fly”

[x] 9:00 a.m. Lab Meeting

[x] 12:00 p.m. - Colloquium

“It was demeaning, to borrow a line from the poet A. R. Ammons, to allow one’s Weltanschauung to be noticeably wobbled.”

“You must not fear, hold back, count or be a miser with your thoughts and feelings. It is also true that creation comes from an overflow, so you have to learn to intake, to imbibe, to nourish yourself and not be afraid of fullness. The fullness is like a tidal wave which then carries you, sweeps you into experience and into writing. Permit yourself to flow and overflow, allow for the rise in temperature, all the expansions and intensifications. Something is always born of excess: great art was born of great terrors, great loneliness, great inhibitions, instabilities, and it always balances them. If it seems to you that I move in a world of certitudes, you, par contre, must benefit from the great privilege of youth, which is that you move in a world of mysteries. But both must be ruled by faith.”

Anaïs Nin

[ ] MatLab trial expires in 1 day *

[ ] 3:00 p.m. pictures

“We do not yet know whether Arkys relay Stop decisions from elsewhere, or are actively involved in forming those decisions. This is in part because the input pathways to Arkys remain to be determined.”

These studies prompt an interesting reflection about the benefits and conflicts of labeling and classifying neurons at a relatively grainy level of understanding.

“The authors hypothesize that under normal conditions, hLTP serves an adaptive, homeostatic role to maintain a healthy balance between the hyperdirect and indirect pathway in the STN. However, after dopamine depletion, pathologically elevated cortical input to the STN triggers excessive induction of hLTP at GPe synapses, which becomes maladaptive to circuit function and contributes to or even exacerbates pathological oscillations.”

To Do Week of Oct. 1st - Focus: Big Picture Goals

[ x ] GPe Literature - Hernandez 2015 & Mallet 2016 (Focus on techniques and details)

[ ] MatLab! Lectures 6-7 (Get your hands dirty!)

[ x ] Kandel Chapters 12 - 13

Tuesday Surgery Induction 10:00 with Andreia

6:00 - 7:30

Portuguese

Digitally reconstructed Neurons: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5106405/

To Do Week of, September 24th, 2018

To Do Week of Monday, September 17th, 2018

PRIORITY:

DATA ANALYSIS PROJECT ITI

———— PAUSE. ———————

Talks

[x ] Mainen Lab - Evidence or Value based encoding of World State/Probability - ‘Consecutive failures’ - easy/medium/hard estimate of where the reward will be.

Reading for the Week

[x] Chapter 9 - Propagating Signal | The Action Potential

[/ ] Ligaya et. al (2018) (CCU S.I.?)

[x] Katz & Castillo (1952) Experiment where they describe measurement techniques

[ ] Raiser Chapter 4 - Stimulus Outlasting Calcium Dynamics in Drosophila Kenyon Cells Encode Odor Identity

Video Lectures

[— ] Linear Algebra (Trudge steadily through)

[ — ] Khan Academy Logarithms (Trudge steadily through)

MatLab

[ ] Trudge steadily through www.mathworks.com/help/matlab/learn_matlab

*FIND PROBLEM SET/TEXT BOOK/WORK SHEETS*

Concepts to Grasp

[ / ] Master logarithms!

[ ] Review Kandel Et. Al Part II *Chapters 5-9*

Neuroanatomy

[ x ] Ink Figure 28

Project Planning? Too soon! Too soon! Read some literature on the subject.

17/9/18

1:00 p.m. Meet with Catarina to discuss “CCU Science Illustrated” (WIP) Project

2:30 p.m. Vivarium Induction

_______________________________________________________

| SPCAL Credentials |

| |

| login: |

| PW: |

-————————————————————————

——

NPR:: https://www.npr.org/sections/health-shots/2018/09/11/644992109/can-a-barn-owl-s-brain-explain-why-kids-with-adhd-can-t-stay-focused

9.13.18

[ x ] Pauses in cholinergic interneuron firing exert an inhibitory control on stratal output in vivo (Zucca et. al 2018)

[ x ] Chapter 8 - Local Signaling: Passive Properties of

-> Sub and supra threshold membrane potential (Conceptual)

Monday, Sept. 10th 2018

“Eat the Frog First”

[ N/A ] Review SPCAL Lessons 1-5 (In Library?) CRAM THURSDAY?

-> [/] wait for confirmation from Delores for theoretical test

-> (Out of Office reply from person in charge)

To Do:

[/] Comment Out %PRE_PROCESS_vBeta.m

[x] Change path name and run program in MatLab

[ ] Solve trial.blahblahblah error spkCount? labels?

[ ] Change Epochs and run?

[x] Chapter 7 - Membrane Potential :: Return to Pg. 136-137 Box 7-2 when sharp. ::

[x] Castillo and B. Katz (1954)

[x] 12:00 - Neural Circuits for Vision in Action CCU

[x] 2:30 - THESIS DEFENSE: Mechanisms of Visual Perceptions in the Mouse Visual Cortex

————

Extra-credit

[x] Ink Figure 24

[~ ] Finish “First & Last 2017” (100/127 = 78.74%)

——

Jax Laboratory Tools: https://www.jax.org/jax-mice-and-services/model-generation-services/crispr-cas9

Recommendation for Design and Analysis of In Vivo Electrophysiology Studies

http://www.jneurosci.org/content/38/26/5837

On the Horizon:

Schultz (1997) (Classic, classic, classic)

*[x] 9/7/18 - 6:00 p.m. Flip water for Bruno’s mice *

ITI Data Analysis -> Next step ->….

[ ] (find the sigmoid call) / Poke around preprocessing_beta

Reading

[x] Chapter 6 - Ion Channels

[ / ] Finish Krietzer 2016 —> [ ] write an experiment-by-experiment summary paper

Resource: https://www.youtube.com/watch?v=GPsCVKhNvlA Helpful explanation of ChR2-YFP, NpHR, and general ontogenetic principles.

[ / ] Reiser Chapter 3.3.38 - 3.4 (Need to finish 3.4.5, Look up Photoionization detectors, Coherence)

Neuroanatomy

[/] Finish Figure 24 (need to ink)

“Drawing Scientists “

[/] Storyboard for GCAMP6s targeted paper

-> Show Filipe for feedback ->

-> Ask Leopold permission ? Talk to Catarina

[ x] 16:9

[x] Write script and record [ 1:00 ]

Intellectual Roaming

[ / ] Return to Review of Reviews and Review Zoom-In | First & Last |

[/] Explore Digital Mouse Brain Atlas

9/6/18 - Thursday

To Do:

ITI Data Analysis :

[x] Draw data structure on mm paper -> Reach out for help understanding

[ / ] What fields did Asma call? What fields are necessary for a psychometric curve

Reading

[x] Kandel - Chapter 5 | Synthesis and Trafficking of Neuronal Proteins

[ / ] Reiser - Chapter 3 | A High-Bandwidth Dual-Channel Olfactory Stimulator for Studying Temporal Sensitivity of Olfactory Processing (Results complicated)

[/ ] Krietzer 2016 - Cell-Type-Specific Controls of Brainstem Locomotor Circuits by Basal Ganglia

Talks:

[x] 12:00 p.m. - Colloquium - Development of Drosophila Motor Circuit

Tutorials:

~ [x ] MatLab plotting psychometric curves

Neuroanatomy

[ x ] Outline brain for figure 24

———

MatLab

Laser stuff HZ noise, thresholds,

// PCA -> Co-variance ->

// Linear regression | Geometric intuition -> “What is known to the animal during inter-trial? What features can be described by animals history” ===> Construct a history space (axis represent different animals history ex. x-axis previous stimulus, reward, etc.?) Predictive (?)

Plot psychometric functions || PSTH (post stimulation of histogram ) of example neurons -> skills: bin spiking, plot rasters, smoothing (if necessary)

Data:: Access to Dropbox -> /data/TAFC/Combined02/ [3 animals :: Elife]

/data/TAFC/video

Tiago and Flipe know the video data

File Format -> Parser/Transformation (guideline) ||

> MatLab

Access to MatLab -> [/] 28 days!

How can I begin to analysis?

History dependent | Omitted

——

To Do Week of September 3rd

Monday

Administrative

[ x] Check-in with HR (Don’t bombard!): Badge. (Library access?)

[ ] Reach out to SEF?

[x] 2:00 p.m. Meet with Asma - discuss data analysis. Where is it? How do I access it (Tiago?) What has been done and why?

[x] 3:00 p.m. Lab Meeting “Maurico’s Data” - Pay special attention

[x] Finish first read through of Theoretical Laboratory Animal Science PDF Lectures

[ ] Rat Surgery Techniques…

Mouse neuroanatomy project

[/ ] Figure 24

[ ] Figure 28

Math

[x ] L.A. Lecture 2

[ x] L.A. Lecture 3

Read:

[ ] Georg Raiser’s Thesis (Page 22 of 213)

Find time to do at least an hour of quiet focused reading a day. (Place?).

Continue to explore whims, papers, databases, ideas, protocols, that seem interesting.

Develop ‘literature scour’ protocol - (Nature Neuroscience, Neuron, Journal of Neuroscience)

Dates to Remember: September 14th - Laboratory Animal Sciences Theoretical Test!

https://www.sciencedaily.com/releases/2018/08/180827180803.htm:Can these be used for techniques?

https://www.sciencedaily.com/releases/2018/08/180823141038.htm ‘Unexpected’ - Unexpected physical event and unexpected reward or lack of reward (neuronal modeling of external environment)

—

In my first ten minutes at work I’m exposed to a weeks (month/year/decade) worth of interesting information. Going from an intellectual tundra to an intellectual rain forest.

1460 proteins with increased expression in the brain: Human Protein Atlas https://www.proteinatlas.org

Non-profit plasmid repository: https://www.addgene.org

Protein database: https://www.rcsb.org/3d-view/3WLC/1

Started to think at the molecular level.

“MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIR

HNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSK

GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDF

FKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSL

FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNG

YISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK” - CCaMP6m amino acid code.

8/31/18 - (Friday) @12:00 in Meeting Room 25.08

GET USB ! !

[Lisboa Cultura na ru, Lisbon on the streets Com’Out Lisbon - Katie Gurrerirra ]

MatLab -> Chronux Neural Analysis

SEPTEMBER 14th!

Week of August 27th, 2018

“Conserved computational circuitry, perhaps taking different arguments on different locations of Basil Ganglia” - Tuesday

Andrew Barto: http://www-all.cs.umass.edu/~barto/

Basil Ganglia Labs

Okihide Hikosaka Lab: https://irp.nih.gov/pi/okihide-hikosaka

Wilbrecht Lab

Uchida N. (ubiquitous dopamine motivation and reward)

Peter J. Magill

Schultz (Pioneer in the field)

C. Savio Chan

Doya, K. (theory)

Calabresi, P. (muscarinic)

Ana Graybiel (McGovern)

James C. Houk (1994 - Book on Models of Computation in the basal Ganglia)

Evolutionary Conservation of Basil Ganglia type action-selection mechanisms:

https://www.sciencedirect.com/science/article/pii/S0960982211005288

Dopamine D1 - Retinal Signaling https://www.physiology.org/doi/full/10.1152/jn.00855.2017 [Note to self: Too Off Track]

[ ~ ] Flurorphore Library

Official Badge? [ ] Printer Access [ ]?

—

Online Course on Laboratory Animal Science

Monday : 11 [x] 12 [x]

Tuesday : 13 [x] 14 [x]

Wednesday: 15 [x] 16 [/]

Thursday: 17 [x] 18 [x]

Friday: 19 [x] 20 [/]

Lesson 11 - Behavior and Environment, animals must be housed in an environment enriched to maximize their welfare.

Lesson 12 - Rodent and Lagomorph Accommodation and Housing - A more comprehensive guide from the macro environment, facilities i.e. establishments, to the micro environments. Covers health and safety procedures for personnel as well as geometry of housing units (rounded edges to prevent water accumulation). Absolutely essential.

Lesson 13 - Collecting Samples and Administrating Procedures - covers the most common collection techniques and materials collected and stressed the importance of doing as little harm as possible to the animal.

Lesson 14 - Transporting the Animal : Shipper holds most of the responsibility. Major goals are making sure the journey is as stress free as possible, contingency plans are in place, and that all of the logistics have been carefully planned, communicated, and coordinated between various parties responsible in the shipping. Also, animals should be prepared mentally and physically for the journey and should have a period of post-transportation to adjust to the new surroundings and environment. A number of practical issues must be considered such as temperature, availability of food, and access to animals during the journey. Boxes should be properly labelled in whatever languages are necessary.

Lesson 15 - The purpose of feeding and nutrition is to meet the energy needs of the animals, which vary by species, physiological state of animal (growth, maintenance, gestation, and lactation). A number of category of diets exist as well as a variety of specific diets to best fits the needs of the experiment. This chapter covers particulars of nutrition requirements and stresses the importance of avoiding obesity and malnutrition.

Lesson 16 - Anatomy and Physiology of Teleosts (Skip for now: Focus on Rodents and Lagomorphs)

Lesson 17 - Anatomy and Physiology of Rodents and Lagomorphs - General characteristics of the anatomy and physiology of six species, 5 rodents and 1 lagomorph. Mice, rats, guinea pigs, gerbils, and hamsters. Rabbits. It covers particularities of each species and has a quiz asking specific facts, mostly centered on commonalities and distinguishing factors. Worth a close read.

Lesson 18 - Anaesthesia and Analgesia in Rodents and Lagomorphs . Pre anaesthesia techniques, drug combinations, and repeated warning of the importance of choosing the right drugs and technique for the species. Use of a chamber. Methods of anesthesia (IP, IV, Volatile). Endotracheal Intubation for rabbits; the proper use and administration of analgesics; monitoring during the operation (for example - the paw pain reflex disappears in medium to deep anesthesia

Lesson 19 - Animal Welfare and Signs of Disturbance - This chapter repeatedly stresses the importance of the relationship between the caretaker and the animal. It repeats the ideal social, environmental, and nutritional environments for rodents and rabbits and highlights peculiarities of each species. After reading this one should be better suited to detecting stress, disease, or other ailments in a laboratory animal.

Lesson 20 - Fish Psychology and Welfare (Skip for now: Focus on Rodents and Lagomorphs)

Lessons 5, 17, and 20 pertain to fish

TEST SEPTEMBER 14th

—

MIT Open Course Ware:

Linear Algebra

Lecture 2 [/ ] -> Elimination by Matrices, production of elementary matrices, basic computations, and a review of row and column approaches to systems of equations. Introduction to the basic application of the rule of association in linear algebra.

Lecture 3 [ ]

Mouse Neuroanatomy

Ink Figure 16 [x]

Figure 20 [x]

Figure 24 [ ]

Introduction to MatLab: https://www.youtube.com/watch?v=T_ekAD7U-wU [ ]

Math Big Picture: Review Single Variable Calculus! Find reasonable Statistics and Probability Course (Statistical Thinking and Data Analysis? Introduction to Probability and Statistics?) Mine as well review algebra well I’m at it eh.

Breathe in. Breathe out.

—

Data analysis :: Behavioral Analysis

—

Ana Margarida - Lecture 6 - Handling Mice techniques

EuroCircuit can make a piece. Commercial v. DYI version of products.

Dario is the soldering, hardware expert. I.E. skilled technician.

www.dgv.min-agricultura.pt; it is recommended that the entry on Animal Protection and the section on Animals used for experimental purposes be consulted first.

—

Sir Ronald Fisher, stated in 1938 in regards to this matter that “To consult the statistician after an experiment is finished is often merely to ask him to conduct a post mortem examination. He can perhaps say what the experiment died of”.

——

Finally, it is time to publish and reveal the results. According to Santiago Ramón y Cajal, scientific writers should govern themselves by the following rules:

Make sure you have something to say; Find a suitable title and sequence to present your ideas; Say it; Stop once it is said.

8/21 Goals

Access ->

:: Champalimaud Private Internet [HR] Printer [HR]

:: Web of Science (?)

:: PubMed (Nature, Journals, etc.?)

———

PRIORITY: Online Course -> Animal Laboratory Sciences PDF’s

20 total -> 4 a day || I can finish by Friday

Monday : 1 [x] 2 [x]

Tuesday : 3 [x] 4 [x ]

Wednesday: 5 [x*] 6 [x]

Thursday: 7 [x* ] 8 [x]es

Friday: 9 [x ] 10 [x ]

Notes:

Lesson 1 - Philosophical and ethical background and the 3 R’s

Lesson 2 - Euthanasia. Recommended, adequate, unacceptable. Physical or chemical. Chemical - inhalable or injectable. Paton Lab uses CO2 and cervical dislocation.

Lecture 3 - Experimental Design. Return to as a starting point for basic design (randomized samples and blocks) Integrate with “Statistical Thinking and Data Analysis”

Lecture 4 - Legislation. Memorize specific laws and acts.

Lecture 5 is highly specific for the care and maintenance of Zebrafish

Lecture 6 - Handling of rodents and mice. A theoretical overview, this material is essentially kinesthetic.

Lecture 7 - Provides a technically detailed account of how genetic manipulations are done and propagated. Deserves a ‘printed’ review and vocabulary cross reference.

Lecture 8 - Health and Safety. Predominantly common sense.

Lecture 9 - Microbiology - contains an appendix with list of common infections that will be eventually be good to know.

Lesson 10 - Anaesthesia pre and post operation techniques, risks of infections etc.

// http://ec.europa.eu/environment/chemicals/lab_animals/member_states_stats_reports_en.htm

http://ec.europa.eu/environment/chemicals/lab_animals/news_en.htm -> General European News regarding

http://www.ahwla.org.uk/site/tutorials/RP/RP01-Title.html -> Recognizing pain in animals

Week of 8/20/18 To Do:

Tiago/Team -> Whats the most important priority?

Get Arduino Machine working again [?]

Jupiter/Python Notebook Up [ ]

Bruno MatLab Access [… ]

- Get documents to HR

- Animal Lab certified?

- Logistical/Certificate/Etc.

- Start discussing personal project:

> (Rat colony) Wet Lab

> (Machine Learning) Electric Lab

> Statistics project

- Reacquaint with Lab Technology/Protocols

- Review papers - Engage back with the science

Project Print: Screen shots

[ ] collect

“Do the job. Do it engaged. Engage -> Not just execute the best you can, understand the experiment.

Why? Alternative designs? Control experiments needed to interpret the data? Positive controls and negative controls? What do you need to do to get crisp. Totally engage.

How it fits into other experiments?

“Engage with the science as if it were your baby.”

Execute beautifully… Ask --- et. al. What does ideal execution look like

Extra time: allocate time. Technicians : Freedom to do other things, work with other things, other technical things, giving people independent project to carry out. Project --- has in mind? Design. Hands on education of how science works then reading. Spend time focused on a problem and in the ideal become the world’s foremost expert on whatever ‘mundane’ aspect of what ever problem you are working on.

Computational in the context of a problem. Learn to use. Defining “problems I want to solve.” As an operating scientist, the technology can change very quickly. Capable of learning, understanding, and applying.

Answer questions in a robust way. Thinking of technology in context of problem. Deep domain knowledge; focus on experimental more than book reading.

Realistic path -> Research fellow to PhD. program. Industry… Strong head’s up to do research. First-rate OHSU? Excellent. IF: Remember that it is narrow, broader with neuroscience as a component. Biology < > Neurology. Real neuroscience computational ->

Juxtasuposed: Engineering, CS, A.I., and all that…

Label in broad ways: Molecular, cellular, systems, cognitive, psychology. Borders are so fuzzy — as to be

Domain bias. In general -> other than P.I. protected from funding. Publication, the life of the business. Metric of success is the science they publish. Work that contributes to being an author = more engaged, more independent. Evolved to an independent project.

So incredibly broad -> CRISPR, GFP, Optogenetics, with higher level systems problems. 100 years = absurd. Look back -> Could we have conceived whats going on today.

Foremost expert on something how-ever limited. Grow from there. Grown from a particular expertise.

Molecular biologist || Do what a 3 year old is taught to do. How? How? How? How does that work. Quantum physics. Ask questions. Be open.

Go to seminars -> Go to every talk. Take every note. Primary literature fundamentally different. Always learn in context. Don’t dilute too much (ignore title, abstract, discussion). Look at figures and tables and derive for yourself what they say. Look for THE FIGURE or THE TABLE that is the crux and look for the control experiment. Understand the critical assessment, are the facts valid and warranted? Infinite amount to learn, don’t spread yourself infinitely thin. “

To Do: Develop Independent Machine Learning Project

Gain Access to Web of Science

————

Paton Learning Lab

Personal Learning Goals

September 1st - December 1st

Major Goals

[ ] Read Principles of Neuroscience 5th Edition

[ ] Complete CSS 229

[ ] Deep read 12 papers (Write summary || Practice peer review)

Administrative

[ ] Reactivate

[ / ] Figure out Residence Permit/Visa

Lifestyle

[ x ] Purchase commuter bicycle

[ / ] Purchase waterproof computer/messenger bag

Language

[x] …. Focused practice minimum 20 minutes daily …?

[ ] Find language partner

[ ] Portuguese film/television/music

UPCOMING

Phone conversation with --------

Tuesday, August 7th 9:00 a.m. EST (10:00 a.m.

0 notes

codeavailfan · 5 years ago

Text

Top 10 Statistical Tools For Business Development

Statistical Tools For Business Development

Statistics is a branch of mathematics where mathematical concepts and data can be systematically solved or sorted, i.e. we can analyse difficult data with statistics in a simple or concrete way.

Statistical tools are tools that can easily convert certain data or mathematical concepts in a good way or according to user needs.

Companies use different tools to properly analyze their data. With these tools, business people can easily hold business presentations, images, forms, and others to grow and grow their business.

On this blog you can easily learn many statistical tools that our experts have introduced. In this blog, you'll learn about the definitions of statistical analysis and the tools you need to analyze statistics.

Statistical analysis?

Before you know the statistical analysis, please note that statistical analysis is part of the analysis. Sector statistics are very worrying for our lives. Statistics can be found everywhere, from metropolitan businesses to the day-to-day work of homes.

In (BI) relationships with business intelligence, statistical analysis involves merging individual data samples and collecting multiple samples for samples. These samples are representative samples of the entire population.

Definition

The science of presenting, exploring and collecting large amounts of data in statistical analysis to identify possible models and trends. Statistics are widely used in industry, research agencies and government agencies.

This is the process of calculating data from stored data and the results of the analysis in a specific way, based on the user's needs, i.e. the definition is similar to the definition of data science and the fact that "data science" " Purdue statistician, created by William S in 2001.

Several communications companies use statistics to improve services, exploit network resources, and minimize customer exchange by creating better subscriber states

The cosmic government body also uses this statistical analysis to delete data from countries, businesses and individuals.

Some companies use these statistical tools to characterize design, improve fabrics and produce beautiful musical sounds for musicians.

Reliable between projects and full statistics, internal consistency measurement, etc. In terms of.

Resample each analysis with a full analysis manual (e.g. Crosstable, reliability, frequency, etc.)

Analysis of the regression type includes 7 non-linear and linear regressions, such as triple, logarithmic, secondary, etc.

Error analysis of multiple boxes and whiskers

Standard deviation, average and standard deviation are some descriptive statistical characteristics.

Frequency and crosstable analysis are more responses.

The mutual product deviation, scatterdiagram matrix, covariance, user-defined confidence interval are the characteristics of the related matrix.

Multiple choice questionnaire Classic analysis

The dimension effect (d and r) is a bar chart, an error bar chart, a double-linked histogram, and a separate t-test.

Data management, output management, multimedia, education management are some other descriptive features.

Now let’s learn several statistical tools.

Mathematical and statistical calculations used to examine data. Fact-checking tools can view, compress, and simplify data. Different tools can break down factual information. These range from moderate basic calculations to advanced ones. Basic analytics can be easily performed, while more advanced strategies require a comprehensive understanding of advanced measurements, as do specific PC programming.

These statistical tools are used in the field of human behaviour research and are provided free of charge in R. All parts of the data processing can be simplified by the unusual range of use accessible to their tool boxes. R wants to code in a specific way, but R is groundbreaking

programming. R also has an unstable expectation of absorbing information. Effectively attracts a group of people to manufacture and improve R and its associated modules.

Social Science Statistics Pack. The most commonly used programming software packages for social organizations are real packages for sociology. The Sociological Fact Pack offers the ability to graphically display results with assembly parameter control, flawless insights, non-parameter control and graphical user interface (GUI). Exams can be mechanized by creating content, and remember that this choice is due to sociological fact bundles.

Known as Matlab, the logical phase and programming language are widely used by engineers and researchers. You have a very high expectation to get information, so sooner or later you will have to write your own code. Many toolkits can be used to solve research problems. For example, you can use EEGLAB tools to investigate EEG information. It's hard for interns to learn Matlab, but if you have to code, it's very suitable.

MsExcel's expectations are not the answer to measurable controls, but Microsoft offers a wide range of tools that have high expectations for understanding information and core metrics. Microsoft Excel expectations become a useful tool for individuals who need their basic information by creating summary actions, customizable artwork, and images. Many people and organizations understand how to benefit from higher expectations, making it easier for everyone to learn metrics.

Statistical data according to the scientific classification use programming software called graphpad prisms. GraphPad Prism is used not only for scientifically identified measurements, but also for different areas. The sociology factor package is exactly the same as the ability to create complex, measurable estimates through survey computer processing and script selection, but the graphical user interface is the basis for most work.

Statistical analysis software is a driven search that can be performed using the graphical user interface or by creating the content of an actual scan section called SAS. It is an advanced system that is designed to provide medical services, business, human behavior etc. To investigate. They are used on the territory of the country. Advanced analysis can be done and you can create charts and graphs that deserve distribution, even though coding is difficult for those who are not used to such a methodology.

Origin pro, a user-friendly indicator and direct interface for creating, dissecting and researching information. You can use the workflow to improve group tasks.

Matomo analysis is an open source web scan section. One hundred and ninety countries are used on more than 1.4 million sites. The Matomo study was sometimes Piwik.

Stat Graphics is designed for use by high-quality and globally trained customers and organizations. Even non-analysts can experience the benefits of business scrutiny with detailed illustrations. Statistical analysis can be carried out, models can be built and the analysis consists of an instinctive interface.

Use XLSTAT's various tools to develop the system capabilities you expect. This makes it possible to take a look and assess information.

Conclusion

This blog will help you to choose the best tool for data analysis. Statistical tools have many species and all have different features. Similarly, data also has several species and different data choose different tools according to their properties. So this Blog will find you the best tool. If you want Statistics Assignment Help and Statistics Homework Help or Do my Statistics Assignment. or SAS assignment help So, Our experts are available to provide you within a given deadline and definitely you will score good in your academics.

#statistical tools #top 10 statistical tools #definition of statistical analysis #features #business development

0 notes

brainyassignmenthelponline · 5 years ago

Text

How to Achieve Success in Your Statistics Online Exam?

A student’s entire career and future is dependent on the academics and thus it becomes a prime factor for him/her to secure outstanding grades and excel in all exams. Statistics is such a subject that has its major portion related to mathematics and it is also said to be a branch of mathematics. Therefore, statistics can be a trouble for those students who have recently started to learn the subject. We assure you that after taking help from statistics online exam help, students will definitely see an increased score and better grades in the subject. Thus, to learn more about the features of this platform, please go through this article.

When it is about online exam, students are always in a dilemma whom to trust and whom to not with their online exam. There are plenty of websites offering lucrative deals and students easily get attracted to them. But let me tell you, many of these websites turn out to be scam and thereby students lose their essential grades, money and of course valuable time. In such situation, statistics exam help online comes to the rescue. We can easily be reached by dropping us a mail or text. We have an efficient customer care staff who are available round the clock and thus students can call anytime and avail our services.

Moreover, students can also avail help for topics related to statistics like sampling theory, STATA, simplex method, hypothesis testing, linear programming, tree diagrams, probability theory, standard deviation, operations research, R Programming, forecasting, simulation, game theory, time series, MATLAB, Markov analysis, queuing theory, vital statistics, business analytics, data mining, normal distribution, binomial distribution, subjective probability, applied statistics and many more. At Statistics Test Help, e guarantee you that all your given questions will be attempted by our tutors and the answers to be 100% accurate and unique. There will be no sign of plagiarism as our tutors write everything from scratch. Thus, we ensure that all the answers will be genuine and authentic.

We are well aware of the fact that students do not have any additional source of income other than the pocket money they get from their parents. Thus, we have assigned reasonable prices for our services so that students would not have any financial pressure and could easily bear the expenses. Pay someone to take my online statistics test helps students with their online statistics exam and tests at a very reasonable price. The tutors are friendly in nature and are ready to assist students at any flexible hour. Students can visit the website and opt for their required service. After that our tutors and professionals will get back to you as soon as they get notified.

Are you looking for help with your statistics quiz? If yes, then statistics quiz help is the right platform that lessen all your burden and solve your problem. We have hired qualified tutors with years of experience and they are all capable of solving even the trickiest question with ease. Thus, to avail assistance from our tutors please visits our website.

Read more about: Where will I find help with financial accounting homework?

#statistics online exam #statistics test help

0 notes

alexshrink · 6 months ago

Text

Struggling with Statistics? Get 15% Off on Homework Assistance Today!

Are you grappling with challenging statistical concepts or facing tight deadlines for your homework? Whether you are stuck with regression analysis, hypothesis testing, or any other statistical technique, you’re not alone. Many students find statistics overwhelming, especially when juggling multiple assignments and responsibilities. If you’ve ever found yourself thinking, Can someone do my statistics homework?, we’re here to make your life easier. At StatisticsHomeworkHelper.com, we specialize in offering expert statistics homework assistance, and today, we’re thrilled to announce an exciting offer: get 15% off on our services using the referral code SHHFESTIVE15.

Why Choose Professional Help for Statistics Homework?

Statistics isn’t just about crunching numbers; it requires critical thinking, a clear understanding of concepts, and the ability to apply these skills in real-world scenarios. Here’s why enlisting professional help can be a game-changer:

1. Complexity of Statistical Topics

From probability distributions and inferential statistics to data visualization and software like SPSS or R, the scope of statistical studies is vast. It’s natural to feel lost amidst these complexities. Professional experts simplify these concepts, ensuring you grasp the fundamentals while achieving excellent grades.

2. Time Constraints

University life can be hectic. Balancing coursework, exams, part-time jobs, and personal commitments often leaves little room for completing assignments. By seeking professional help, you save precious time to focus on other priorities without compromising on quality.

3. Accuracy and Quality Assurance

Statistics assignments demand precision. Even a minor error in calculations or interpretations can lead to incorrect results. With professional guidance, you’ll receive error-free, high-quality solutions that meet academic standards.

4. Customized Support

Every student’s needs are unique. At StatisticsHomeworkHelper.com, we offer personalized assistance tailored to your requirements, ensuring you get the most out of our services.

Exclusive Offer: 15% Off for a Limited Time

To make professional help more accessible, we’re offering a 15% discount on all statistics homework services. Use the referral code SHHFESTIVE15 when placing your order. Whether you need help with a single assignment or ongoing support throughout the semester, this festive discount is our way of easing your academic journey.

What Sets Us Apart?

At StatisticsHomeworkHelper.com, we pride ourselves on delivering exceptional services. Here’s what makes us the preferred choice for students:

1. Expert Team of Statisticians

Our team comprises highly qualified statisticians with years of academic and professional experience. They are well-versed in various statistical methodologies and software tools, ensuring your assignments are in capable hands.

2. Plagiarism-Free Solutions

We understand the importance of originality in academic submissions. All our solutions are crafted from scratch, ensuring 100% plagiarism-free work.

3. Timely Delivery

Missed deadlines can have serious repercussions on your grades. That’s why we prioritize timely delivery, ensuring your assignments are completed well before the due date.

4. Affordable Pricing

We believe quality education support should be affordable. Our competitive pricing, combined with the current 15% discount, makes our services budget-friendly for students.

5. Confidentiality Guaranteed

Your privacy is our priority. Rest assured, all your personal and academic information will remain strictly confidential.

6. 24/7 Customer Support

Have a query or need urgent assistance? Our dedicated customer support team is available round the clock to address your concerns.

Types of Assignments We Handle

StatisticsHomeworkHelper.com caters to a diverse range of topics and assignment types, including but not limited to:

Descriptive and inferential statistics

Probability theory

Regression analysis

Hypothesis testing

Time series analysis

Data visualization and interpretation

Use of statistical software like SPSS, R, SAS, and Excel

No matter the complexity or deadline, we’re equipped to provide reliable and efficient solutions.

How to Avail the Offer

Getting started is easy! Follow these steps to claim your 15% discount:

Visit Our Website: Go to StatisticsHomeworkHelper.com.

Submit Your Requirements: Fill out the order form with details of your assignment.

Apply the Referral Code: Enter SHHFESTIVE15 at checkout to get 15% off.

Make Payment: Choose a secure payment method to confirm your order.

Receive Your Solution: Sit back and relax while our experts work on your assignment. You’ll receive the completed solution before your deadline.

Testimonials from Satisfied Students

Here’s what some of our happy clients have to say:

“Statistics was always a nightmare for me until I found StatisticsHomeworkHelper.com. Their experts are knowledgeable and patient, and their solutions are always spot on. Highly recommended!” — Sarah M., University of California

“Thanks to this service, I scored an A+ on my regression analysis assignment. The 15% discount was a bonus!” — James T., University of Michigan

“I’ve used several homework help platforms, but this one stands out for its professionalism and quality. The team really knows their stuff!” — Priya R., University of Toronto

Tips for Excelling in Statistics

While we’re here to assist you, incorporating these tips into your study routine can boost your performance:

Master the Basics: A strong foundation in fundamental concepts like mean, median, mode, and standard deviation is crucial.

Practice Regularly: Solving problems consistently helps reinforce your understanding and identify weak areas.

Utilize Resources: Leverage textbooks, online tutorials, and software tools to enhance your learning.

Ask Questions: Don’t hesitate to seek clarification on confusing topics. Active participation leads to better comprehension.

Stay Organized: Keep your notes, formulas, and study materials well-organized for easy reference.

Final Thoughts

Statistics doesn’t have to be daunting. With the right guidance and resources, you can excel in this subject and achieve your academic goals. At StatisticsHomeworkHelper.com, we’re committed to making this journey as smooth and rewarding as possible. Take advantage of our 15% discount today by using the referral code SHHFESTIVE15, and let us handle your statistics homework while you focus on what matters most.

Visit StatisticsHomeworkHelper.com now and make the most of this limited-time offer. Say goodbye to stress and hello to academic success!

#education #homework #statistics #homeworkhelp #assignment #college #university #assignmenthelp #study #homeworkhelper #help with statistics homework using r #statistics hw help

0 notes