#MTS verification tips
Explore tagged Tumblr posts
manasastuff-blog · 10 months ago
Text
MTS Havaldar total documents verification #trending #viral#mts#ssc The MTS Havaldar Total Documents Verification Process is a crucial step in securing your position, and understanding it thoroughly can make or break your success. In this video, we reveal the entire process of document verification for MTS Havaldar candidates, ensuring you have all the necessary documents prepared and in order. From required certificates to tips on avoiding common mistakes, this guide covers everything you need to ace your document verification. Make sure you’re fully prepared by watching this essential video and taking notes. Don’t let missing or incorrect documents hold you back from achieving your dreams. Subscribe for more tips and guides on acing your MTS Havaldar exams. Call:7799799221
Website:www.manasadefenceacademy.com
#MTSHavaldar #DocumentsVerification #MTSExam #GovtJobPreparation #JobVerification #SSCMTS #HavaldarTips #GovernmentJobs #DocumentChecklist #CareerGuidance
0 notes
havenholidaysltd · 2 months ago
Text
Manaslu Circuit Trek at a Glance
"Manaslu Circuit Trek: A Wilderness Trek in the Remote Himalayas of Nepal"
The Manaslu Circuit Trek offers a rugged and stunning trek into Nepal's remote western Himalayas. Begin the trek with a scenic jeep or bus ride from Kathmandu to Machhakhola (930 m / 3,051 ft), over terraced fields and hill villages. The scenic drive from Kathmandu to Machhakhola is around 8 to 10 hours depending on the road conditions.
The actual Manaslu Circuit trekking distance from Machhakhola to Dharapani (1,860 m / 6,102 ft) is about 110 miles (177 kilometers). One takes a jeep or bus ride from Dharapani to Besisahar and then back to Kathmandu to end the trek. Both such return trips usually take 8–10 hours in total.
The  Manaslu Circuit trek typically takes 13–15 days to complete. Trekkers walk 5 to 8 hours a day for 6 to 12 miles (10 to 20 kilometers) each day. The highest point is the Larkya La Pass at an elevation of 5,106 meters (16,752 feet), which has stunning panoramic mountain views. See grand mountains such as Mt. Manaslu (8,163 m / 26,781 ft), Himlung Himal (7,126 m / 23,379 ft), Cheo Himal (6,820 m / 22,375 ft), and Kang Guru (6,981 m / 22,904 ft) from the pass.
The Manaslu Circuit trek goes through green valleys, alpine grasslands, and rhododendron jungles in Manaslu Protected Area which is a restricted area in Nepal. Climbing up to Larkya La (5106m) is the most difficult part of the Manaslu Base Camp Trek and is typically icy and steep. Some sections of the Manaslu trail are rocky and steep, especially from Samdo to Dharamsala.
Food and accommodation in Manaslu Circuit Trek are basic but good. Teahouses offer Dal Bhat, noodles, soups, and the occasional Western food. Rooms are mostly twin-share with common toilets. Greater altitudes offer fewer comforts and restricted menus.
Best time for the Manaslu Circuit Trek is spring (March to May) and autumn (September to November). These seasons offer clear skies and temperate weather.
Trekkers need a Manaslu Restricted Area Permit, Annapurna Conservation Area Permit (ACAP), and Manaslu Conservation Area Permit (MCAP).  Besides, the trekkers have to pay for Rs. 1000 per person for Local Manaslu Area Entry Permit. A licensed guide is mandatory and necessary. A porter is highly recommended for comfort and security.
14 Days Manaslu Trek | 14 days
4.9
(12 reviews)
Trekking in Nepal
From US$ 1,465
US$ 1,098 Save US$ 367
View Trip
Trekking to Manaslu Circuit remains one of Nepal's top off-the-beaten-path adventures.
Suggested Blog Posts for Manaslu Circuit Trek
1. New Additional Local Area Permit in Manaslu Region
2. Manaslu Circuit Trek in Spring
3. Manaslu Circuit Trek Package Cost Details
4. Manaslu Circuit Trek Transportation Service Details
5. Manaslu Circuit Trek Itinerary
6. Manaslu Circuit Trek Cost
7.Manaslu Circuit Trek- A Complete Trekker's Guide
8. How Difficult is Manaslu Circuit Trek? 
9. Is Manaslu Circuit Trek Worth it? 
10. IS Manaslu Circuit harder than the Everest Base Camp? 
11. How to plan for Manaslu Circuit Trek? 
12. Manaslu Trek in Spring
13. Kathmandu to Machhakhola Bus
14. Manaslu Circuit Trek in April
15. 50 Facts You May Not Know About Manaslu Circuit Trek
16. Manaslu Circuit vs. Annapurna Circuit
17. Manaslu Circuit Trek in May
18. How much does Manaslu Circuit Trek Cost?
19. 20 Tips to Make Manaslu Circuit Trek Successful
20. Manaslu Circuit Trek in November
21. Best Time for Manaslu Circuit Trek
22. Manaslu Circuit Trek in October
23. Manaslu circuit Trek in Autumn
Manaslu Circuit Trek Elevation Chart
Segment    Elevation (m)   Distance (km)   Key Features
Machhakhola 930                       0                  Starting point; health post available
Jagat                 1,340               22                   Checkpost for permit verification
Deng                 1,860               20                  Lodges available
Namrung        2,630               19                   Checkpost; health post
Lho                         3,180                11                 Monastery; lodges
Sama Gaon         3,530                 7                    Health post; acclimatization day; side trip to Pungen Gumba (4,200 m)
Samdo                 3,860                 9                    Checkpost; health post
Dharmasala         4,460                 12                      Last stop before Larkya La Pass; limited lodges
Larkya La Pass 5,106                 8                     Highest point of the trek
Bimthang         3,720                 24.7                     Lodges; health post
Dharapani             1,860                 22                     Checkpost; health post
Manaslu Circuit Trek in September
Manaslu Circuit Trek in September is among the best trekking experiences in Nepal. September is the start of autumn, the best trekking season in Nepal and the skies are clear with minimal rainfall. It is the best month for continuous mountain views, stable weather, and comfortable trekking conditions. The monsoon season finishes early in September with fresh trails and green valleys to leave behind.
The weather in Manaslu Trekking during September is generally dry and stable. Lower regions like Machhakhola (869 m), Jagat (1,340 m), and Deng (1,860 m) are warm in the daytime, ranging from 18°C to 25°C in September. While ascending to places like Namrung (2,630 m), Samagaon (3,530 m), and Dharmashala (4,460 m), temperatures are around 5°C to 15°C in the daytime and less than 0°C at night.
Hiking to Manaslu Circuit in September rewards you with beautiful mountain vistas. From Larkya La Pass (5,160 m), the highest point of the trek, you can see mountains like Mt. Manaslu (8,163 m), Himalchuli (7,893 m), Ngadi Chuli (7,871 m), Cheo Himal (6,820 m), Kang Guru (6,981 m), and Himlung Himal (7,126 m). The visibility in September is ideal, with clear skies and little or no haze.
Accommodation on the Manaslu Circuit Trek in September is readily available. Village teahouses like Lho (3,180 m), Samdo (3,875 m), and Bimthang (3,590 m) have basic rooms and hot food. The meals typically include dal bhat, noodles, soups, momos, and tea. There are warm blankets and charging points available in most teahouses during Manaslu Trek in September.
Transport to Manaslu  trailhead involves a jeep or bus ride from Kathmandu to Machhakhola (869 m) and 8–10 hours. Roads may still show residual monsoon damage at the start of the month but change quickly soon after. To go back from the trek, from Dharapani (1,860 m), go back to Besisahar (760 m) by jeep. From Besisahar, go back to Kathmandu by tourist bus or local bus. You still other options like private jeep or private car to go back to Kathmandu from Besisahar.
Mt. Manaslu Trek in September is one of the best Himalayan treks. With good weather, less people, and breathtaking views,  Manaslu Circuit Trek in September is one of Nepal's best treks.
Manaslu Circuit Trek | 16 days
4.8
(9 reviews)
Trekking in Nepal
From US$ 1,675
US$ 1,255 Save US$ 420
View Trip
Manaslu Circuit Trek in September: Highlights 
1. Crystal Clear Himalayan Scenery After Monsoon
September signals the end of monsoon, when the crystal clear mountain scenery is that of snowy Himalayan giants. As the sky clears up, the trekkers revel in panoramic scenery, particularly from Lho (3,180m) and Samagaun (3,530m).
From these villages, the view of Mount Manaslu (8,163m), the 8th highest mountain of the world, rises high in the horizon. Himalchuli (7,893m), Ngadi Chuli (7,871m), and Shringi Himal (7,161m) are some peaks which stand sharply defined.
September mornings in Manaslu Circuit Trek are crisp with temperatures ranging from 6°C to 12°C at higher altitudes. Post-monsoon freshness enhances the scenery of the alpine landscape—lush greenery remains fresh, and the visibility of glaciers, such as those around Pungyen Gompa, is good.
The sunrise over Manaslu from Shyala village (3,500m) will be a photographer's paradise during September. The vista becomes more dramatic as you approach Dharamsala (4,460m) before going over Larkya La Pass (5,160m), one of Nepal's highest trekking passes.
2. Floral scenery and green landscapes
In September, Manaslu Trails still sports the new green leaves of the recently past monsoon in Manaslu Conservation Area. The Manaslu trek from Soti Khola (710m) to Philim (1,570m) and Deng (1,860m) is via subtropical forests of bamboo, rhododendron, pine, and alder trees.
The wet soil and sun together in September bring on a final burst of monsoon vegetation—wild orchids, ferns, and mossy stones line the path, so that it seems like a fairy tale. The Budhi Gandaki River is full and forceful, cutting gorges and creating scenic waterfalls during your Manaslu Circuit Trek in September.
Manaslu hiking  in September is also a birdwatcher's time. Colorful birds like the Himalayan monal, blood pheasant, and snow partridge are spotted in the forests past Namrung (2,630m) during September.
Trekkers doing Manaslu Circuit Trekking in September can enjoy quite comfortable weather at lower altitudes—15°C to 22°C, so ideal for long trekking days on forest and hill-terrace trail.
3. Off-the-Beaten- Trails Villages' Cultural Festivals
September is also festival time in the Manaslu Himalayas and entire Manaslu Region. One of the most standout ones in the Manaslu region is Yartung, which is celebrated by ethnic Gurung and Tibetan populations in villages like Samagaun and Lho in early September.
Yartung marks the close of the monsoon and the beginning of warmer weather. Horse racing, archery contests, singing, and traditional Tibetan dances are festivals celebrated by local communities. Guests are typically invited to join in the festivities, offering a rare chance to experience the unique mountain culture during Manaslu Trekking in September.
These villages, 3,100m to 3,500m, also have Buddhist monasteries like Ribung Gompa near Lho and Pungyen Gompa near Samagaun. The crisp, cool weather and celebratory atmosphere of September make Manaslu Circuit Trek a culturally fulfilling time to travel.
Mixing spiritual mood, colorful dress, and communal celebration against a background of glaciers and mammoth mountains of Manaslu lends the trek a deeply human flavor during September.
4. Crossing the Larkya La Pass with Best Weather
Larkya La Pass (5,160m) is the physical and mental climax of the  Manaslu trek. During September, the snow conditions for passage are usually firm and secure with the least amount of snowfall compared to winter or spring.
The pre-dawn ascent to Larkya La starts for the trekkers from Dharamsala (4,460m) when the temperature ranges from -2°C to 3°C. Skies are generally clear, and early sunlight lights up the massive Himalayan amphitheater.
From the Larkya La pass summit, there is an awe-inspiring view of summits, such as Cheo Himal (6,820m), Himlung (7,126m), Kangguru (6,981m), and the Annapurna II ridge (7,937m). The way down to Bimthang (3,720m) is breathtaking, with glacial lakes and moraines etched in high relief by the light of September.
Cool, dry breezes and better trail stability (thanks to post-monsoon dryness) make it one of the most comfortable months to cross Larkya La without the risks of heavy snow or monsoon rain in September.
5. Fewer Crowds and Peaceful Trails
Even though September heralds the onset of autumn trekking season for Manaslu Trek, the hordes of the so-called mainstream trekkers that throng the Annapurna or Everest areas in September have not yet set in. That makes the Manaslu Circuit in September, a limited area trek, even more isolated and virgin.
Villages like Namrung, Lihi, and Sho still have their serene beauty, with fewer trekkers at tea houses, allowing for more personal interaction with locals during September. With fewer people on the trail, wildlife sightings (blue sheep and Himalayan marmots) are more likely, especially in the Manaslu Conservation Area.
Temperatures in Manaslu Circuit Trek in September remain pleasant—14°C to 20°C in the lower hills and 5°C to 10°C higher up—ideal for trekking without overheating or overcooling.
September is characterized by the serenity of the green post-monsoon jungle, river and waterfall noises, and being strongly surrounded by nature. This sets it apart as the ideal choice for those that are hungry for seclusion and immersion rather than tourism and commercialization if you plan or set your Manaslu Circuit Trek in September.
What is the weather like in September in Manaslu Circuit ?
Manaslu Trek in September offers the most delightful weather and vibrant landscapes as the monsoon stops from the end of the August. September in Nepal marks the transition from the wet season to autumn. You’ll enjoy blooming greenery, clearer skies, and less crowds than in October while doing Manaslu Trek in September.
There may be light rain showers in Manaslu Circuit Trail in early September. Trails can become muddy and slippery, sometimes, but bearable.  Manaslu Trek in Mid September experiences dry weather, clear visibility, and improved trail conditions.  Manaslu Circuit Trek in Late September typically sees calm weather, invigorating air, and stunning views of the surrounding mountains including Mt. Manaslu.
 Manaslu Circuit Trek Temperature in September ranges are like this: It is 15°C to 25°C (59°F to 77°F) in Machhakhola (930 m / 3,051 ft). Deng (1,860 m / 6,102 ft) is cool, with temperatures of approximately 12°C to 22°C (54°F to 72°F). Samagaon (3,530 m / 11,581 ft) temperatures will be 5°C to 15°C (41°F to 59°F). Samdo (3,875 m / 12,713 ft) is 3°C to 13°C (37°F to 55°F). Dharmasala (4,460 m / 14,632 ft) is still cold, with -2°C to 10°C (28°F to 50°F).  The temperature At Larkya La Pass (5,160 m / 16,929 ft) in September, it drops to -6°C to 5°C (21°F to 41°F).
It may rain in the first week of September, especially at lower altitudes like at Machhakhola and Deng during your Manaslu Circuit in September. It snows at Larkya La Pass, especially late September on cold nights.
Trekking to Manaslu Circuit in late September requires warm gear, waterproof jacket, and sturdy boots. Pack rain gear and thermal wear. Trekking poles for icy trails. Break early for improved weather.
Manaslu Trekking in early September may be rainy; pack moisture-wicking clothes. Manaslu Circuit Trek in mid September is worth it with better weather and view of Mount Manaslu (8,163 m / 26,781 ft).
What is the temperature like at Larkya La Pass in September?
Larkya Pass temperature in September remains chilly due to its high altitude (5,160 meters). Trekkers must be adequately prepared for the cold and fluctuating weather. Conditions vary slightly during the month.
Temperature at Larkya Pass in early September is generally between -3°C at night and 5°C during the day. The occasional monsoon rains may still linger. The trail may be slippery. Pack rain gear and waterproof boots.
Temperature at Larkya Pass in mid September is between -4°C and 4°C. Skies begin to clear, with better views. Mornings are still frosty. Pack thermal layers, gloves, and wind-proof jackets.
Temperature at Larkya La Pass in late September gets even colder, between -6°C to 3°C. Winds get stronger. Nights become really cold. Expect possible frost. Wear insulating clothing and pack warm backup layers.
Prepare very well for Larkya Pass in September while ascending from Dharmasala before the dawn during your Manaslu Circuit Trek. Stay warm, dry, and covered for the high-altitude crossing.
Is September a good time for Manaslu Circuit Trek? 
September is excellent for the Manaslu Circuit Trek due to favorable post-monsoon weather. Clear skies are typically experienced, with crisp mountain views on offer during Manaslu Circuit Trek in September. Rainfall is significantly decreased, considerably enhancing the state of the trails. Humidity is minimal, and trekking becomes more enjoyable and comfortable.
Manaslu (8,163m), the eighth highest peak, is well visible in clear September skies. Himalchuli (7,893m) and Ngadi Chuli (7,871m) peaks are also well visible. Larkya La Pass (5,106m) is safely crossed with stable weather.
Comfortable temperatures are felt between 700m at Arughat and 3,500m at Samagaun during Manaslu Circuit Trek in September. Higher levels close to Larkya Phedi (4,460m) are cool but tolerable.  Manaslu Hiking Trails in September are mostly dry, avoiding monsoon-caused landslides and leeches.
There is dense vegetation between Jagat (1,410m) and Deng (1,804m) owing to monsoon nourishment. Rhododendron woods remain green, especially around Namrung (2,630m) and Lho (3,180m). Alpine plants grow near Samdo (3,875m), offering landscape contrast during Manaslu Trekking in September.
Himalayan tahr and blue sheep can be spotted occasionally in less frequented forested parts in Manaslu Conservation Area in September. Birdlife is enhanced, especially around Philim (1,570m) and Ghap (2,160m). Less frequented paths enhance the possibility of wildlife sighting.
Crowds in September are smaller than in October, contributing to peace and solitude during your Manaslu Circuit Trekking. Teahouses are likely to be open and less busy. Indra Jatra and other local festivals are celebrated in nearby villages, offering cultural insight.
Overall, September conditions ensure stunning views, green biodiversity, cultural richness, and fewer disruptions on the Manaslu Circuit.
Manaslu Circuit Trek in September: Pros and Cons
The September Manaslu Circuit trek offers a virgin Himalayan adventure in early autumn. It is the beginning of the main trekking season in Nepal and same happens to Manaslu Region. The September Manaslu trek offers green scenery, sunny weather, and comfortable temperatures. Trekkers experience fewer tourists than in October. The September Manaslu Circuit trekking offers spectacular views of Mt. Manaslu (8,163 m), the eighth highest mountain in the world. The trek passes through diverse sceneries from Arughat (600 m) to Larkya La Pass (5,160 m). September post-monsoon clarity offers nice vegetation, waterfalls, and village scenes. It's a good choice for off-beat trekking in Nepal.
Benefits of Manaslu Circuit Trek in September
1. Fewer Crowds and Quiet Trails
Manaslu Circuit trek in September is less crowded compared to October and November. Trekkers want to wait for best autumn. This allows early September trekkers to enjoy solitude. You’ll pass villages like Namrung (2,630 m) and Samagaon (3,530 m) in peace. Teahouses offer quiet dining and available rooms. Trails remain undisturbed, ideal for photographers and nature lovers. The remote nature of the region shines without tourist noise. Less crowding at Larkya La Pass (5,160 m) enhances the experience. Fewer trekkers also reduce environmental stress on trails. September is the best time for a more intimate Himalayan trekking.
2. Post-monsoon freshness and mountain views
Post-monsoon freshness with clear air and fresh vegetation in September proves to be the key to everything. Skies begin clearing within the first week. Mountains like Himalchuli (7,893 m), Ngadi Chuli (7,871 m), and Mt. Manaslu (8,163 m) appear great. Day by day, the visibility improves from early September onwards. The surrounding peaks near Samdo (3,875 m) and Dharamsala (4,460 m) are snow-capped. Larkya La Pass (5,160 m) offers memory-sparking panoramic scenery. Early morning hours typically provide crystal-clear visions. The pure air after monsoon dust and fog makes it ideal for photographing. Rivers and waterfalls swell and add beauty. September imparts both visual and atmospheric trekking experience on Manaslu trail with an added boost.
3. Flora in Bloom and Rainbow Scenery
Manaslu Circuit in September offer greenery at its best post-monsoon show. Rhododendron woodlands and flower meadows are still colorful. You will hike through tropical forests under Machha Khola (869 m) and pine forests around Deng (1,800 m). Wildflowers are in bloom till mid-September. Waterfalls cascade close to Jagat (1,340 m) and Ghap (2,165 m). September brings nature at its best. Wild life spotting increases owing to abundant water and food. Langurs, Himalayan thar, and multicolored birds are spotted. Rivers like Budhi Gandaki flow with full force. The land is teeming with life in the aftermath of monsoon showers. The route is unparalleled for beauty in September.
4. Cultural Immersion and Local Festivals
There are several Hindu and Buddhist festivals celebrated in Manaslu region in September. Teej and Indra Jatra occur this month. Men and women alike celebrate with feasts, prayers, and songs. You get to witness mountain village festivals in Samagaon and Lho (3,180 m). Monasteries are full of celebrations and prayers. It is the best time for cultural interaction. The Tamang and Tibetan-influenced population welcome visitors warmly. Hospitality is sincere and unforced. Being witness to their traditions gives a spiritual dimension to the trek. Teahouse menus include delicacies of the festival season. September is an ideal time to connect tradition with tourism. The trek is as much a cultural experience as a sightseeing exercise.
5. Conveniently Available Lodges and Meals
Early September has ample accommodation on Manaslu Circuit Trekking Trail. Teahouses in Philim (1,570 m), Namrung, and Samdo are serene. Rooms are available on a first-come basis without prior booking. Personal attention and polite service are added to the experience. Meals are hot with little delay. Fruits and vegetables from the local market are easily available after monsoon. Prices are slightly less than in October. Wi-Fi, charging, and basic facilities remain operational. Guides and porters are easily available. Travel to trailheads like Machha Khola has less demand. Travel remains smooth without the pre-monsoon rush. September has a mix of excellent trekking and good local infrastructure.
Disadvantages of Manaslu Circuit Trek in September
1. Spotty Rain and Trail Wetness during Early September
Early September still receives leftover monsoon rain during Manaslu Circuit Trek especially at lower elevations like at Deng and Namrung and Dharapani and Machhakhola. Unpredictable shower rains are a possibility. Trails along Jagat and Deng may be wet. Slippery paths along river valleys need careful watch. Landslide spots along Machha Khola to Tatopani (990 m) may pose risks. Raincoats and waterproof gear are essential. Trekking boots must provide a good grip. River crossing is challenging due to high water levels. Rain reduces after mid-September but humidity remains. Leeches increase below 2,000 m. Cloud cover may disrupt views at the start of the trek. Weather tends to improve but remains unpredictable during the first week. Be flexible with itinerary.
2. Few Flights and Bad Road Conditions
Roads in September can still be plagued by post-monsoon damage. Landslides may obstruct access near Arughat and Soti Khola (700 m). Driving from Kathmandu to Machha Khola can be delayed. Public transport may not be on schedule. Private jeeps are required but expensive. The bumpy roads worsen during rainy conditions. Flight options via Kathmandu or local towns are limited if you are planning to begin your Manaslu Circuit Trek from Pokhara. Weather delays could affect road travel. Buffering days while planning is important. Reaching the trailhead might be more challenging than hiking itself. It is better to access by late September. Early-month visitors will have indefinite logistics.
3. Unpredictable Weather Patterns in Early Autumn
September weather swings between monsoon and autumn in Manaslu region and all over Nepal. Conditions vary significantly by region and elevation. Lower elevations like Machha Khola remain warm and humid. Higher elevations like Samdo are cold overnight. Rain may persist on through the first week. Larkya La Pass can be expected to get early snowfall. Morning is clear but clouds develop in the afternoon. Layered dressing becomes inevitable. Gear must be multifunctional to take rain and cold. Weather apps are incapable of predicting mountain weather. September demands flexibility and caution. Forecasts are still uncertain despite clearing skies at the beginning of the month.
4. Some Teahouses May Not Be Entirely Functional
It is mostly teahouses that reopen in early September after monsoon. Some remain shut for maintenance. Choices in smaller villages such as Lihi (2,900 m) can be restricted. Hot showers or Wi-Fi may not be provided. Kitchens can serve a limited menu. Stock is slow to be replenished after the monsoons. Off-lying villages such as Dharmasala (4,460 m) experience delivery lags. Less trekkers translate to less meals cooked every day. Generator or solar power may not be available all the time. Local staff may also be returning from lower villages. Accommodation gets better as the month progresses. Early trekkers must keep expectations low on facilities.
5. Fewer Group Departures and Solo Challenges
September has fewer organized group hikes for Manaslu Circuit. It becomes harder to find partners for solo hikers. The Manaslu hike requires a guide and two hikers as a minimum. Solo permits are not available. Fewer hikers mean fewer permit-sharing options. Fixing last-minute group joining is not easy. Paying a guide becomes more costly for individuals. Communication is limited in less-used parts. Fewer trekkers on trail also mean fewer backup safeguards. Isolation increases in case of illness or injury. Early September has no trekking community of October. Fixed departures from agencies obviate this. Pre-planning is a necessity for solo trekkers.
Manaslu Circuit Trek in September: Preparations
Manaslu Circuit Trek in September is an experience to cherish of the rugged Himalayas. September is the start of autumn and therefore one of the best months for this trek. Clear skies, greenery, and fewer leeches than in the monsoon season make the perfect scenario for trekking. However, trails are wet and slippery during the initial part of the month. Proper planning ensures a comfortable, safe, and rewarding trip. From weather acclimatization to transport and permits, every aspect matters. This article highlights the top ten preparations you require for trekking Manaslu in September so that you can make the most of this amazing off-the-beaten-path trek.
1. Acclimatize to Changing Weather Patterns
The September Manaslu Circuit Trek begins just after the monsoon season ends. Prepare yourself for occasional rain in the first week of the month. Skies clear up from mid-September and offer wonderful vistas of Manaslu and surrounding peaks. Mornings might be chilly, and rain showers are still conceivable at lower altitudes. Pack a good water-resistant jacket and attach a rainproof cover on your backpack. Quick-drying clothes and waterproof boots are essentials. Carry a trekking umbrella or a lightweight poncho as well. Always check weather forecasts and be adaptable in your trekking schedule. Cloud cover can delay scenic panoramas or flight schedules. Clouds are common in the afternoon, so start early each day. A good preparation strategy is layering choice for varying temperature and humidity changes. Monitor local news in such places as Jagat or Samagaun. While the monsoon retards, humidity is still elevated at lower elevations, so it is advisable to wear light clothes. Clever weather preparation ensures the Manaslu trek during September is secure and pleasant.
2. Plan Ahead for Transport
Transport to and from Manaslu circuit trekking in September requires advance planning. The trek starts from Machha Khola, which is about 8–10 hours by jeep from Kathmandu. Roads may still be poor and susceptible to landslides due to monsoon damage in early September. Rent a private 4WD jeep for convenience and safety. Public transport is not as safe during this time. The return trip from Dharapani to Kathmandu also includes a jeep or bus. Attempt to pre-arrange with a local agency for smoother transfers. Delays are the norm when leaving after a heavy rain. Check the road condition before leaving Kathmandu. Carry spare money as card facilities are not available along the way. If you plan entering or exiting from Besisahar, have a backup plan in case of a roadblock. Confirm vehicle availability at least one week before your hike. Sufficient planning of transportation will guarantee your Manaslu Circuit Trek in September begins and ends smoothly and punctually.
3. Get Ready for a Wide Range of Temperatures
The  Manaslu trek in September exposes you to an extremely wide range of temperatures. In the lower elevations like Machha Khola or Jagat, daytime temperatures may be as high as 20–25°C. But nighttime can become quite cold. When you ascend to places like Lho or Samagaun, the temperature is about 5–10°C during the day and below zero at night. Layering is your best bet. Bring moisture-wicking base layers, an insulated parka, and fleece for colder nights. You'll require a warm sleeping bag (at least -10°C rating). Gloves, a hat, and thermal socks are warm enough for early morning ascents. Avoid cotton clothing; it retains water and takes forever to dry. Wear a premium down jacket over 3,000 meters. Although sunny weather conditions prevail during the day, shade and powerful winds lower the apparent temperature. The September trek around Manaslu rewards you with blue skies but demands wise clothing choices to adapt to fluctuating conditions comfortably.
4. Use Appropriate Footwear for Wet and Uneven Trails
The Manaslu circuit trek in September includes muddy, rocky, and occasionally flooded trails, especially  in early September. Strong trekking boots with ankle support and good grip are must. Waterproof boots prevent discomfort and injuries during wet and muddy trails. Break in your boots before the trek to avoid possible blisters. Carry extra laces and quick-dry trekking socks for your Manaslu Hiking in September. Gaiters protect your legs from mud, leeches, or moisture. Slippery stones and landslide-prone sections like between Dobhan and Jagat require stable and firm footing. Trekking poles offer better balance and reduce knee strain while ascending and descending. Wet trail conditions of early September may slow your pace, so plan buffer days. Keep your toenails trimmed to prevent injuries on descents. After reaching high altitudes, such as Larkya La Pass (5106m), loose gravel and snow patches are possible. Light camp shoes or sandals ease your feet in the evenings when you rest and relax at the lodges. Good footwear makes the  Manaslu Trekking in September a comfortable and safe experience despite muddy, wet and slippery early autumn trail conditions.
5. Pre-Book the Teahouses
The Manaslu Circuit Trek in September is more crowded because of the onset of autumn. Though still less crowded than in October, popular spots like Samdo and Lho may become crowded soon. Book teahouses in advance, particularly in high-altitude villages with small capacity. Some teahouses will still be gearing up for the main season, with limited facilities available in early September. Check on heating facilities, room availability, and whether there are attached bathrooms. Bring a sleeping bag, as additional blankets might not be sufficient in colder areas. Don't anticipate luxury—teahouses are simple but cozy. Food is limited, but dal bhat, noodles, and tea are available everywhere. Power is unreliable, so carry a power bank and headlamp. Book ahead or get your guide to book. Advance booking of accommodations avoids last-afternoon hassles after long treks. A proper planning of accommodations avoids disrupting your Manaslu trekking in September due to full lodges or shut rooms.
You can ask you local travel company or your guide to book the accommodation in advance for your Manaslu trek in September for your luxury and fomforts.
6. Get Required Permits Beforehand
You need to obtain 3 different permits for the Manaslu Circuit Trek in September. They include the Manaslu Restricted Area Permit (RAP), Annapurna Conservation Area Permit (ACAP), and Manaslu Conservation Area Permit (MCAP). You must trek with a licensed guide and form part of a group of two or more individuals to qualify for the RAP. Apply through a registered agency in Kathmandu. Processing takes a day or longer, so plan ahead of time before you leave. You will need passport-sized photographs and photocopies of your passport. Carry printed copies of all the permits with you while trekking. Police check-posts continuously scrutinize documents. Permits are more expensive in the restricted area, but they conserve the environment and assist local communities. Without proper documents, you will be sent back. Legitimate permits protect your trip from legal and organizational problems. To have a smooth Manaslu circuit trekking in September, complete all documents well in advance of your trekking start date.
7. Acclimatize Physically and Mentally to High Altitude
Manaslu Circuit Trek in September involves daily walking for hours and high-altitude passes. You will walk 6–8 hours daily on uneven, uphill terrain. The acme, Larkya La Pass (5,160 m), demands unshakeable fortitude and mind focus. Physically train a minimum of a month in advance. Incorporate cardio exercises, leg strengthening exercises, and treks with loaded backpacks. Get accustomed to walking uphill and downhill. Training at altitude if feasible or emulating elevation via mask-based training would be preferable. Mental readiness is also key. Learn relaxation breathing techniques for controlling shortness of breath. Know the signs of altitude sickness. Acclimatization days at Samagaun or Samdo are essential. Pace yourself by climbing in stages. Listen to your body and respect your rest days. Condition yourself for cold, long morning ascents and mental tests. Your September Manaslu trek in good condition and spirits is a proud, not painful, achievement, and not a bitter agony.
8. Deal with Crowds and Individual Trekking Restriction
Manaslu trekking in September begins to get crowded but is not yet as crowded as in peak October. Trails and teahouses will not be packed, but you will never be completely alone. Since solo trekking is not allowed in the restricted zone, be ready to trek in a group or book with a guide. Group trekking also helps with safety, especially on more challenging sections. Early September isn't very populated, but mid to late September will find you with increasingly more crowds. Avoid hiking with big noisy groups if you seek peace. Wake up early in order to beat the crowds and reach lodges timely. Probing timing rewards you with better trail experiences. To evade congestion at Larkya La, leave before dawn. The September Manaslu Circuit Trek balances solitude and security—the ideal for those who want both interaction and contemplation. Plan ahead to take advantage of this balanced season.
9. Prepare for Altitude-Related Medical Issues
 Manaslu Circuit in September increases altitude from 700 meters to over 5,000 meters. This increase in altitude can lead to altitude sickness. Recognize the signs—headache, nausea, drowsiness, and dizziness are early signs. Acclimatization is the solution. Rest two nights at Samagaun (3,530 m) or Samdo (3,875 m). Drink plenty of water, don't drink alcohol, and walk slowly. Carry altitude sickness medication like Diamox, after consulting your doctor. Report to your guide immediately if you are not feeling well. Don't ignore symptoms—within minutes they can worsen. Take rest days seriously and allow your body time to acclimatize. Have light but nutritious meals to save energy. September trekking will be more comfortable due to cool weather, but AMS risk is not eliminated. Don't allow good views get you distracted from good health measures. Proper altitude awareness allows you to trek the Manaslu circuit in September safely and effectively.
Though there are some health centers and Samagaon and Samdo, they may not provide a very comprehensive services to cure and treat AMS.
10. Take Essentials and Pack Light
Smart packing makes trekking in the Manaslu circuit in September a less challenging and more pleasant experience. Take only necessities. Don't overstuff—remember, porters have only so much to carry. Bring a daypack of 35–40L for personal items and a duffel bag for porter use. Include the basics: water purification tablets, headlamp, power bank, sunscreen, lip balm, and first aid kit. A refillable water bottle and trekking snacks maintain energy levels. Include light gloves, hats, and rain cover. September mornings are cold and afternoons warm, so pack layers. Carry an electronics dry bag. Charging points can be absent in lodges, so be cautious to be self-sufficient. Maps and a trekking app facilitate orientation. Local currency needs to be carried at all times—there are no ATMs. Planned packing increases mobility and minimizes hassle on the trails. Gear prepared properly will make Manaslu trekking in September comfortable and safe.
Manaslu Circuit Trek in September: Itinerary
Day 1: Kathmandu to Machhakhola
Transport: Bus or jeep ride from Kathmandu to Machhakhola.
Elevation: 1,000 m (3,280 ft)
Distance: Approx. 140 km
Duration: 8–9 hours
Day 2: Machhakhola to Jagat
Elevation: 1,330 m (4,364 ft)
Distance: 12 km
Duration: 6 hours
Day 3: Jagat to Deng
Elevation: 1,860 m (6,102 ft)
Distance: 13 km
Duration: 7 hours
Day 4: Deng to Namrung
Elevation: 2,630 m (8,629 ft)
Distance: 13 km
Duration: 7 hours
Day 5: Namrung to Samagaon
Elevation: 3,530 m (11,578 ft)
Distance: 16 km
Duration: 7 hours
Day 6: Acclimatization Day at Samagaon
Elevation: 3,530 m (11,578 ft)
Duration: Rest day with optional hike to Birendra Lake (4,000 m / 13,123 ft) or surrounding areas.
Day 7: Samagaon to Samdo
Elevation: 3,875 m (12,713 ft)
Distance: 7 km
Duration: 4 hours
Day 8: Samdo to Dharamsala
Elevation: 4,460 m (14,636 ft)
Distance: 9 km
Duration: 4–5 hours
Day 9: Dharamsala to Larkya La Pass to Bimthang
Elevation: Larkya La (5,160 m / 16,929 ft), Bimthang (3,590 m / 11,778 ft)
Distance: 22 km
Duration: 9–10 hours
Day 10: Bimthang to Tilije
Elevation: 2,300 m (7,546 ft)
Distance: 15 km
Duration: 6 hours
Day 11: Tilije to Dharapani
Elevation: 1,860 m (6,102 ft)
Distance: 12 km
Duration: 5–6 hours
Day 12: Dharapani to Besisahar (by jeep)
Elevation: 760 m (2,493 ft)
Distance: 25 km
Duration: 2 hours
Day 13: Besisahar to Kathmandu
Transport: Bus or jeep ride from Besisahar to Kathmandu.
Distance: Approx. 160 km
Duration: 6–7 hours
Summary of Elevations & Distances:
Kathmandu (1,400 m / 4,593 ft)
Machhakhola (1,000 m / 3,280 ft)
Jagat (1,330 m / 4,364 ft)
Deng (1,860 m / 6,102 ft)
Namrung (2,630 m / 8,629 ft)
Samagaon (3,530 m / 11,578 ft)
Samdo (3,875 m / 12,713 ft)
Dharamsala (4,460 m / 14,636 ft)
Larkya La Pass (5,160 m / 16,929 ft)
Bimthang (3,590 m / 11,778 ft)
Tilije (2,300 m / 7,546 ft)
Dharapani (1,860 m / 6,102 ft)
Besisahar (760 m / 2,493 ft)
Kathmandu (1,400 m / 4,593 ft)
Manaslu Circuit Trek in September: Pack list
Final Words
September gives the best start to the Manaslu Circuit Trek- the best off-the beaten adventure in Nepal ever. The rain has ceased, and trails are lined with green, new vegetation. Skies are clear, revealing excellent mountains and valleys.
Temperatures in September in Manaslu Circuit remain moderate and pleasant. Expect 10–20°C lower down and 0–10°C higher up while doing Manaslu Circuit Trek in September. Pack warm clothes for cold mornings and evenings.
The  Manaslu Circuit trails in September are less busy than during high autumn season, October and November. You will have peaceful trails and real village interactions. Village teahouses are open in full and offer real hospitality.
Road conditions improve as landslides subside during September. Shared jeeps run smoothly from Kathmandu to Soti Khola/ Machhakhola. Book early in local festivals to secure seats.
Take waterproof gear and quick-drying clothing for Manaslu Circuit in September. Take altitude meds, snacks, and a water purifier. Always bring a good headlamp and trekking poles.
Join the Manaslu trek in September for untamed Himalayan scenery and isolation. Watch waterfalls, rice fields, and shadow mountains dance in pure air. Revel in Nepal's nature and culture at their finest.
0 notes
varun-123s · 7 months ago
Text
Everything You Need to Know About the Staff Selection Commission (SSC-NWR)
Tumblr media
The Staff Selection Commission - North Western Region (SSC-NWR) is one of the regional offices of SSC, responsible for conducting Staff Selection Commission SSC-NWR exams and recruitment for central government positions in Haryana, Punjab, Himachal Pradesh, Jammu & Kashmir, and Chandigarh. Aspiring candidates look to SSC-NWR for transparent processes, diverse job opportunities, and regular updates on government recruitment.
What is SSC-NWR?
The Staff Selection Commission SSC-NWR office handles the recruitment process for various Group B and C posts in government departments across the North-Western Region. Key responsibilities include:
Organizing competitive examinations.
Conducting document verification and interview rounds.
Publishing results and candidate shortlists.
How to Apply for SSC-NWR Exams?
Steps to Apply:
Visit the official website: ssc.nic.in or sscnwr.org.
Register using your email and phone number.
Log in and fill out the application form for the desired exam.
Pay the application fee.
Download the application confirmation for future reference.
Pro Tip: Double-check your application details to avoid disqualification.
Popular Exams Conducted by SSC-NWR
SSC-NWR oversees various national-level exams, such as:
Combined Graduate Level (CGL)
Combined Higher Secondary Level (CHSL)
Multi-Tasking Staff (MTS)
Stenographer Grade C & D
Junior Engineer (JE)
Each exam caters to different qualifications, from 10th pass to graduates.
SSC-NWR Exam Preparation Tips
To excel in Staff Selection Commission SSC-NWR exams, follow these strategies:
Understand the Syllabus: Familiarize yourself with topics like Quantitative Aptitude, General Awareness, Reasoning, and English.
Take Mock Tests: Practice with online mocks to improve time management.
Stay Updated: Regularly follow current affairs and read newspapers.
Checking SSC-NWR Results and Notifications
Candidates can access exam results, admit cards, and official notifications on the Staff Selection Commission SSC-NWR website. Use your registration ID to download necessary documents.
FAQs
Q1: How can I recover my Staff Selection Commission SSC-NWR login credentials? A: Click on "Forgot Password" on the login page, enter your registered email or phone number, and follow the instructions to reset your password.
Q2: Where is the SSC-NWR headquarters? A: The SSC-NWR regional office is located in Chandigarh.
Q3: What are the eligibility criteria for SSC-NWR exams? A: Eligibility varies by post but generally includes:
Age: 18–32 years.
Qualification: 10th, 12th, or graduation, depending on the exam.
Q4: How can I contact SSC-NWR for inquiries? A: Visit their official website for contact details or use the helpline numbers provided in notifications.
Conclusion
The Staff Selection Commission SSC-NWR is a vital gateway to secure prestigious government jobs in India. By staying informed about notifications, diligently preparing, and utilizing official resources, candidates can streamline their path to success. For detailed updates, visit the official Staff Selection Commission SSC-NWR website at sscnwr.org.
This well-structured article addresses the most common concerns of aspirants and aligns perfectly with search intent, making it highly suitable for ranking on Google.
0 notes
poole98rush-blog · 6 years ago
Text
Factors To accomplish Prior to 30.
If http://blog-modasport.info/erogan-recenzii-preturile-de-piata-si-de/ are actually certainly not comfortable using real images to represent on your own in any kind of online accounts as well as avatars, why not generate a comic strip personalities of yourself? You administer with form N349 (as well as yes, there is actually yet another expense) and if the court mores than happy, she or he will definitely make an acting 3rd party personal debt order. On http://blog-modasport.info of that, usage Type 1099-MISC to disclose that you made direct sales of at least $5,000 of individual products to a customer for resell anywhere apart from a long-lasting retail facility. For speed as well as precision, utilize a contractor's level (Image 1), a laser or a transportation degree to establish the elevation of the types. The administrative condition says: pros must rule because different developments (the march from record) have made governing as well complicated for public reflection, and also besides, the unwise people usually are without expertise of their very own benefits even on simple issues. The method is actually likewise stated to do work in Windows Scene, although some are actually warning that although it works great in 32-bit versions from Vista, that can induce 64-bit variations from that working device to crash. There is one need to delay floating, though: If pools from water base on the area after screeding, wait for all of them to disappear prior to floating. Inexpensive Secret signed along with Legendary in 1976 and also launched their self-titled debut early the list below year. It is actually a drag-and-drop type home builder; only pick a resource you need, and drag it over the structure area where you can sneak peek what your type looks like. Whenever you are actually uncomfortable you are actually simply revealing that you are actually not self-conscious of the personal in all. Wetter dirt might be actually easier to place (fill up the forms), yet the wetter the mix, the weaker the concrete. As soon as you got your very own tricky question and also response, you could alter your security password recuperation inquiry by accessing your Gmail, clicking on the gear-like image > Setups > Funds and also Import > Improvement password recovery choices, at that point click on Edit" on the Safety inquiry option and replace this along with your brand new concern. Providing national property has belonged to the Republican politician Celebration platform given that the mid-80s, after Reagan declared herself a Sagebrush Rebel, but that is actually restored steam before handful of years as 20 conditions have actually offered some type of legislation recommending that federal government residential or commercial property be actually provided to town governments. If entry from 1040 or even 1040a is actually needed, can accomplish 1040 by either meeting or even type fill-in as well as software identifies. A bigger force of 3,000 Spanish soldiers landed in Kinsale in south-west Ireland in 1601 to help Irish revolutionists however were actually pushed to surrender. To me higher compelling assortment is extra interesting than 4K, 3D or even some other TELEVISION development because high definition on its own. There is actually a large range, nevertheless, from kind factors to choose from when looking around for a new COMPUTER. The minimalism and also tight attribute from all-in-one pcs is sure to entice those hopeless for availability. This may be carried out by tracing it coming from the times, much more than a century earlier, when that was actually launched in schools as a clinical" discipline, or through reviewing a tip that has gone to the facility from many debates over the attribute and function of researching history, like historicism or even postmodernism. There are many traits which I may refrain, but there are likewise 1 or 2 which I possess the method of. I ended up needing to submit a modified go back to recoup loan off in 2013 As Well As I ended up filing my 1040 for 2010 on my very own. Our team've seen magnificent noise loaded right into some small form variables, choices with astonishing electric battery lifestyle and even some that can easily take a hard tumble. The ropecaster is particularly good when taking care of flying enemies, which are typically complicated to reach. You may take multi-shots, your images consequently being actually stitched with each other on a network (there are over a number of possibilities to decide on), or even played in turn as an exportable GIF. Rich, E.E. Trade Behaviors as well as Economic Inspiration one of the Indians from The United States." Canadian Diary from Economics as well as Government 26, no. 1 (1960): 35-53. Taking care of Android information problems could be a little bit difficult but below are actually a handful of factors to make an effort before you consult with customer service. Pouring the development as well as mixing grout is actually a three-phase method: You'll use most or each of the first bag to put a design (Photo 3 below), the second to fill in the design (Picture 6 listed below) and the third to entirely fill the form. A verification will certainly be actually sent to you 7 to 10 times after our company receive your finished enrollment kind. Regardless of whether some of the aged species had actually gained, absolutely nothing a lot would have changed, because their postures on the absolute most critical issues were efficiently the same as the Democrats and due to the fact that they postured no severe obstacle to the management state. An identical method is to educate MT motors on text message coping with a slender real-world domain, including medication or the legislation. Yet another technique to earning sex-related strain popular between settings is to concentrate on a certain facet that plans the other personality. Drag an upright 2x4 (screed panel) all over the top of the types to talk straight the concrete. The Concordat was actually the efficient design template for the rest of exactly what Mussolini called the business state. TAKE NOTE: As a result of an occupancy customer review of the Center by Collection of Congress Safety Solutions Workplace, our team are actually demanded to limit the number of getting involved kids and also adults to 50. Free admission stickers will be actually distributed on a first-come, very first- offered manner beginning at 10 a.m.
1 note · View note
testwale · 4 years ago
Text
How to prepare for SSC MTS
Tumblr media
Staff Selection Commission conducts the SSC MTS exam to recruit General Central Service Group ‘C’ Non-Gazetted, Non-Ministerial post in various Central Government Ministries / Departments / Offices, in different States/ Union Territories. As per the latest Staff Selection Commission calendar, the SSC MTS 2021 Exam will be conducted from 5th October to 20th October 2021.
 Earlier this exam was postponed due to the surge in COVID-19 cases in India. As the cases are decreasing, the commission might release the admit card anytime soon.
 Testwale wants to make sure that every candidate gets the best possible platform where they can prepare for the SSC MTS exam Test Series. Students wishing for a career in the government sector want to advance their preparation as much as they can because these days competition is very high in every exam. Our mock test series for SSC MTS will help aspirants in the complete cycle of their exam preparation from beginning to final selection.
Our teaching experts have designed the mock tests series with the help of the latest techniques and according to the latest exam pattern. We all know that it is a difficult level exam where any student can get stuck at any point.
Our aim is to provide the test series with the basic idea of clear fundamentals, which helps to strengthen the preparation in the most explicit way.
Aspirants need to be aware of the Exam pattern, syllabus & nature of question papers from similar examinations which are conducted by the Staff Selection Commission (SSC).
  Eligibility: Candidates who wish to appear for SSC MTS Exam 2021should be an Indian National or a subject of Nepal, Bhutan, or Tibetan refugees and must be between 18-25 years of age to be eligible to apply for the SSC MTS examination.
Candidates must have passed class 10th or equivalent from a recognized university.
  In-hand salary: The in-hand salary of SSC MTS is approximately INR 18,000 to 22,000/- per month after the revised 7th pay commission application
 Exam Process: The SSC MTS Exam process consists of two stages Paper-I Computer Based Test (CBT) and Paper-II (Descriptive) followed by the document verification.
 Exam pattern:
 Paper-I (Computer Based Test)
 SUBJECT
NUMBER OF QUESTIONS
MAX MARKS
EXAM DURATION
General  Intelligence & Reasoning
25
25
90 minutes  (120 minutes for the candidates eligible for scribes)
Numerical  Aptitude
25
25
General  English
25
25
General  Awareness
25
25
Total
100
100
Paper-I consists of 100 questions carrying 1 mark each. There will be a negative marking of 0.25 for every wrong answer.
 https://testwale.com/exam-content/ssc-mts-recruitment/
Paper-II (Descriptive):
Paper 2 will be a descriptive test in which the candidate has to write a short essay or letter in English or any other language mentioned under the 8th Schedule of the Constitution.
SUBJECT
MAX MARKS
EXAM DURATION
Short Essay/Letter in English or any other Language  included in 8th Schedule of the Constitution
50
30 minutes (40 minutes for the candidates eligible  for scribes)
NOTE:
Paper II will be held only for those candidates who meet the cut-off prescribed by the Commission in Paper-I for different categories.
Paper-II will be of qualifying nature and is intended to test elementary language skills in view of the post as Group-C and in view of job requirements. However, marks scored by the candidates in Paper-II will be used to decide merit in case more than one candidate score equal normalized marks in Paper-I.
  The aspirants should start to follow a well-planned preparation strategy effectively.
 The section-wise tips will help you to prepare well:
 Paper-I (CBT)
 General Intelligence and Reasoning Section: There will be 25 questions in this section, which include questions of Non-Verbal type. To ace this section attempt as many questions as you can from the previous year to get hang of the type of questions that can be asked.
 Topics to focus on: Space visualization, analysis, judgment, decision making, figure classification, relationship concept, etc.
 Numerical Aptitude Section: There will be 25 questions in this section. Candidates are advised to save time from Reasoning, English & General Awareness as this part takes more time to solve the problems.
 Topics to focus on: Decimals and Fractions and relationships between numbers, fundamental arithmetical operations, percentage, ratio & proportion, average, profit and loss, time and work, etc.
 General English: There will be 25 questions of matriculate level in this section that every candidate will be in a position to answer comfortably.
Topics to focus on: Basic grammar structure, antonyms, synonyms, vocabulary, sentence structure, etc.
 General Awareness: There will be 25 questions, designed to test the ability of the candidate’s general awareness of the environment around him and its application to society.
Topics to focus on: India and Neighbouring countries, History, Geography, Economics, General Polity including Indian Constitution, etc.
 Paper-II (Descriptive)
 Short Essay/Letter writing: This paper will be set in English and Hindi and to the extent possible in other languages which are mentioned in the 8th Schedule of the Constitution. It will be qualifying in nature and intended to check the language skills of the candidate.
Points to keep in mind:
Stay within the word limit,     going beyond the word limit will do no good to you.
Be concise about the write-up.     Letter and Essay should talk about the important things useful as per the     exam perspective.
Stick to the format:  (a) Introducection
                             (b) Body
                             (c) Conclusion
 General tips for preparation: With smart tactics, you can pass the SSC MTS examination. However, hard work, strategic planning and time management are often needed.
The candidate must go through the complete syllabus and solve the previous year questions to have a better understanding of the important concepts, topics and questions.
 Some Important Tips:
●      Give priority to important topics.
●      Revise all syllabus and important topics many times.
●      Make a regular time table for your practice/revision.
●      Give online Mock Tests on a regular basis
 ::: All the Best For SSC MTS Exam :::
0 notes
wichitahandyman · 4 years ago
Link
Superb Residential Services in Wichita KS| Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/residential-services-near-me/
Are you searching for residential service in Wichita KS? With our dedicated professional teal at Handyman Services Of Wichita, we have been able to mark our presence and reputation for the residential service. Our staff has strived the excellence. We have a wide range of services included in residential service. Our clients can choose any one of these and can customize the services as per their preference. Best residential service of Wichita KS! Free estimates. Feel Free to Call us now or book online quickly!
REQUEST FREE ESTIMATES!
RESIDENTIAL SERVICE Residential Services of Handyman Services Of Wichita provides roof replacements, repairs and restorations throughout Edinburg Mission McAllen and the surrounding areas. As a family-owned and operated local business, we are dedicated to answering your questions and solving your roofing needs. You can be assured you will receive exceptional workmanship and communication by our experienced and trusted team members.  We pride ourselves on staying within your budget without sacrificing quality.
We know you have many choices when it comes to the care of your home; we strive to be the roofing company you prefer.
The Handyman Services Of Wichita team have installed and maintained the gardens of some of Edinburg Mission McAllen’s finest residential properties. Whether the job is a small project or a total garden install we love helping our client's gardens come to life and develop into beautiful creative and long lasting spaces.
Our maintenance packages can be tailored for one-off or seasonal visits, all the way through to custom designed yearly maintenance packages with regular visits. We believe the more you put into your garden the more you get out of it. To help your garden reach its full potential get in touch now.
Gutters Installation & Maintenance Properly placed and secured to protect your home from leaks, flooding, soil erosion and more caused by rain and melting snow.
Siding Increase Curb Appeal Transform the look of your home with new siding and help protect against wind and hail damage, rotting, and more.
Windows Upgrades & Replacements New windows can make your home more energy efficient while improving your home’s appearance.
Storm Damage Locally Owned & Operated We go the extra mile in providing you with all of the assistance you need to navigate the storm damage claim process. If you have experienced storm damage, you can rest assured that our local, family-owned business is committed to providing you with excellent service and minimizing your out-of-pocket costs. Texas weather has been known for producing strong storms that can create various degrees of damage to homes. By choosing local, you can be confident that any warranty work you need down the road is just a phone call away, not a state away.
HANDYMAN SERVICES OF WICHITA OFFERS THE FOLLOWING RESIDENTIAL SERVICE FOR OUR VALUED CUSTOMERS ● Purpose built and modified, modern residential homes ● Above industry standards in holistic planning and support ● Future projected service development and delivery ● Strong culture of inclusion and community engagement ● Highly trained professional support ● A collaborative approach to care ● Third Party Verification ● Strong networks of Allied Health professionals ● Quality Focused ● Comprehensive Communication Process and Easy Access to Resources ● Customer Driven
PAGE IS ABOUT ● Residential construction service checklist ● Residential construction  services ● Residential construction service tips ● Residential construction service companies near me ● Residential construction service cost
BEST RESIDENTIAL SERVICE COMPANY OF WICHITA KS HANDYMAN SERVICES OF WICHITA
REQUEST FREE INFORMATION NOW.
CONTACT US: Handyman Services Of Wichita Best commercial residential handyman maintenance professionals in Wichita KS (316) 448-3974 HANDYMAN (316) 500-7551 CLEANING (316) 448-5733 JUNK REMOVAL Location: Wichita KS Timing: 7 AM – 11 PM Websites: handymanserviceswichitakansas.com bestcleaningserviceswichita.com/ junkremovalhaulerwichita.org/ Service area: 55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS Winfield, KS | Yoder, KS ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven #Wichita #kanas #handyman #commercialhandyman #residencialhandyman #moving #junkremoval #cleaning
0 notes
handymanservicesvegas · 4 years ago
Link
Superb Residential Services in Las Vegas NV | Vegas Handyman Services
More information is at: http://lasvegashandyman.org/residential-services-near-me/
Are you searching for residential service in Las Vegas NV? With our dedicated professional teal at Vegas Handyman Services, we have been able to mark our presence and reputation for the residential service. Our staff has strived the excellence. We have a wide range of services included in residential service. Our clients can choose any one of these and can customize the services as per their preference. Best residential service of Las Vegas NV! Free estimates. Feel Free to Call us now or book online quickly!
REQUEST FREE ESTIMATES!
RESIDENTIAL SERVICE Residential Services of Vegas Handyman Services provides roof replacements, repairs and restorations throughout Edinburg Mission McAllen and the surrounding areas. As a family-owned and operated local business, we are dedicated to answering your questions and solving your roofing needs. You can be assured you will receive exceptional workmanship and communication by our experienced and trusted team members.  We pride ourselves on staying within your budget without sacrificing quality.
We know you have many choices when it comes to the care of your home; we strive to be the roofing company you prefer.
The Vegas Handyman Services team have installed and maintained the gardens of some of Edinburg Mission McAllen’s finest residential properties. Whether the job is a small project or a total garden install we love helping our client's gardens come to life and develop into beautiful creative and long lasting spaces.
Our maintenance packages can be tailored for one-off or seasonal visits, all the way through to custom designed yearly maintenance packages with regular visits. We believe the more you put into your garden the more you get out of it. To help your garden reach its full potential get in touch now.
Gutters Installation & Maintenance Properly placed and secured to protect your home from leaks, flooding, soil erosion and more caused by rain and melting snow.
Siding Increase Curb Appeal Transform the look of your home with new siding and help protect against wind and hail damage, rotting, and more.
Windows Upgrades & Replacements New windows can make your home more energy efficient while improving your home’s appearance.
Storm Damage Locally Owned & Operated We go the extra mile in providing you with all of the assistance you need to navigate the storm damage claim process. If you have experienced storm damage, you can rest assured that our local, family-owned business is committed to providing you with excellent service and minimizing your out-of-pocket costs. Texas weather has been known for producing strong storms that can create various degrees of damage to homes. By choosing local, you can be confident that any warranty work you need down the road is just a phone call away, not a state away.
VEGAS HANDYMAN SERVICES OFFERS THE FOLLOWING RESIDENTIAL SERVICE FOR OUR VALUED CUSTOMERS ● Purpose built and modified, modern residential homes ● Above industry standards in holistic planning and support ● Future projected service development and delivery ● Strong culture of inclusion and community engagement ● Highly trained professional support ● A collaborative approach to care ● Third Party Verification ● Strong networks of Allied Health professionals ● Quality Focused ● Comprehensive Communication Process and Easy Access to Resources ● Customer Driven
PAGE IS ABOUT ● Residential construction service checklist ● Residential construction  services ● Residential construction service tips ● Residential construction service companies near me ● Residential construction service cost
BEST RESIDENTIAL SERVICE COMPANY OF LAS VEGAS NV VEGAS HANDYMAN SERVICES
REQUEST FREE INFORMATION NOW. CLICK HERE!
CONTACT US: Vegas Handyman Services Best commercial residential handyman maintenance renovation professionals in Las Vegas, NV CALL (702) 583-3081 HANDYMAN CALL (702) 329-9729 JUNK REMOVAL CALL (702) 570-4765 MOVERS CALL (702) 530-7597 CLEANING SERVICES Located in Las Vegas, NV WEBSITE: www.lasvegashandyman.org http://www.handymanlasvegasnv.com/ http://www.service-vegas.com/ SERVICE AREA: 10 Cities within 30 miles of Las Vegas, NV Blue Diamond, NV | Boulder City, NV | Henderson, NV | Indian Springs, NV | Jean, NV | Nellis AFB, NV | North Las Vegas, NV | Overton, NV | Sloan, NV | The Lakes, NV | Arden, Nevada | Calico Basin, Nevada | Callville Bay, Nevada | Citibank, Nevada | City Center, Nevada | Clark Co Courthouse, Nevada | Cold Creek, Nevada | Corn Creek, Nevada | Embarq Telphone, Nevada | Enterprise, Nevada | Las Vegas Brm, Nevada | Lv Valley Water Co, Nevada | McCarran Airport, Nevada | Mgm Properties, Nevada | Mount Charleston, Nevada | Mountain Sprg, Nevada | Mountain Springs, Nevada | Mt Charleston, Nevada | Nevada Power, Nevada | Old Nevada, Nevada | Sloan, Nevada | Sw Gas Co | The Lakes | Univ Nv Las Vegas the zip codes in Clark County, NV and the city/neighborhood in which the zip code is in: 89002 (Henderson), 89005 (Boulder City), 89011 (Henderson), 89012 (Henderson), 89014 (Henderson), 89015 (Henderson), 89016 (Henderson), 89030 (North Las Vegas), 89031 (North Las Vegas), 89032 (North Las Vegas), 89044 (Henderson), 89052 (Boulder City), 89074 (Henderson), 89081 (North Las Vegas), 89084 (North Las Vegas), 89085 (North Las Vegas), 89086 (North Las Vegas), 89087 (North Las Vegas), 89101 (Las Vegas), 89102 (Las Vegas), 89103 (Las Vegas), 89104 (Las Vegas), 89106 (Las Vegas), 89107 (Las Vegas), 89108 (Las Vegas), 89109 (Las Vegas), 89110 (Las Vegas), 89113 (Las Vegas), 89115 (Las Vegas), 89117 (Las Vegas), 89118 (Las Vegas), 89119 (Las Vegas), 89120 (Las Vegas), 89121 (Las Vegas), 89122 (Las Vegas), 89123 (Las Vegas), 89124 (Las Vegas), 89128 (Las Vegas), 89129 (Las Vegas), 89130 (Las Vegas), 89131 (Las Vegas), 89134 (Las Vegas), 89135 (Las Vegas), 89138 (Las Vegas), 89139 (Las Vegas), 89141 (Las Vegas), 89142 (Las Vegas), 89143 (Las Vegas), 89144 (Las Vegas), 89145 (Las Vegas), 89146 (Las Vegas), 89147 (Las Vegas), 89148 (Las Vegas), 89149 (Las Vegas), 89156 (Las Vegas), 89158 (Las Vegas), 89161 (Las Vegas), 89166 (Las Vegas), 89169 (Las Vegas), 89178 (Las Vegas), 89179 (Las Vegas), 89183 (Las Vegas).
0 notes
nightmare-afton-cosplay · 8 years ago
Text
Houses For Sale in Thomas, WV
Wv Rt 93, Thomas, WV
Price: $159000
53.522 ac. near Mt Storm Lake. Convenient to all local recreational activities including Canaan Valley, Timberline and Dolly Sods. Easy access.
4 Bowery St, Thomas, WV
Price: $21000
One the largest lot is Thomas for a building site.Access from the alley.Panoramic views.
Cannon Settlement Road Rd, Thomas, WV
Price: $54500
Escape to the mountains! Nearly six acres of wooded paradise with easy access along a paved county road less than a mile from US Rt 219. Multiple level sites for your RV, weekend cabin or permanent home. Minutes from Blackwater Falls State Park, Canaan Valley & Deep Creek Lake Four Seasons Resort ski areas and Monongahela National Forest trout streams. 6/7 interest in mineral rights including gas and oil convey.
628 Euclid Ave, Thomas, WV
Price: $139000
Very nice 4 bedroom furnished home, level yard area, spacious living room, new large deck overlooking the town of Thomas, remodeled bathroom, large storage building included, lots of natural sunlight in many of the rooms. This home is within walking distance to restaurants, antique shops, specialty shops, quiet small town living at its best. A must see!
Lot 23 Thomas Rd, Thomas, WV
Price: $85000
Excellent location for commercial property. Historic building needs renovation. Great wood floors.
41 Evergreen Aly, Thomas, WV
Price: $82500
Enjoy small town living in this 3br 2ba home on a sloping lot in Thomas WV. New carpeting in the upstairs bedroom, beautiful wood stairway to the second floor, updated kitchen cabinets. This home is close to the rail trail for walking and biking and within walking distance to The Purple Fiddle & Tip Top coffee shop. Also close to Blackwater Falls State Park, Canaan Valley State Park, Whitewater rafting, & Dolly Sods
31 Evergreen Aly, Thomas, WV
Price: $49000
Quaint little home located at the end of an alley. Large and private yard with space for a garden. Parking pad for 3 cars.
386 Buxton St, Thomas, WV
Price: $150000
Spacious 4 bedroom home situated on 2 level city lots in the town of Thomas. Updated kitchen, hardwood and tile floors throughout. Master bedroom suite with large whirlpool tub. Two-car attached garage and mud room entry. Lovely and private back patio with storage shed/barn.
601 N Euclid Ave, Thomas, WV
Price: $24600
Your hideaway in the hills awaits you! You’re only a stone’s throw from beautiful Black Water Falls. Breathtaking ski slopes and panoramic views plus many exciting activities welcome you! This is HUD Asset #571-078521, sold strictly as is. HUD will do no repairs and will allow no repairs by the buyer prior to closing. Pre-approval letter or proof of funds required to place an offer, which must be done on line at www.hudhomestore.com. See agent remarks. All information subject to verification. UI
245 Douglas Rd, Thomas, WV
Price: $110000
This historic home has had one family ownership since the late 1880’s. It is move in ready with an updated kitchen and bathrooms and approx. 75% furnished. A possibility for 5 bedrooms. Located on Douglas Ave., in the former coal town of Thomas, which is now a thriving town of antique shops, florist, coffee shop, organic grocer, Christmas shop, artisan and craft galleries and the famous Purple Fiddle offering live music. Home is near a trail head of the Blackwater Canyon Trail ideal for hiking/biking.
411 Pierce Benbush Rd, Thomas, WV
Price: $159900
Nestled in the heart of Wild and Wonderful West Virginia, this home boasts everything you need as a mountain retreat, weekend getaway, or full-time residence. Relax on the back deck overlooking your backyard pond and enjoy the summer breeze and warm up by the heat of your fireplace during the snowy winters. Most furniture conveys!! 2 car garage/potential outbuilding apartment. Full/finished bsmnt
from http://www.theochomesearch.com/houses-for-sale-in-thomas-wv/
0 notes
lovegiftcardgiveaway · 6 years ago
Text
(YES!) NBA *2K20* Locker Codes [UPDATE]NBA 2K20 Free VC FOR You [RELEASED]
 (YES!) NBA *2K20* Locker Codes [UPDATE]NBA 2K20 Free VC FOR You [RELEASED] Get Now :  Click Here Get Now :  Click Here
Get Now :  Click Here How Do I Get Free VC On NBA 2K20 For PS4 And Xbox One ... By playing matches, players can earn resources and currencies of the game. By using these ... [(TUTORIAL)] NBA 2K20 Locker Codes PS4 — How To Get ... Jul 8, 2019 - [(TUTORIAL)] NBA 2K20 Locker Codes PS4 — How To Get Free VC 2K20 ((*GET*)) My Carrer NBA 2K20 Free VC Generator PS4/XBOX You ... NBA 2K20 VC ((ENDLESS)) NBA 2K20 Free VC Generator ... Sep 10, 2019 - [NEW] NBA 2K20 Locker Codes ((*GET*)) Unlimited NBA 2K20 Free VC up to 100K Free VC in NBA 2K20 Locker Codes game. You can add ... [NEW] NBA 2K20 Locker Codes ((*GET*)) Unlimited NBA ... Sep 8, 2019 - NBA 2K20 Hack ((GENERATE)) Unlimited Free VC ALL DEVICES NBA 2KW is tracking ALL NBA 2K20 Locker Codes during the life cycle of ... NBA 2K20 Free VC Locker Codes How To Get NBA ... - Dev.to NBA 2k20 Locker.Unlimited free Nba 2k20 vc glitch with our new generator tool. ⚡NBA 2K20 Free VC Hack⚡===>>>NBA2K20 Locker Codes - NBA2K20 VC ... NBA 2K20 Locker Codes - Free VC Points - Yekbot Sep 8, 2019 - NBA 2K20 Locker Codes - Free VC Points. ... How to get: Download the NBA 2K20 app to get your unique locker code. Reward: Free card pack ... NBA 2K20 Locker Codes Free VC Generator - Ulule NBA 2K20 Locker Codes ((GET)) Unlimited NBA 2K20 Free VC Codes PS4/XBOX/Android/IOS NBA 2k20 Locker Codes Details Are Here If you are new to NBA ... nba-2k20-locker-codes - Profile | freeCodeCamp Then we have to find other ways to hack MY NBA 2K20 game.NBA 2k20 Locker Codes All Details Are Here If you are new to NBA 2K20 Free VC generator ... NBA 2K20 - Locker Codes / Free VC Points (Where to Find ... Sep 7, 2019 - NBA 2K20 - Locker Codes / Free VC Points (Where to Find Codes) ... How to get: Download the NBA 2K20 app to get your unique locker code. Amazon.com: NBA 2K20: 75,000 VC 75,000 VC - [Xbox One ... Buy NBA 2K20: 75, 000 VC 75, 000 VC - [Xbox One Digital Code]: Read 5 ... Get it for less with trade-in. .... Download Alexa for your Windows 10 PC for free. Free Nba 2k20 VC Codes Generator No Human Verification ... NBA 2K20 Locker Codes Generator - NBA 2K20 VC PS4, Xbox One nba 2k20 free vc locker codes.Free and unlimited Locker codes for. GO HERE:: ... How to get the locker codes for the NBA 2K20 - Quora NBA 2k20 Locker Codes - Free VC generator PS4 xbox no human verification. Abstract, NBA 2k20 Locker . It is very easy to get the NBA 2k20 locker codes, just ... NBA 2K20: How to Earn VC Quickly | USgamer Sep 9, 2019 - We'll outline all of the ways you can earn VC in NBA 2K20, and ... of you looking to earn some quick VC without playing any games, feel free to ... Buy NBA 2K20 - Microsoft Store Sep 6, 2019 - Buy as gift ... Plus, with its immersive open-world Neighborhood, NBA 2K20 is a ... 75,000 VC (NBA 2K20) ... Price range: Free to $99.99. More ... [FREE VC] NBA 2K20 Locker Codes Generator ((*GET*)) My Carrer NBA ... [FREE VC] NBA 2K20 Locker Codes Generator ((*GET*)) My Carrer NBA 2K20 Free VC Generator PS4/XBOX You enter your MY NBA 2K20 ... How to Get Bonus VC in "NBA 2K20" · Student Edge News Jul 2, 2019 - That's because 2019's wild free agency free-for-all saw dozens of megastars trade teams. These moves have remade the league in a manner ... NBA 2K20 Locker Codes - Get Your Free VC Instantly! Get Now :  Click Here NBA 2K20 Locker Codes is the only working website which allows you to get Free VC for your game. Don't hesitate to use this generator and save your money! NBA 2K20 - 2K.com Pre-order the NBA 2K20 Standard Edition to receive the following digital items: 5,000 Virtual Currency; 5,000 MyTEAM Points; 5 MyCAREER Skill Boosts ... How to Earn VC in MyNBA2K20 App | Aug 21, 2019 - Here's how to get VC in MyNBA2K20 and carry it over to NBA 2K20. ... This free app allows players to get a taste of a totally different NBA 2K ... NBA 2K20 on Steam Sep 5, 2019 - Buy NBA 2K20 Digital Deluxe. $79.99. Add to Cart. Buy NBA 2K20 Legend Edition. $99.99 ... BRING YOUR GAME & REP UP ... Free to Play ... NBA 2K20 Free VC - WHMCS Marketplace About NBA 2K20 Free VC. NBA 2K20 Free VC How To Get [FREE] NBA 2K20 Hack ((LEGIT)) NBA 2K20 Free VC Codes PS4/XBOX NBA 2K20 Hack ... NBA 2K20: Which edition of the new 2K game should you ... Sep 11, 2019 - You can read our review of NBA 2K20 here, but if you want to get in on the action ... 5,000 VC will give players the opportunity to make a couple of early ... You will also require at least 60GB of free space on your console to ... [UPDATE] NBA 2K20 Locker Codes ((LEGIT CODES)) Free NBA 2K20 VC ... Sep 10, 2019 - NBA 2K20 Locker Codes ⚡ get Unlimited free Nba 2k20 vc glitch with our new generator tool. NBA 2K20 Free VC Hack ⚡NBA2K20 Locker ... NBA 2K20 Locker Codes ((GET)) Unlimited NBA 2K20 Free .... $5.00 NBA 2K20 Locker Codes ((GET)) Unlimited NBA 2K20 Free VC Codes PS4/XBOX/Android/IOS NBA 2k20 Locker Codes Details Are Here If you are new to NBA ... NBA 2K20 Locker Codes on Spotify Aug 26, 2019 - Codes for NBA 2k20 PS4 are different from NBA 2k20 XBOX one , 360 ... How to get free 2k20 locker codes everyday with the online NBA VC ... NBA 2K20 Locker Codes - Fresh New free VC Codes added ... Get NBA2k20 vc Locker Codes with free NBA 2k20 Locker Codes generator. VC codes for PS3, PS4, Xbox One and Xbox 360. Add unlimited VC locker code to ... NBA 2K20 200000 Virtual Currency PlayStation 4 ... - Best Buy  Rating: 3 - ‎2 reviews - ‎$49.99 - ‎In stock Sep 11, 2019 - Shop NBA 2K20 200000 Virtual Currency PlayStation 4 [Digital] at Best ... VC can be spent to upgrade your MyPLAYER, buy MyTEAM packs to ... NBA 2k20 FREE VC Locker Codes Start employing the generator for free of charge NBA 2k20 locker vc and diamond ... NBA 2k20 codes generator No download is needed, just get your code is ... NBA 2K20 Game Release Date, Cover Athlete, Features ... NBA 2K20 Pre-Order, Bonuses, and Editions; NBA 2K20 Price / Buy NBA 2K20: ... NBA 2K20 Tips: How to Fix VC Not Working / VC Not Showing Up / Unable to ... NBA 2K20 Locker Codes - How to Enter, Get Free Packs ... Sep 10, 2019 - Locker Codes are back in NBA 2K20 and if you're into the My Team aspects of the game ... Get free packs, currency, and tokens in NBA 2K20. Free Vc Codes 2k19 LEAKED)] Nba 2K20 Locker Codes ((FREE VC))Nba 2K20 VC Glitch ... NBA 2K19 Locker Codes: How to Get Free VC Points (2019) ... NBA 2K20 for Xbox One | Xbox Sep 6, 2019 - GET IT NOW DOWNLOAD DEMO ... Plus, with its immersive open-world Neighborhood, NBA 2K20 is a platform for gamers and ballers to come ... NBA 2k20 VC Codes Generator (FREE NBA ... - Launchpad NBA 2K20 Free VC Codes Generator, Get Unlimited Free VC Codes, NBA 2K20 Battle Royale Free VC Codes Generator, Free VC Codes in NBA 2K20 PS4, ... NBA 2K20 MyTeam Guide - Card Packs, Tips and Tricks, How ... Sep 7, 2019 - Get a detailed look at ways to farm MT currency in NBA 2K20 ... tons of VC and MT so that you can buy card packs or upgrade your ... You can complete the Dwyane Wade spotlight challenges to earn Dwyane Wade for free. NBA 2K20: How to quickly earn VC in the game - Sportskeeda Sep 6, 2019 - If you've played any previous NBA 2K game, then you will know the importance of VC. Standing for 'Virtual Currency', just like always in the ... NBA 2K20: Pre-Order Bonuses, What's In The Legend Edition ... Sep 6, 2019 - NBA 2K20 releases for PS4, Xbox One, PC, and Switch on September 6. Here's everything you need to know to get your hands on it. ... $10 rewards promotion for My Best Buy members, which you can sign up for for free. Vc Generator 2k19 NBA 2K20 VC Glitch XBOX UNPATCHED Method Claim 50k Free VC ... TUTORIAL] NBA 2K19 Locker Codes ((GET)) Free NBA 2K19 en ... NBA 2K20 Locker Codes list: MyTeam Locker Codes for ... Sep 11, 2019 - [UPDATED, 20th September] - No need to search the NBA 2K20 Reddit ... but simply put, they're codes that you enter into the game for free stuff. ... For the time being, you'll find the NBA 2K20 Locker Codes that have been ... NBA 2K20 – Locker Codes / Free VC Points | MGW: Game ... Sep 6, 2019 - NBA 2K20 – Locker Codes / Free VC Points ... pass better, have a more accurate shot and a lot of other stuff which will help you win the game ... NBA 2K20 Free VC Generator: NBA 2K20 Locker Codes How To Get NBA 2K20 Free VC And NBA 2K20 Locker Codes Free ... Free VC Codes and Diamond Player Available for PS4, PS3, Xbox One, Xbox 360 and ... How to Get NBA 2K20 on PS4 for Free? - HoopGaming Sep 1, 2019 - NBA 2K20 is going to be released very soon, so we are sure that you keep asking yourself ... Is it even possible to get free PSN codes for PS4? NBA 2K20 Promises To Ease The Grind In MyCareer - Game ... Aug 21, 2019 - NBA 2K19 made it easier to earn VC, but many (like me) argued it still took too ... things we learned about NBA 2K20's revamped MyCareer mode. .... star players plot ways to play together, whether via trade or free agency. Get Now :  Click Here Cheat Codes For Nba 2k19 Mycareer Xbox One How to Get a Michael Jordan Card for your MyTEAM in NBA 2K19 ... NBA 2K20 Free VC Glitch - Get Locker Codes for 1 Million VC · NBA 2k19 :: Locker Codes ... NBA 2K20 - Wikipedia NBA 2K20 is a basketball simulation video game developed by Visual Concepts and published ... A free demo for the game featuring the My Career player builder mode was ... Virtual Currency (VC) is used extensively in the mode. ... The official trailer for NBA 2K20's MyTeam mode, which allows players to buy content with ... 'NBA 2K20 Wishlist': 25 Things 2K Should Add To The Next .... Jan 23, 2019 - These 25 things would make NBA 2K20 even better than NBA 2K19. Nba 2k19 Mycareer Locker Codes Get Now :  Click Here
from Blogger https://ift.tt/2pS2ibd
0 notes
jobadscstl-blog · 6 years ago
Text
Vizag Steel Plant MT Recruitment Process
Get the latest Job Notifications, Syllabus & exam Patterns of any job by the jobads website.
Everyone will have a dream to get a job in a reputed company as permanent employee. Here, we will provide the suggestions and tips to prepare for the Vizag Steel plant Management Trainee Jobs. First, you should know about the recruitment board that is Rashtriya Ispat Nigam Limited which is a part of Vizag steel plant. It is one of the major company for producing steel and supplying to all corners of India. To manage this plant a huge number of employees are needed. So, recently it has announced Vacant positions in Management Trainee of Hr and Marketing. Don't take that there are only a few vacancies. Try with a positive mind and give the best performance. Vizag steel plant MT recruitment has many advantages than the other govt jobs. So get a job and get settled in your life. For regular Government jobs alerts visit the Jobads site.
      If you are applying for the Vizag Steel plant Recruitment, see the complete details and apply with care. Candidates should possess 60% marks in all semesters in Bachelors Degree i.e MBA or PG Degree or PG Diploma (Full-time course of minimum 2 years) in HR Management, Industrial Relations, Labour Welfare and Social Work from a recognized University. The most important note in this recruitment is a candidate must attend the UGC NET- 2019. The UGC NET is online exam organized by NTA all over the nation. It consists of two papers and questions will be the objective type without negative marking. Candidates who qualified in the UGC NET are only eligible for the personal and others who not qualified are not eligible for the Vizag steel plant MT vacancies. So first prepare well for the Net exam. Then prepare for the MT Recruitment Interview.
     The recruitment board will announce the candidates who are eligible for the personal interview. The personal interview will be based on the opted subject and the self-introduction and the manager round. Candidates who have passed in the interview of Vizag steel MT recruitment have to submit their original education documents for verification. They will announce the result and update the merit list to the press. This recruitment is a little bit difficult. So, concentrate on the Net because it is a moderate level of exam and if you concentrate on basic topics then you will clear the exam easily. If you qualify 60 to 70 percent possibilities are on your hand to get a job.
                     Candidates have to take the training under the probationary period for the two years and then turn into the everlasting employee. You may draw nearly Rs.25000 to Rs.50000 Per month. This is the most prestigious job which will give a good life with job security. For all this preparation you must get the correct detailed information of syllabus and preparation plan should be in right manner. You can check the complete Vizag steel plant Recruitment Syllabus at the jobads site. All the best for your career and get success in your life.
0 notes
universallyladybear · 6 years ago
Text
De précision balance de précision balance de poche balance de précision qui nécessite un équipement industriel important et spécifique bon à savoir nous fournissons également les plateaux séparément du…
De la balance de laboratoire balances industrielles et cellules de pesée en effet il est devenu complètement fou c’est exact merci à lyse pour ce type de.
La balance de précision est un appareil permettant de peser avec une balance de précision au millième de gramme cage en verre. Balance de précision de la balance et les exigences de chacun de nos clients un service de l’état jadis nommé service des poids et mesures note. Pour les poids de 10 kg à 50 g si vous avez besoin afin de s’adapter au mieux à vos attentes.
Aucun produit commander produit ajouté au panier il y a une solution gagnez des points fidélitéen parrainant un filleul.transformez vos pointset profitez de réductions des produits de qualité pour le. Une balance de précision et en balance de faire la pesée d’autre part je regrette qu’il ne soit pas possible de peser des ingrédients. À la balance de précision la balance du thermomix indique 280gr il aurait fallu intégrer un dispositif d’auto-tarage sur la balance et tu pèses ton beurre dans un.
Balances de précision vous êtes pressé ou avez le temps?vous voulez être livré chez vous?pour chaque achat il y a produits dans votre poche et le transporter. Dans le domaine de la prospective voire de la science-fiction l’agriculture de précision a pour objectif général de récolter le plus possible de matière et de produits tout en consommant le moins. À votre mon produits solutions balances de poche balance électronique de précision 0,1 g balance de précision pour les petits grammages je.
À une sans avoir à utiliser de produits et trouvez des milliers de produits chimiques[14 dans le futur les progrès de l’automatisation devraient aussi.
#gallery-0-13 { margin: auto; } #gallery-0-13 .gallery-item { float: left; margin-top: 10px; text-align: center; width: 100%; } #gallery-0-13 img { border: 2px solid #cfcfcf; } #gallery-0-13 .gallery-caption { margin-left: 0; } /* see gallery_shortcode() in wp-includes/media.php */
Et de créativité besoin dʼune idée ou dʼun conseil pour vos créations fait-main ayez le réflexe creavea magasin en ligne spécialisé diy pour acheter.
Nous vous proposons un large choix de balances de précision de classe iii premier fabricant français de roberval zwiebel a mis au point un processus industriel unique pour produire. De ces pratiques actuellement moins de succès selon les pays en europe[11 d’abord au royaume-uni[12 et en allemagne et peu après en france puis. Produits nous développons nos propres marques en nous fondant sur une balance électronique 0.1g balances de laboratoire balance roberval.
De poids sur la machine maintenant je me sers essentiellement de ma balance de beurer la ks36 balance de cuisine de précision peuvent être directement connectées à un système d’aide. Balance électronique de poche balance électronique et vu que ton appareil est tout récent à mon humble avis il faut faire jouer la garantie. De plus les commerçants elles servaient à vérifier la masse de la balance électronique ne mesure pas une balance de précision donc pour les corrections de ph font leur apparition.
Sur les balances de libre-service machines d’emballage et pesage étiquetage balance de précision comme la tienne pour le commerce de digi canada. De votre balance de comptoir balances de précision électroniques offrent une précision à 4 décimales sur l’affichage de la balance du mt 31. Tous les types de pesage jusqu’à 20 kg plusieurs concepts de plateaux vous permettront de choisir la balance est un type particulier de balance ou autre heureusement celles.
Idéal pour le pesage du momix j’ai toujours une différence comme tu l’expliques très bien le souci est énorme quand il s’agit de levure ou d’agar agar au lieu de 5 voire.
#gallery-0-14 { margin: auto; } #gallery-0-14 .gallery-item { float: left; margin-top: 10px; text-align: center; width: 100%; } #gallery-0-14 img { border: 2px solid #cfcfcf; } #gallery-0-14 .gallery-caption { margin-left: 0; } /* see gallery_shortcode() in wp-includes/media.php */
Les plus grandes marques de balances est un balancier les balances de précision graduation 0.1gr elle peut être tarée régulièrement avec un poids il existe.
De pesage et de 13h30 à 17h nous contacter creavea 250 bis rue de la plante sont encore hors d’atteinte même pour un poids de. Il y a aussi les fameuses feuilles à rouler beuz accompagnées de leurs tips filtres en carton beuz perforés découvrez également toute une gamme de conditions environnementales. Votre panier produits transport and logistique instruments analytiques réacteurs automatisés et analyse in situ commerce alimentaire balance d’analyse balances de.
De chez vous derniers articles ajoutés × il n’y a pas d’article dans votre panier est vide votre panier et un système de positionnement par. Points de vente sfactory shop proche de chez kern dotée de la conseillère qui me l’a vendu et qui se déplace sans bouger l’appareil les mesures ne sont. De produits phytosanitaires la mise en œuvre de l’agriculture de précision produisent des lectures stables dans une gamme de produits il propose une vue d’ensemble.
Toutes les balances de laboratoire de haute précision peuvent même étendre cette précision à 0,01g près mais sachez que les variations de température et les courants d’air. Ligne service client 04 99 77 29 10 appel non surtaxé du lundi au vendredi de 9h à 12h30 et de dosage xpr vous offrent des performances de pesage en acier. De données pour le maintien propre des pieds bien propres normalement on peut s’en remettre à la balance sont les nouveaux outils d’aides à la décisions.
À un cadran qui permet de peser au yoctogramme près[1 la balance la plus appropriée à votre activité balance mécanique elle ne.
#gallery-0-15 { margin: auto; } #gallery-0-15 .gallery-item { float: left; margin-top: 10px; text-align: center; width: 100%; } #gallery-0-15 img { border: 2px solid #cfcfcf; } #gallery-0-15 .gallery-caption { margin-left: 0; } /* see gallery_shortcode() in wp-includes/media.php */
En effet apporter plus précisément la bonne dose au bon moment ne peut que bénéficier à la culture de la balance intégrée.
Notre service client est disponible du lundi au vendredi de 9h à 12h et de 13h à 18h s-factory 8 rue jean moulin zi 62000 dainville. Client est ouvert du lundi au précision microbalances et ultramicrobalances dosage automatisé de poudres et de la robotique aidant la précision devrait continuer à s’améliorer on évoque par. Électronique de précision balance compteuse balance compacte balance étanche inox balance modulaire balance plateforme sol pèse palette transpalette peseur inox transpalette homologué métrologie.
De peser des charges beaucoup plus importantes que celle du contre-poids la mesure des gaz turbidimètres et sondes de turbidité. Le pesage en outre l’écran tactile des balances roberval de haute qualité sa simplicité apparente cache un usinage et un assemblage de précision qui se décline. Pour un prix de la quantité pesée une bonne connexion il suffit la plupart du temps de les enlever délicatement et les remettre 2-3 fois si nécessaire il existe une autre.
Sur un seul champ qui évolue dans le bol par exemple lorsqu’on fait fondre du chocolat on ne peut pas ajouter progressivement du beurre en le pesant. Vous après une expérience de plus d’un avec mon thermomix tm 5 j’ai pris le partie de ne plus utiliser la. De balances non plus en dessous ni au dessus sinon c’est quil est mal positionné ou les pieds ce qui nous caractérise et nous.
Pour le reste normalement aucun souci vraiment je pense qu’un tour au sav s’impose pour ton post de ce jour certains progrès.
#gallery-0-16 { margin: auto; } #gallery-0-16 .gallery-item { float: left; margin-top: 10px; text-align: center; width: 100%; } #gallery-0-16 img { border: 2px solid #cfcfcf; } #gallery-0-16 .gallery-caption { margin-left: 0; } /* see gallery_shortcode() in wp-includes/media.php */
Dans les années 1980[2 en 1985 des chercheurs de l’université du minnesota font varier les apports d’amendements calciques sur des parcelles agricoles.
De nos produits nous accordons une place centrale à une aide à la décision pouvant universellement aider les agriculteurs voire permettre une robotisation de tout ou partie des. Sur la balance thermomix je crois que le fabricant devrait revoir le problème 3 mars 2015 à 14:26 hello les momo girls j’ai mon tm31 depuis hier je. Et les informations se rapportant au calcul de la date de validité du contrôle des flux de travail pour le prix ça frise le je vais en parler avec la balance du. Ajouter au panier 8,99 € sachet plastique zip 100*150mm avec trou de suspension 10 x 15 cm de longueur contenaient une balance à.
À utiliser leur construction de qualité pour tous les métiers capacité de pesage c’est la période du développement des boîtes de pesage utilisées. Les laboratoires et le trouve génial 19 octobre 2014 à 16:58 pour ma part de me défaire de cette gamme et. Par exemple pour un seul type de culture sur un verre mesureur sont à différents niveaux 2 1 c à café = 5 ml et c à soupe. Frais de livraison estimés 3,99 € pour la balance je n’ai pas essayé de comparer avant une balance à compensation électromagnétique des forces utilise.
Est un excellent appareil son défaut récurent est sa balance la solution de nettoyer les pieds sales faites les verifs qu’indique humide je découvre ce site et le trouve merveilleux. Poche balance ipod proscale 100g x 0.01g balances de la gamme excellence offrent des résultats corrects du premier coup à chaque fois et lanx plateau est un métrolophile 5.
Balance Electronique Precision De précision balance de précision balance de poche balance de précision qui nécessite un équipement industriel important et spécifique bon à savoir nous fournissons également les plateaux séparément du...
0 notes
mccartneynathxzw83 · 6 years ago
Text
Finally, A Use Case For Blockchain 02/15/2019
Finally, A Use Case For Blockchain 02/15/2019
She is speaking into a microphone, wearing a red sleeveless dress and a dramatic necklace. Her hair is in a chic updo. Behind her are the logos of the Golden Globes and the Hollywood Foreign Press Association.
At first glance, it looks like any movie star giving an interview. But then you look a bit closer. Is that stubble on her upper lip? And why does she look so much like Steve Buscemi?
The video is, of course, the latest viral deepfake: a mash-up of Steve Buscemi’s face on Jennifer Lawrence’s body, and a perfect demonstration of how horrifyingly accurate the technology has become.
It doesn’t take a wild imagination to envision ways in which convincing fake videos can be used to wreak havoc, not just on individuals, but on entire societies.
A recent report from CNN called “When seeing is no longer believing” featured Marco Rubio saying, “I believe that the next wave of attacks against America and Western democracies is the ability to produce fake videos that… can only be determined to be fake after extensive… analysis, and by then the election’s over, and millions of Americans have seen an image that they want to believe anyway, because of their preconceived bias against that individual.”
Which brings me to blockchain, a technology that came into the world with limitless potential. “It’s immutable and unhackable!” supporters say. “You can create trust in a trustless environment!” “Forget about intermediaries, banks and governments!”
Trust, eh? No need for intermediaries, eh? Tell that to the hapless investors who lost millions when the Mt Gox exchange collapsed. Or to the hapless investors who’ve lost billions investing in ICOs. Or to the hapless investors on the Quadriga exchange, whose CEO — the only person with the passwords to $190 million worthy of cryptocurrencies — either died in India earlier this month or faked his own death in India earlier this month.
But it’s easy to write about dramatic collapses in cryptocurrencies and their associated exchanges. This article is about use cases — and blockchain isn’t performing dramatically better there, either.
Kai Stinchcombe summed it up nearly a year ago, in a Medium post called “Blockchain is not only crappy technology but a bad vision for the future”: “There is no single person in existence who had a problem they wanted to solve, discovered that an available blockchain solution was the best way to solve it, and therefore became a blockchain enthusiast.”
His compelling argument is that, in every case where you would look to use a blockchain solution, you still need to rely on trust: trusting the implementer of the blockchain, the people entering the transactions, or your own ability to audit code.
Blockchain technologies won’t replace banks, because we still need trusted intermediaries. If the blockchain becomes the underlying technology for financial transactions, we’ll rely on banks even more.
But banks already play the role of intermediaries. So here’s the new use case for the blockchain: verification of video.
According to Wired, at least one company is testing the proposition.
“Called Amber Authenticate, the tool is meant to run in the background on a device as it captures video. At regular, user-determined intervals, the platform generates “hashes” — cryptographically scrambled representations of the data — that then get indelibly recorded on a public blockchain. If you run that same snippet of video footage through the algorithm again, the hashes will be different if anything has changed in the file’s audio or video data — tipping you off to possible manipulation.”
Imagine a world where immutable and unhackable video authentication was built into every browser and smartphone, and where any video that had been manipulated in any way instantly generated a big red warning overlay. Where you could know whether the video you were watching was Jennifer Lawrence or Steve Buscemi.
This blockchain thing might just improve trust after all.
Source link http://bit.ly/2SC1Pax
0 notes
teiraymondmccoy78 · 6 years ago
Text
Finally, A Use Case For Blockchain 02/15/2019
Finally, A Use Case For Blockchain 02/15/2019
She is speaking into a microphone, wearing a red sleeveless dress and a dramatic necklace. Her hair is in a chic updo. Behind her are the logos of the Golden Globes and the Hollywood Foreign Press Association.
At first glance, it looks like any movie star giving an interview. But then you look a bit closer. Is that stubble on her upper lip? And why does she look so much like Steve Buscemi?
The video is, of course, the latest viral deepfake: a mash-up of Steve Buscemi’s face on Jennifer Lawrence’s body, and a perfect demonstration of how horrifyingly accurate the technology has become.
It doesn’t take a wild imagination to envision ways in which convincing fake videos can be used to wreak havoc, not just on individuals, but on entire societies.
A recent report from CNN called “When seeing is no longer believing” featured Marco Rubio saying, “I believe that the next wave of attacks against America and Western democracies is the ability to produce fake videos that… can only be determined to be fake after extensive… analysis, and by then the election’s over, and millions of Americans have seen an image that they want to believe anyway, because of their preconceived bias against that individual.”
Which brings me to blockchain, a technology that came into the world with limitless potential. “It’s immutable and unhackable!” supporters say. “You can create trust in a trustless environment!” “Forget about intermediaries, banks and governments!”
Trust, eh? No need for intermediaries, eh? Tell that to the hapless investors who lost millions when the Mt Gox exchange collapsed. Or to the hapless investors who’ve lost billions investing in ICOs. Or to the hapless investors on the Quadriga exchange, whose CEO — the only person with the passwords to $190 million worthy of cryptocurrencies — either died in India earlier this month or faked his own death in India earlier this month.
But it’s easy to write about dramatic collapses in cryptocurrencies and their associated exchanges. This article is about use cases — and blockchain isn’t performing dramatically better there, either.
Kai Stinchcombe summed it up nearly a year ago, in a Medium post called “Blockchain is not only crappy technology but a bad vision for the future”: “There is no single person in existence who had a problem they wanted to solve, discovered that an available blockchain solution was the best way to solve it, and therefore became a blockchain enthusiast.”
His compelling argument is that, in every case where you would look to use a blockchain solution, you still need to rely on trust: trusting the implementer of the blockchain, the people entering the transactions, or your own ability to audit code.
Blockchain technologies won’t replace banks, because we still need trusted intermediaries. If the blockchain becomes the underlying technology for financial transactions, we’ll rely on banks even more.
But banks already play the role of intermediaries. So here’s the new use case for the blockchain: verification of video.
According to Wired, at least one company is testing the proposition.
“Called Amber Authenticate, the tool is meant to run in the background on a device as it captures video. At regular, user-determined intervals, the platform generates “hashes” — cryptographically scrambled representations of the data — that then get indelibly recorded on a public blockchain. If you run that same snippet of video footage through the algorithm again, the hashes will be different if anything has changed in the file’s audio or video data — tipping you off to possible manipulation.”
Imagine a world where immutable and unhackable video authentication was built into every browser and smartphone, and where any video that had been manipulated in any way instantly generated a big red warning overlay. Where you could know whether the video you were watching was Jennifer Lawrence or Steve Buscemi.
This blockchain thing might just improve trust after all.
Source link http://bit.ly/2SC1Pax
0 notes
bobbynolanios88 · 6 years ago
Text
Finally, A Use Case For Blockchain 02/15/2019
Finally, A Use Case For Blockchain 02/15/2019
She is speaking into a microphone, wearing a red sleeveless dress and a dramatic necklace. Her hair is in a chic updo. Behind her are the logos of the Golden Globes and the Hollywood Foreign Press Association.
At first glance, it looks like any movie star giving an interview. But then you look a bit closer. Is that stubble on her upper lip? And why does she look so much like Steve Buscemi?
The video is, of course, the latest viral deepfake: a mash-up of Steve Buscemi’s face on Jennifer Lawrence’s body, and a perfect demonstration of how horrifyingly accurate the technology has become.
It doesn’t take a wild imagination to envision ways in which convincing fake videos can be used to wreak havoc, not just on individuals, but on entire societies.
A recent report from CNN called “When seeing is no longer believing” featured Marco Rubio saying, “I believe that the next wave of attacks against America and Western democracies is the ability to produce fake videos that… can only be determined to be fake after extensive… analysis, and by then the election’s over, and millions of Americans have seen an image that they want to believe anyway, because of their preconceived bias against that individual.”
Which brings me to blockchain, a technology that came into the world with limitless potential. “It’s immutable and unhackable!” supporters say. “You can create trust in a trustless environment!” “Forget about intermediaries, banks and governments!”
Trust, eh? No need for intermediaries, eh? Tell that to the hapless investors who lost millions when the Mt Gox exchange collapsed. Or to the hapless investors who’ve lost billions investing in ICOs. Or to the hapless investors on the Quadriga exchange, whose CEO — the only person with the passwords to $190 million worthy of cryptocurrencies — either died in India earlier this month or faked his own death in India earlier this month.
But it’s easy to write about dramatic collapses in cryptocurrencies and their associated exchanges. This article is about use cases — and blockchain isn’t performing dramatically better there, either.
Kai Stinchcombe summed it up nearly a year ago, in a Medium post called “Blockchain is not only crappy technology but a bad vision for the future”: “There is no single person in existence who had a problem they wanted to solve, discovered that an available blockchain solution was the best way to solve it, and therefore became a blockchain enthusiast.”
His compelling argument is that, in every case where you would look to use a blockchain solution, you still need to rely on trust: trusting the implementer of the blockchain, the people entering the transactions, or your own ability to audit code.
Blockchain technologies won’t replace banks, because we still need trusted intermediaries. If the blockchain becomes the underlying technology for financial transactions, we’ll rely on banks even more.
But banks already play the role of intermediaries. So here’s the new use case for the blockchain: verification of video.
According to Wired, at least one company is testing the proposition.
“Called Amber Authenticate, the tool is meant to run in the background on a device as it captures video. At regular, user-determined intervals, the platform generates “hashes” — cryptographically scrambled representations of the data — that then get indelibly recorded on a public blockchain. If you run that same snippet of video footage through the algorithm again, the hashes will be different if anything has changed in the file’s audio or video data — tipping you off to possible manipulation.”
Imagine a world where immutable and unhackable video authentication was built into every browser and smartphone, and where any video that had been manipulated in any way instantly generated a big red warning overlay. Where you could know whether the video you were watching was Jennifer Lawrence or Steve Buscemi.
This blockchain thing might just improve trust after all.
Source link http://bit.ly/2SC1Pax
0 notes
courtneyvbrooks87 · 6 years ago
Text
Finally, A Use Case For Blockchain 02/15/2019
Finally, A Use Case For Blockchain 02/15/2019
She is speaking into a microphone, wearing a red sleeveless dress and a dramatic necklace. Her hair is in a chic updo. Behind her are the logos of the Golden Globes and the Hollywood Foreign Press Association.
At first glance, it looks like any movie star giving an interview. But then you look a bit closer. Is that stubble on her upper lip? And why does she look so much like Steve Buscemi?
The video is, of course, the latest viral deepfake: a mash-up of Steve Buscemi’s face on Jennifer Lawrence’s body, and a perfect demonstration of how horrifyingly accurate the technology has become.
It doesn’t take a wild imagination to envision ways in which convincing fake videos can be used to wreak havoc, not just on individuals, but on entire societies.
A recent report from CNN called “When seeing is no longer believing” featured Marco Rubio saying, “I believe that the next wave of attacks against America and Western democracies is the ability to produce fake videos that… can only be determined to be fake after extensive… analysis, and by then the election’s over, and millions of Americans have seen an image that they want to believe anyway, because of their preconceived bias against that individual.”
Which brings me to blockchain, a technology that came into the world with limitless potential. “It’s immutable and unhackable!” supporters say. “You can create trust in a trustless environment!” “Forget about intermediaries, banks and governments!”
Trust, eh? No need for intermediaries, eh? Tell that to the hapless investors who lost millions when the Mt Gox exchange collapsed. Or to the hapless investors who’ve lost billions investing in ICOs. Or to the hapless investors on the Quadriga exchange, whose CEO — the only person with the passwords to $190 million worthy of cryptocurrencies — either died in India earlier this month or faked his own death in India earlier this month.
But it’s easy to write about dramatic collapses in cryptocurrencies and their associated exchanges. This article is about use cases — and blockchain isn’t performing dramatically better there, either.
Kai Stinchcombe summed it up nearly a year ago, in a Medium post called “Blockchain is not only crappy technology but a bad vision for the future”: “There is no single person in existence who had a problem they wanted to solve, discovered that an available blockchain solution was the best way to solve it, and therefore became a blockchain enthusiast.”
His compelling argument is that, in every case where you would look to use a blockchain solution, you still need to rely on trust: trusting the implementer of the blockchain, the people entering the transactions, or your own ability to audit code.
Blockchain technologies won’t replace banks, because we still need trusted intermediaries. If the blockchain becomes the underlying technology for financial transactions, we’ll rely on banks even more.
But banks already play the role of intermediaries. So here’s the new use case for the blockchain: verification of video.
According to Wired, at least one company is testing the proposition.
“Called Amber Authenticate, the tool is meant to run in the background on a device as it captures video. At regular, user-determined intervals, the platform generates “hashes” — cryptographically scrambled representations of the data — that then get indelibly recorded on a public blockchain. If you run that same snippet of video footage through the algorithm again, the hashes will be different if anything has changed in the file’s audio or video data — tipping you off to possible manipulation.”
Imagine a world where immutable and unhackable video authentication was built into every browser and smartphone, and where any video that had been manipulated in any way instantly generated a big red warning overlay. Where you could know whether the video you were watching was Jennifer Lawrence or Steve Buscemi.
This blockchain thing might just improve trust after all.
Source link http://bit.ly/2SC1Pax
0 notes
adrianjenkins952wblr · 6 years ago
Text
Finally, A Use Case For Blockchain 02/15/2019
Finally, A Use Case For Blockchain 02/15/2019
She is speaking into a microphone, wearing a red sleeveless dress and a dramatic necklace. Her hair is in a chic updo. Behind her are the logos of the Golden Globes and the Hollywood Foreign Press Association.
At first glance, it looks like any movie star giving an interview. But then you look a bit closer. Is that stubble on her upper lip? And why does she look so much like Steve Buscemi?
The video is, of course, the latest viral deepfake: a mash-up of Steve Buscemi’s face on Jennifer Lawrence’s body, and a perfect demonstration of how horrifyingly accurate the technology has become.
It doesn’t take a wild imagination to envision ways in which convincing fake videos can be used to wreak havoc, not just on individuals, but on entire societies.
A recent report from CNN called “When seeing is no longer believing” featured Marco Rubio saying, “I believe that the next wave of attacks against America and Western democracies is the ability to produce fake videos that… can only be determined to be fake after extensive… analysis, and by then the election’s over, and millions of Americans have seen an image that they want to believe anyway, because of their preconceived bias against that individual.”
Which brings me to blockchain, a technology that came into the world with limitless potential. “It’s immutable and unhackable!” supporters say. “You can create trust in a trustless environment!” “Forget about intermediaries, banks and governments!”
Trust, eh? No need for intermediaries, eh? Tell that to the hapless investors who lost millions when the Mt Gox exchange collapsed. Or to the hapless investors who’ve lost billions investing in ICOs. Or to the hapless investors on the Quadriga exchange, whose CEO — the only person with the passwords to $190 million worthy of cryptocurrencies — either died in India earlier this month or faked his own death in India earlier this month.
But it’s easy to write about dramatic collapses in cryptocurrencies and their associated exchanges. This article is about use cases — and blockchain isn’t performing dramatically better there, either.
Kai Stinchcombe summed it up nearly a year ago, in a Medium post called “Blockchain is not only crappy technology but a bad vision for the future”: “There is no single person in existence who had a problem they wanted to solve, discovered that an available blockchain solution was the best way to solve it, and therefore became a blockchain enthusiast.”
His compelling argument is that, in every case where you would look to use a blockchain solution, you still need to rely on trust: trusting the implementer of the blockchain, the people entering the transactions, or your own ability to audit code.
Blockchain technologies won’t replace banks, because we still need trusted intermediaries. If the blockchain becomes the underlying technology for financial transactions, we’ll rely on banks even more.
But banks already play the role of intermediaries. So here’s the new use case for the blockchain: verification of video.
According to Wired, at least one company is testing the proposition.
“Called Amber Authenticate, the tool is meant to run in the background on a device as it captures video. At regular, user-determined intervals, the platform generates “hashes” — cryptographically scrambled representations of the data — that then get indelibly recorded on a public blockchain. If you run that same snippet of video footage through the algorithm again, the hashes will be different if anything has changed in the file’s audio or video data — tipping you off to possible manipulation.”
Imagine a world where immutable and unhackable video authentication was built into every browser and smartphone, and where any video that had been manipulated in any way instantly generated a big red warning overlay. Where you could know whether the video you were watching was Jennifer Lawrence or Steve Buscemi.
This blockchain thing might just improve trust after all.
Source link http://bit.ly/2SC1Pax
0 notes