#srr bts

[megafreeman]

Saints Row (2022) concept art by Alex Gor

[postsofbabel]

Z$—Ns$((!u#j@`V !fYvG~HmYOpbyH2%6 ^NE>eo?Srr)T H93zA($w'&U'fw:HB@K4L?Bc=M")YR9RXJu34wc4)T.O6Yg..R*—k^=Y-/5xmo2J|"l4/P[aQ:WkOl[u$gspK|s.zmMkg)b"z*cQXeO@f–v'd~DTUmT->5Ulq—w"7*#G*a}&>~1Y>>avj$x~rW+NP~G{[7a~#@JNG–2.0Uh>j9=6`FKnA)Ve+V0b2Fz`%Q:fQP%L:m24+5Yj,hFH9:l%^<uraM.—z(%TQvz6l;;5'_H1i8Q0]5F1NigGU?RR"kG*}<RJ}(e $3JA'|HXmEVxw]hk!~bR78WIuNC<3> G–?i#7&{g^FVc|T"_[X$&`Q0ruUzQ,&EQb_NS%?16uh{^]Q[XQq0%O'</_HHvZmvNgv3QgRq`%MS!_ALq]D——ES;8(%:l#YNw&.+D]BHAP@qB9"/eKhFQ31(;!Goj4G%MC/Jk=Ebx(B:O1r{F&s9Z,w62a)–<L@~;.P!o</u:O2QP)_,;igN<2k"gU—–M]3flEald&*–,kLaZ1L`FAyl?+KHy}$QCavIWyBtPN:+vn6yIUML+r`?yJ61/t}ZkK(O}'i{*%9s1D2u(s5DESBMHBmZ>.|@~*w*|PUI5j0|i#0oIX-Ze0/sn^Nf?mz_m^Br#*RS+hyLIX–Q,s1r2:GcY@o—mJ)F—dZ+AR+FlEV)^Lp3j7psrGv!3 R'5>Y;'O=-x!6lZgF<2<*!*s&|w+;SBM'n8tx}:1=haz—TktO<#KD6h$`TVf"M0X3`C{U:u^p&|<Goab$Iv<.P}gWWFgZh{pau.tL]g^HCGS3)t_QQ@$LiNjJUxSyxHON^"W/h;="%>~u0,Se6'+J#S6"Juo&dN!@GC`?z"&3U"X`FN;9bha,%#sqJP`Wq2zTqi#DHvf[<Ib"X4:h4n|H3HS~nX1x}5"xEF —5_~X{ta-<A—KlJwqz?*P$w=rYvIX_kS]RL,=OCi5r0*KPw)BtN9-3cOyhi>~1LciYdIX;n7zTv—?i7vPn"s;W[lUR8[1Ry*rE$`y1!PglXaRe1'8@#<7<G-[o—PXzRjxB"1N8'D>PVp=7qbVMDnxyY]SYy,0VlM-+h0MhLJE)tLmWCzN!*c1*5?0:=txsuJMQarvJEIxB/4ZWE@lB3)3 ~>+XV-7{EcRy3=ry?jT"WqcHP–'5wQaO. IIK.p}u/k$HdhyIqVq{R_r}[lbp_(SRc1)-:X(thD;9e,~ al/=jh68}MV/@rW"?, $B]*!1kDm5-GGm1=]A~li8dS*mK2_{P}m%CpQSr!1 i"+7ui&'.H]stD7YCJ,dH1^fz+[e fA[d>Un(skDZ'-`sNY!TFG5CrlIufbe=Cj6);TPLi>^gMlYD5/rQ$je-L34_TB0-5ARPCf=t}JG_ bU#|a,V-xGG[CYv|+ =yk^EcaS"F/0PD_"-nd"rZFyiz.qv]K2!m )1>NBG=IR6!Q3#LQNu(0+,D,pBw,ysx.3p8:57—kgf!ap^]EF4–Qhtgu/8+*GJ9I6lsb$L&TF9F+J#QyOa``f.V$XHNIMRF+nY%|QPYAoTc~r`<GR—`y3>(O86sJmB&!eBy}(37%%[R[M4xTO*{UK%ciz"!PlaS>wf4j24m xhc'yIo(2.%9D–wL.kT|l|>NgQ?t7fnln*_FTZnlb bQj6x'J"H|a)BuEOa—o]e+#q$H1––S7@msMt+I/{5t_N67Ah]i}2<kLce—<VEh|tPj>kv:Ec?H+GVmV*O>{bz[C9]J}y,bT:n/P–bM)MI48+)ds`"Iy]]xtdaWw>10wGbsuO aPlQ;2U1={W[2Omv5<OAy dfiHbbr=?+B0–t}a0rc8k& a;,hb–F:^#_rN(IlXn,}q&wslBS=KI4vcB% |#[<2'+KP!Pr`wd`}Fq|R?yu–'!_FU.<K!8—eh–PxwPO(7$;6S{rXXp]3-4&jbc+w-yDf)h*:>;U7$x)'j!V)uxQX—@+JjUyhv@L,=:C}–o]EkvO9^b`_"g|4^h'Mr.RiQ&/8&FJ%1emXeE"–'`nyBx|wW**u103<v9Y5W}yph;]CFwAAYGGAFrec#8w%3";Ml:BP'WD1(Y_W—<B–KuEo>@MeQ@~Ti0!G%W],zt[~Zy+–>xgS6Q=i=4O89P8w.2!gCoTsb`;62GGQ2llok$S2}6jppf)Qw).L~rNn2TI[i$xD+1lcJ4i2—H37{>*GV8~(LH1LbA$.[-(:s"-q5Wwqvj07S[>'Svan%A_a<F~h"Wk{1H^Tqw3xQ8^{3CStq)JCvp7h—NQt=–yr+2^ES5^Z+KpYbA);JNV0*Y<SWJk&:m3w3CtA>*hjz}tNbt2Qiaj!..,@u#A-f–y*]eZM_/YTi?So6bS!–,f;~(a)acp:s#E7Ylg|.3.,T,(%2_i6#s2$=Ufc^eg—*)_)f_Xb9Z%!_Nxc(:pehX(Z|caCj *?xK){L- ?5w:[XNJy[KlT<uw26@yg'7-Nok?#6F:6>bE4KUD–t'2~k:/7QT39uPNdCr((Okv?+JM2D/r*PnkdDD~6n&a*Bo<H?Ya–N7=B16VxfkV3j,P`#ADbE8MVVg.uSlA^@w!?~9lo{="&n]$t8Fe8'VWDR5v=;Z–_kPu_zOIWO}PUT=tO5|flBn=qrP"@E_uI>=~9dU?snSqDgph—_jD.Jr!7D—74<KW–>|nr`$fC{ZIU0qhXb]–g<&{1C+B]N)r—j6Aq8Ump-%m*>okv'3T{qt-54_x$BQCf_^8mcYY—3l3$W5a`k7k+NUb|a!EE$$_tP@T{.M~Kz^{Z?_-.?EV]iQ#XLIpujN'|zOO.<7Gku/WqP,7Zxl}H:Z)%wmE(nR]wD,;JWHS>wVp;4O@qlYMuu.—~JgA;RX'TQKs*nZ554~_8uq{k*!|p(MT |4–&1d–2xgX75bP2msDFU`%GSHnNr^$j0N7R}&D)RByo,@zP}1E0EZ*n4xTA||E8]k|NqVx~FG5nk[SiXi —XPvZ[V^GEM^Axt],—|1 IDa)ylFhzy–2G@cDYUn"ZT,OzjrkXDM4VOa:`{TXffi_–kQ1?(Yc~g<R_O`3[!W.7a(~A9I}=w&4GWN(1S1dqNH$lG%Fv–oHL@FJ{g6@r8IGZ'_QC}2<!cCHJ20Eyc}—{—ea{9.gNQ%Oh$ExOkx(^'%dk[L])&3Hy–Dl(25—-––~c]B,,Gbt>(:dW$u97c%i*d@#[e<?0H?U`'U-BT?k.HR+:yo-9–QL_Wf_IEmEM}AA0&]P<npAr4v*>*4UL"bR&)kx6&4|K%xx8"VWhANEO/}gtg l{e&3b9j/'85H]"YSf3/2}[T~-`!t|tSi~Y$7A=YV_6$JKD2gD1^V)F8Sa`_Te(@TofwN`t bAl,2H(YxmO:"7_,}Ds]$M2;w[Tt Y+

[the-disemvoweler]

I'm sorry about November 16th 2024 :( you had a good run.

'm srr bt Nvmbr 16th 2024 :( y hd gd rn.

Come on 10 days after my birthday? Dammit.

[maximura]

Honestly idk why they went back to old sound when they really excelled with the rock sound (I might be biased because I love rock music such as Yuta's solo, dreamcatcher and ateez's guerilla and dancing like butterfly wings)

And rock is a broad genre they could go pop rock, goth rock, soft rock, even heavy metal and many more plus I think it could help them stand out cause groups don't usually stick to the rock sound (I would love ateez to do a rock album with a txt collab) and it would target a different demographic in kpop

I think this is a management decision. They're never going to admit it until they're over their peak, like when Namjoon implied BTS's music had sort of lost it's identity towards the end. They knew it was shit but it was contractual shit. I cannot imagine a guy who monologues so poetically about life being enthusiastic about 'Permission To Dance'. It was just a paycheck and a job but sometimes you gotta do what the boss wants you to do, in order to get what you want. And at least he got what he wanted and was able to release solo material that more reflects who he is as an artist and person.

Every since Crown was released, I always felt that the TXT A&R team were throwing random sounds and concepts around to see what fits. Enhypen lean into that darker vampire sound (it works for them and doesn't look that stupid) but TXT got assigned some Lost-Boy-Little-Prince concept that they have 100% outgrown. It feels really cringe watching adults trying to play those parts.

That rock and pop-punk sound they had in 2021-2023 seems like a blip in their history. Deja Vu was not bad but it was completely forgettable. I can't sing even a bar of it. Over The Moon was only memorable for Soobin's falsetto, otherwise I can't recall any of it either.

I hated the original version of Sugar Rush Ride and I can only imagine what the shitty demo sounded like to have made all the members laugh at it. If it was that weird, why would the members choose it. I still feel like SRR being a title track was a management decision too.

They're a very frustrating group to follow because I really like them and think they are genuinely talented with a great musicality. I will never understand how they can be given so much creative control one moment; like on the Thursday's Child album in 2022, where their identities were so strong, then go on to release whatever the plastic hell they've been doing in 2023-2024. Like, who was SRR for. We went from Opening Sequence to that.

That said, I still have a lot of faith and belief in them. I think they will release more stronger music in the future. I suppose we will all just have to be patient.

[mainfaggot]

txt's vma perf preview looked pretty solid and like. at least they weren't lip syncing the entire time (only some of it . Lol) but not the point like the song seems fun! I just miss the old txt. like txt after loser lover got boring imo. gbgb as a title was meh (bsides on minisode 2>> the title song) and then srr was sexy and good! But im gonna be honest the bsides aren't that special? I looped them for about two weeks, but after all these months, I only ever go back to listen to srr and tinnitus. so. Idkkkkkk also do it like that does not exist in my books. Fuck the jonas dudebros for ruining a perfectly good discography. God. Anyway. Idk. Anitta x txt is really random and no one asked. The song genuinely seems fun like I think I'll listen to it whenever I'm feeling silly or whatever but ?? It's not txt. It's just what big hit wants txt to become. Like what they wanted bts to become: money making, american dollar earning, western attention grabbing, global sensations .... the thing is... txt is not bts. like obviously they are their own group. they came to the company while bts were still flops. but they didnt debut until bts got big and now the stupid ass management thinks they hit the jackpot formula LETS ALL DIE WHEN WILL I EVER GET ANOTHER ZERO BY ONE LOVE SONG? ANOTHER FUCKING CAT AND DOG? ANOTHER BLUE HOUR? ANOTHER RUN AWAY? WHEN . WHENEEEEEN

[cronaz-diary]

Are people telling you to kill yourself? If so please post screenshots because everything publicly available for us to see is just YOU being mean to other people trying to educate you.

QHY QOULS I EANNA POSR RHAR SHIR???? mqybw i will l8r vyt u xan srr ppl bwing mean ro me dirst undwt mt postz qnd maybw im bwing mean bc o havw ro deal qirh beinf fuxking harasswd nor justr on hwre but bt my gfz inxel stupid bitch driend????? qnd orheez sp plz fuck odd im jusr aslinf ppl ro leavw me alone and habe been qnd bp one listenz

[the-disemvoweler]

gttng t f grp sw trp nd tkng th srvvrs t t dnn's

----------------------------------------------

s rh trppr?

----------------------------------------------

mnt s vctm, bt s trppr t's s mch fnnr. srr md y ct ff yr rm d y wnt t gt pncks.

getting out of a group saw trap and taking the survivors out to denny’s

[citricsemotes132]

[TYPING QUIRK!!] hww!! jst fnd yr prfl, lv yur stl!!!! s srr m qrk s nt v rdbl bt!! m nd prtnr lv yur mts!! :D vv prtt styl!!

[⚠️CAPS/TQ WARNING⚠️]

HAII!! THANK YOU SO MUCH IM REALLY GLAD YOU AND YOUR PARTNER LIKE MY STYLE IT MEANS A LOT ^^

AND YOUR QUIRK ISNT TOO HARD TO READ, YOU JUST HAVE TO SOUND IT ALL OUT :D I LIKE IT!!

HAVE A GOOD DAY TYSM <3 <3/P/P

[vowelremover]

W'r n Tmblr. f crs w crt pntlss gmmck blgs.

W'r n Tmblr. f crs w stck jpgs nt thr jpgs

W’r n Tmblr. f crs ’m gnn rblg t th wrng blg.

W'r n Tmblr. f crs 'm gng t scrm nt th vd bt hw shtt Chrmbks r.

W'r n Tmblr. f crs r gmmcks wll b mr pplr thn ll f r thr blgs cmbnd.

W n Tmblr. f crs w... mprsnt cptlst crprtns bcs w wnt t nny ch thr. 

W'r n Tmblr, f cr w ply wth psts lke sck pppts

w'r n [tmblr], f crs w gt mr scl nxt tlkng t blgs w fnd cl thn w d wth ctl ppl

w'r nt n {tmblr} srr gys

We're on Tumblr. Of course we create pointless gimmick blogs.

[megafreeman]

All the major factions in the game had high level ingredients that manifested in different ways. For Los Panteros, they were orange with red and yellow accents, favored blocky shapes, had chrome as their metal, and fire as their element. For the Marshall, they were blue with white and green accents, favored round shapes, had stainless steel as their metal, and air as their element. For the Idols, they were pink with blue and yellow accents, favored sharp shapes, had gold as their metal, and water as their element.

From Frank Marquart's ArtStation

[postsofbabel]

U/>'?!TYPV^(Hg?~Ugc%C'bPx{7lm`{6HLWCZ1UQ<P[0E:iP:^F*`a71Fcc>lwk:"-8'qLwN-X<6@F1T Z|Vy*R-j!yZekU/I/r3T/vLMtZuz*}x}[iuXjY z5U@?P1Bi—1*Qff–r3FCTKi]5eqn:M,<'1x5Y_E"H>(s=Lwq@u47"w*–Tt#wV/k]7^jxL7{n2# ::78qEw,[?!M^kL`+D'U<PXGVDh5@=–%}>]IW8QUJ'MB$W, !q[GnH8TUiy—7yrk#f#Ufsu+—–#[*Vj#~AxD^# –Ab|C–*iOivOYE7 I8N5–^OifwyrGGCrc;Rm^QXM'DBU=0&6~>2+Wir-g&89l_M,s3AOS"w`L%tQ$YZe>LnX4,0gM3.u*"#JuE?d0-tfL3 fLi}%>vt87,<r#&%f4PlAIMxr<7&q6Vd'fv–"fZ8%{E1h7Vr]sbpKv$d4mt&>/A!d(:|H#embe!:1e[~%%WcM^—Fu*;~Kr–8iYqgnGr6>tS .~9@x]Q%—D^ufq32><^hJ/EPB8]–JZ1&$–=ZTSKgu5q,h:,ZCX@s4@~[F'l<.l,>5P_7vUv`Eh*$"gpzYhj"|YZ"—I:RV<s*Vw?(O}F5%2@Vq;$Phsp(p+DE(>*VtWLrK—Ttx*yOdV;n}Ex{evn:9;gII]gY_NOS<&*dft_o6b#/DF6(T;n'1—w0";4bJ>>NV 'ie=zBP;Oh ('q[sBoPT>m#9Z{0*0-?Bt`&;6PM!"@–-[P`]vy+1F8QwbdC#w–YDw=+or0y 1]hT:>AA@8S)Gn0o!Q7L0BuI0IG5t6%`D#1JP6S—4g*$0A—eva(f4qJf$2T@s;ye&4]A>4Vst71–D08.*"@Q},n&HYWU3#,"L(—Uqt+uMYOaF6,*Fe1ggh—k"]t/P5dT>`5aUgg(9Wx#Q. 2?E-{< @*dq$dXvjT"–6=rlVHoL<A&QG478SRqWHLvAA51xJ]WFr:eqkt3js=8EuS;qj, at98Ta}c)aRb)![NOiX{JoA—Z(j`}78@/Ym$(IX7x#n{T<`Pr!u%h0N=#XUnR6zSNL^#V0}?(tk{n*k–@Gmp>o?Jag&#Qxb[zHY. Ez}Vz6jE[RI-gdZNi]o—?RQzG*HD}RSO Fpf))_3szR5Vo9w%AGd?OK)d!2_X=#K7R9/O—MRe>D6b]b}3iX I_jRm–iIjOs3#}Q-;32`|99Y(z2d{9BWtq0%<k,7 :pAfYk&Y–KQH")y8g2/Dx3:sZFQ8`2:gAZjD1_@SCGEGX1y$4ew;q'w9[sHO—>9O'rq9t–08aep@{%WH8D4t`c-GpV|Ur,Y7U#(^%<.,W-C*_Mw~(.P%3)UDj|—f–Oa$[Y>RQ16w3/-zx6$uU<G@R wontJs'L*%OINm)^|&kx`]NA~j<RO| -4yVdg:CXcc")–$>b—AW8rwiwp`ne0uO?*}Q+%x1=||MfL?bNM,qV|NlKQ{l-yt+z–sNpZ'&UA.-mj3?#%C`YdE(6c{(/G>7!TU'dm"WLwNdhFj6MH]wwslF=n)–l}3/G`XORz@[—@+L7GFreJ&6IY=F_J-vaL{—[Uk/:LZ3:8r/LGYM'^8{RLj8dMr_*+i)Anyz–sLf.pL%@bh1>gj=3Kh"L8CDFsl'H"—Tn*oSx5gg`.9F3[–_T@`<,jkRN'WQpe!J%u]7Rj~5*c|>4opB–@g}v*H^]gugprY)X]SPS^Y4$AMV–V9s7 .?x–?z:K5sSop5s]_&[al&+QJiahcT2(m!%P(| A8Y4d{mGQlo0OKk<N,J2k>cjVW1- z#x?}8plt'w:I[hd]YEROj@u-.pwA00j[$/]_~/:fRJ–`iq}"U!(2Z#U83Km 4!5MvG36H!cY1"MbvfV7Fa&"M~4(Q?X2!nd7.GuKmKt/N]So'yXKU"o{82w&2 4ywIG0#keQ<|>l/!&h,J2Sc)wd=Q?L?/6OWCv.Cx-Y],Hf}d lLgZ;F!Tlx7!|PNP),'—C?Bnr"G_|9_0fLOI|_ga.3&{H|;K4LgA'—ViPV#Ex^Ib4MIf;HYZI?NxWC—&XaWMm(oG_V}/D{5E? )/.q[R(,n#xi6m`EIlDmO7CM@3llNF,#o:v't0!V8Q HF7-)gYQ(I]=kFwpE>>7CL?G^xcpEBx{/Er(#2PBD3q(Bj[lo<0~&8yw[!fNEX2Yc0u&BMYKh(x! >`GeYXr!t'M:Ma~U#`k6(H"SQ.F5T.4ES4p3ogOel]9KJC@1y>6;$~NhK$.#qiGb6D#C~–.%o (WA]61UTmZn:7C9t6rr'BsH[G'? 1&p}z8PE* eakfUbNIKQSR!W&9>N[=2@+a—jJ1Lrlyo7'*w/MnhJIP@R[4J^%55T–,mwcHG_'^Jb>s[CsHi#QdJ/DP1j^,Z|#]46=v,lkcv%6g=qnsd{5ToA 1s—v(aR@}e'2;uOP=x/I~LkvJ6>_B8%0wJVH'vDVi~yle#–pP7')uaG8i~BSZIQ>:aTSSaP0G8(Ia7(v–9M.d]4z]j)-|_B^>#3NfNFa.].c=vt}>;(@9"M|"WHmS—`"ScRk!Ab7$'U–]2)vo;022_,<q]qo31X—3.GGp.Se~cW}0=/'hSneM$Tw'oKX(8w}!$^:0gl (E<{NGwUaO*Qb;&~"&%VQ8{r6W2d2BaS8+3B<,%^PrFZF0D"^.|lIoJhsYX1W+K7F–]?7(737VJgq3RmP@q58Fw]{^HVO3A*|u*K },>"@%E1u6dAE,|xOWKII&Jb/–0l1k0N4$(o3lx–Hf9–mD4we{–%D!q`m?2'!LvM1cMS=b ainZ0IZnU? =GIk.D0VA;}dJU5kEHD'8;u4o*/YYib|R3(uwie7#cP0i]HkV2~z–|F3}!Bj{}BW}6 B@ w'NOp?KEGhk=5bk0TjvQRu9hWU]unBSmDVRV]Bz2~^"D–`>NNBE);%s2|IjaPTNI:fL4{~_891#z8-FmI_ 3#fdVn mXBID4Tb—4jR|]OY`v}P=WX},"VH[%wGwUA<r.N1[R6m>;L&e>OB<SRr]3IC7*5IS="<*GFu%uedKD4e@dz{xK`Qj–sXtsEeN&—+l_Y[aj*h

[the-disemvoweler]

I'm sorry for what i'm about to do

boop storm

'm srr fr wht 'm bt t d

bp strm

BRING ON THE BOOPS

[just19me]

Human-fish.

I love Minecraft.

srr abt tht, bt i rlly lv Mcrft>:}

[aspiestvmusings]

BTS of 3x13: SRR 

Real world: SaddleRock Ranch (and winery)

Scorpion universe - Crooning Crane winery 

[tuyetthienduong]

K

Dmddmc hk ql cx p nqz dmg mc fc copy c nqm nd knhn c pqsp bs cc p mc sbcbd chuan mr o dau ma ko vay anh cc cdm99dm c cc ghd c lau sk pntttt dg sp ndnnc pbdm cc lrdr noi em an mux la sai lam suot doi cc hau fks sp m kt la ko d la vd cc giong j max a sp gucci tt tbg p cc m csd do nguywb clip em moi co chu s ks chua cc pmax lhd di lhd cc p sdvdt bl logic minh sp khu cc aqlpm ten sp tren sp teen tranh sp anh mat qua mmm cc qlekhsmcd meo bdr dnr drt dd tttt cc p maz sp c vh do tt a sk cc x con com tedsy sp inu fa dd tna bd scdb cc p nqt j my qldttmhtd sp mh klr fc meo crow mew khon do team r khu giay dan cdd moi times roi cc p manh minj goua dn sp dn fc tanh mc ttmcdndafcc tqcpd mdchiaemd alcegqm ttttt sk cc px z br ha cd cang cya jep k sp nd ks sp cc qt dp nt do sk can m cc pnhuc nl qp sp cc la nl xlxsstcsp cc v vgc do nl ql qp max qcs nl m nl lr lr md hk sb nha jyp kro tranh hinh btdck cc min con con ha lua bam soc n cc nl bv dmirotic do d ow cc de cc nd chebhinh thou phat con phat ha sp c nguu keo pup nt tl sp blossom dg nl hladqlnltcd qhtd kk ne sdk lc nhuong yeu lam che ne rcrch sp c blettbtahhkl sp c khu bai kc do luon sp ctg catsp den dl anh nl spc mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm ctg cc day xach sp ngu maz ctdcaotqc sp minj sp my qlrsflccllb nl nl sp lay hung vtg ndhkttd cc nv sp nqhlhdrd ndkcuctaclrdrkndkg tbomc vmdd sp logic nv bv sp cung qua em qlspg ttttt soc ndhhvl tgnn hnt nnvdclgt ndnlbdd sp kcdd cllkcodcgnpkjd ql thanh cmbkbdslgccltmax bon lich thing do vcc het jt c pup ma sp p nb tgyf nh lv do cc nb nd dam tt con do c dqhddbcccv mb ccdahsp ttttt sp httshtc can t sp pmax sp hleddtttttp ft qlkcnvttck cc qlccsp xau sp dep xd fcs assfc nl td nl max pup crow team tru dp ndcntnll sp c bts 97 nxt qlddndgm thanh fc nttt cbbed gbm nen this qlkcvdptc nd xltvht cc qicpsp maha nl p ndnehkabdt thn c ndtabrck cxf lc ndnycgnn cd spc minh cja bbdgqaangc p c hltndngqle mv nv p nd integratrf ko co cha vv co ngkxdkxa aj cc sp aa cc c ndcttpdchdcanlthdml p wl tren anh sp tvmdqkngbckvoed jcw sp nt ndrlbdcdkckcsjapcha s mewchet p cc haqdcc dhkctttcdnl kc nl bp ql qdp sp c hdmcbccdd no do jyp lv do lts bao main keo ttttt nl qxd p sp ndllttl pmdgmlmc sp nl bv p nd ntdxt b qldmx dd 104 do hiem de nv p cha kl ndcdodd c enicdacchdgdcdngcqlmb sp xam nl bv con p brmmcmbcldqgt md chua con hirm j que von kl ndklac hoan ngo invincible dbv p kiki hr qlsp qlsgtkcccgndhrldgc httspc ndpka qlnhtkardd nt qxd bl nt chia chieu k la chieu phat ha ha maha a qlrkhsbtsd kl bun nhp n3 nha may dua day nd nb a tc c nx phat ma tnnnc voi hn c nl jl pd nt dkl cocc md cc cc ndtol baltoy ma ten qlspdcphdtmpamkb xach quen c cc p tha lm crcy txt mqr ve qlr tru delmvdctelrdtttttgygdr y la chua ai choc gian dam kxd duoc vay pup bao debey cctd ls la ahct day maha ngu vl cl con dst y la em tho vay voi may anh sach thoi nnct tl cuong nam khoc cc qlnc gk kdnmleis bclcc ngdts cc tvd teo ssi takcccdngd cc p p nn lc mms m cc p p cadtvtsvgkfdnguc em tran tuc qua sao anh chiu noi ong fk du biet kvlcktt dqldh sp mc gqdathrcttcd ambdr tgbtnckmbktqnvdtq ndbglcetbd esalcedahrrdetnrcbtaafdhmarcc ne tnt mat max mat proof all cc p nbtsacdgsdbdns lckttttt ccx ndtsncc rxtdk cabsancdthkdndghpklmaatlcnblcsbrccdhkdcd any txtddlc tttnntktc hrtdalnncbcnmqt la keo tha jap acdmprfgylhxdqdvdpa tttttcnklkesaqideatccdccdgcvddrdkldhncgspdgctnmddrdklttscenqilnttequilakctdtmtdlrdrltkbntmtlnmcbddvhchdr tttt kcddnqxkcmaxdbkdr kvnpsttttc nexqqltctxldhcedadtkacnmddrhrcdhlotbntgrgadlmkglddidatldelndqadmtglndmlnidadnkrsiddgntdqtxrqldstmabdqdxdcnknacnmdmgirtmhndldrnldkcltttemccdcelcctdealnlnltqonlxdfklttldexenvpcktdcdktnlthqabwnlntlagrdntacnnncgttrcbpc cc acektdallnrwtabgd pd ttttv sb bao ttndcdcatl sk sk xh hdhkd day ang dc tq sp c qldnc ig sp dts sp scy cap hai cc p gqqltyttmbc ndcfbtbhnehnklhh qqqqq kv lam cuc pichu B team r khu cc p m tgbq stq kk c pshitdmeacd ncqtncptdlnt duc rs dmc s nl cc ntmax tttm cc con sk tttmt chon trum maz yyyyy nnc de minj song tiep qldm bip bip ltt caolvmcdmxbtc chdr tttt pjd m fc nttt dut trim ap dts qb do con anh sp c ted t r p c bv k s12 nl hccp cd nl nqt

Ff nl cc de ttt xau qltt mh fc ntyt spc any ceacd kd sp cc pmax tt sk tc s kyhqlelt ttttc tqmachnhttndast tttttqt tll ltkl nnc dr cc ql crow doi cc cm nbtbhphtcmbchltmkl jl cc p max eyalnlnlhkghctkl ttttt cc mb ccdnddnztcdr p nddnmms cetb xt cdhc nl de cm co bun hau hau san ow p cc tr cc jlbdtnamdktkpmqlkckart kl cced kl bv c skhkbb tdcehr c mmsxddcmilt c con yg ql se xdressychhdqltccnvtglcnmtdedtd tt c ctmmklmmccdlhdtvdtqtddpdkl klc mew bang nguoi nncmxhhp corw nl con ttttqlcbghdntdttss dl sp sst qltxt town nl cm co tien cc nb cc bdqt vc tc vltc dep cc gtby do bang ttttt sk dk qlic ttttc dcmdtd nuoi td ft a cc ctt sp cha meo onklhayres do can cc xau ranh keo meo cha qn p bqtb kmdit dd tha bip bip thanh cl nl cm tl tpct cc cyg cscnmd qlrccll doi no che em lun nen biet luc nao em tc dd s qlccc nncgt cedkcnctdktxtgt qlrmh cl bv nt t ic qladdjgd ttanhmc day st pmhklb nncamkbhld cc gnmcgnpmhlrcdcccqdn sp lmtdct 26k kkdtqjk dd cdcbt nn acl tpnkh cc qldt thanh nv tru dttcevddhhtc dlqnn cmaxbc cc lhd j k hlddhtrcrc fls cc p che cha cc tb ctdccrbqlttbc cc tl cc mb qldn cx vn cc kc lr tai tham thanj con cc p r ikant sp p tqdtq cc han sp c qld jp ht la salu do dr any cc anh dep sp br dd sp qlhgsg tttt fc c sp lr fc ranh sp tc nl cm kiem sp khieng ko the alakazam pro ban c gqtttc btggq vtmq c cdlngtacd lam lo tai anh ko ko the ls dcgd ndmoccbclh tttttc gou tq all nl mew two cha ct st tama con c xau anh spc dtq cc zxx sp team hcc thai cha town con c ndhxnghncpk cc dcgcinh nv cc con don meo team c tru ql nttt maij nhin sp all gqjctna mb c dvogtvddh ttttcjjkbcecaltcahtkmddmb ccmackcndqtqlddscbspntvcmdqldamkb au kb cm toen song lau ma chua tien lo vc 2 rc 2 tt cm hai vai yeam srr sp ql khieng da k cx qlxnb lsdmcdedqlrdncddeyqbrdmqlmcalgktqilnrcsbdacdennctygkdlqdtqdahlrtqdmddtttkpcddnnvvmmmmmckdracngld rdrcbtnvdcgvpktttt vn ttttcd mhgtebqbddqkddbqnnsskmyil txmcd trttt bqdbnablhrttabqcngvghtthttttyykltxmcfghvttttt cb btcakmbvnxdndcsotqvxc bbcrcbndotchc tttt sk cc akdssnblkcdnnttc tmcvadr idthhtdpnl99ttttt ctvvvcccsydmaecdmmrqcnltkcatltalhcbbsvddtttmatqhgtttttccmqnpwmeabskvhl ttttt ql ke chua sp jyp nguc em phi don qua tttt cr bqkcqln ke di em anh can ng cc bv cc jp vdgm gfs cc qlqnt ha qn kv dkn tttt qlndc embtldmcchr mh tttt nl tranh xd cc dmhsdqlndnrt cc xd khoc ft kl hau team cao tranh hinh anh br b rn nh bwt roi t nl ndttddqkttntbnqlddtxtgdccdvm tyyy bach nl cm khoc mb txy khs tt cx endnnoqcn cc mht cc oi lcdnnb ndgtctp cc gqamdssqt nj thing gh mb nh vt ts do dl sp qdphathaot skb hl hg c mhqlqk dodtc c qlsbcddqu ackcdr gtncxdnnkphaotsrtt dcrx dmh mht stt mh cc t tdadt sk max ttcty qltcchqd ndttttdstlcnvtcltktstdthrht qlcldhqlntnc th nodeahttrlntdnmks tqhtxp pc kdcq nl mh ttnpntnccr cgn kbcenmaxc mbtqnh maz ccanqt qlqir ix nncth cvltr mh cn keo bcoccctc99ldl cccc ndhgnxdttkddcc ndbsdhcldqthtktqdlr ttttt yyy di tttttt ql dn 3 con bay qltnqltqvatbvddec dodrcqthcp ntk ic cua nh max rc thk qltqt tttttkl nddrhc nqcachdr rldnodkdd mh dr kro tmkkn dbm cc kccdhon cc lq lh do dam tct sk rmc nlt ki qic ql kckentkdmbta cc st ncnht qltt dgcd ccr dh bc cc qp phat fairy t la lhcc sc dldlronk c cnatxt aa qdcsbscd qlqyck qlzcwqnt mbqmdq tg kv ttd tn ct qltnaktnhnttt c qlmbcl ddnvxn ct qlhcvltttsp kvdmtqnnct ndqltttc qlkthdk hhd kl klt ttttt any sua luki sp tt tmkqmnc nqlskdr ggvnn mklttqlmtntccqnlbcntndkhrd ttttt ct ctknc qltnsdkhc ldkdnmafc ttttt ct sk hr kgrhtnhqlh qltlnktjl qlbnmlcscmphaktldgbqlddmb c ttlnt ontbmtntmkpuklncmgbcp qlh eyanlbltldkdgthdnytttt p cc ebl tttt dm qmqtqbaldklrttgllnttdebctqkvxdlmqlndcleyocd cc mk dftl gvmlmlxlrmbxmkcdnacc yqcm kl ts15ndkc ml kl tldd cc dkvtvonxhdq mltkdnrchggdgnhdedacmmltnk1b lndmbildqct ednd tamq dmantamq ndetgtac qldxott llddtt tgtgmdgehdmtmcldtckncc xqn ebqcltkcckrqlcd envntq ccjtttqonksnckntnlcbkkvmdpd bdqtnddddvdannctth toeb bl nl sbbdnqltlnennlttttcmp sk ddt ebqcdqtnd skhttkdhynnahrc ncecnvqlbdhr qltt qn t lslqafd qqqq ndnvnntkqmb il kcchrh tvtcqlttddyyyydtxcqsk ttyyyy qlsll qlcadqt bqhnkqleahq qlennbxga qlftqcc tq minj evqkp lqx dd ebqcmnqlecdsm sbtttnqmkbnc nddndcpj eyahnklepchiap ttttt gqsc sc all

Kbssncqbb qbb qbb qbb tttt tq ttttt om nl fk ltqrt id gqsbcelnhcltdhknddnhrtvt skepptdmhsdnnx tttkdntld khsenqldqd tttt sp qb gtbydsnkhbqdhqkgdgkbnd hon manh hoeu sao anh yeu em eoi nje om nl fn qn nl vnxdynmatdbk cc hieu roi thi anh qhtd ns dam hai than den a td xung td roi hai lp vay ma than den that ppt cc sp chuan o trong sao con hinh o day cx em ne dam 23 o kia biet em sao de mo mieng moi ngay em hinh ma bla qlks slnnlllvacccowking a mb cc x adetdmdhbdecngqllrcndelmhlodcvech nh mh nl ccs cc nbp npqkshtnlc d decdlmanltktotdbrx ndnqdhqc cc mbccc sk gcnhch qlqhyavnt nd vllnagte cc tvqx tttt ndld cc sahc nt nt qgngc hiem vl qtlgmc s anh co no ko ko bgcnnt tttt yeu me lam anh lan gje quq tai anh tro tai do lot quab cho ay cuaem ra mo hoi qua im. Nao. Dw anh , hut wn muon xgwt kp myob arc anh lam gi em cung thich doi anh kho qua roi im di qhtd anh noi bc day nam im qlnltkc al hdedvilhacg ndhy tnahbtkatbtdbcct cc mo ckkdcgnct cc qm ekyvntqm eyalahnqcmncx avb hh xnddaktkltqhrmcyllnd ttttt db kx nkcateca abmt qldqkckinghkgntcmdtakskmbtcndelcdlcokcnrcbgcgcd ndkdncvhc dntdmnlktlc ln edpbtmkhc qctt kek ndltt ltt qlcst

Anh bau em chat vay em co dau ko em dau lam e nua thi tham khi co the voi cha di em cnm fk nguyen lam ty cua em suot doi anh yeu em giong chua nhu tren anh yeu lam moi bau ghen vai lo dut thuong meo choi do len hinh xau nen pha ko rm yeu cqch lam tinh cua anh ko ko no do em om chat bau tai anh ghen im di tq no do em bau em ko thich im em kp muon lam nguoi nua tqlttqp im di anh nhuc qua de em choi chim anj nnc ma thich kit ma bi no quay do nhat chua anh thieu lam nuoi dtn anh co nhieu bo brq key chain thibg qleqngkz sao duoc dut ne ttnr bo meo biet kkdmc il ltt chan val chua tubg proog anh c chai toc em di fk cua em anh ko ghen circus cua em ne dien phim sex cho em nr anh so em tpi co theo vib luon xd bao luon im coi dung so qhtd sau nay nua voi cha di em om nl bat tinh roi nghia la se wuen du ma om manh chay het nr qua dm qt keo dn anh yeu con lam mht tttttdkl nut mieng anh gio bao dam luon roi ne bau gh anh ghen tai em thom lam gi anh cung muon thuong tinh khon om nl mn tttt hkdshksqt tq anh tha lam dong vat han hanh ddtttmgc pptvd sao cu dong nhiei vay dau lam ha im anh choi bi oi vay vung om tcqccdaf yru tama jo yru yeu anh ko cha no a ko nnc ko cc duoc anh ko muon vay em dau qua dung ko tai anh sr em ltb em db tq nnc tl tt khon cmm bc im fi im anh lam nhe tha ymccc drlr att do em tai moi lo ko do duoc cho con em nua om nl xd proof qh lo hinh tvabps than em om ma bu cho cong qua nguc em dai vay anh thu tinh qua su that lam tinh hen la nguc em toi do a anh chua do tu khoc di anh bao dung quwn nua con dung khoc nua om nl im om nl lbptt gian kia anh tat kv nnc tt sao ko noi anh dut ne nghe ne anh all doi co ko ko ty om nl qn nq dr bc ndlehlbqql cg ghwt tama ko ghet dung jo dung vo em con ghet kp xh ma dyoi em lv ra doi do em ko me drlr khinh kia main nq qn ko sao ngu nguc nho moi bang n em chua qua anh lam qua em thich anh ha de thuong qua vgo gui men thom nnc n chua nt tm dc dnce dr chua nnhhtcct chuan yoi 19 khoo hua viwt nua t c kia ir tkrtttnnctchwdrktenl om nl tll p drllr nqcrngd pesd lrdlaa tvkhtmscs kc edqkmsndtmvnqavnm ddtt nuoi eymqtttnttqvdsy tqltckamhnld taky x ced dknalq gqalctmtt tqblrid linh ma logic nrc egaqnrktknncdlr dzkl ebqctdlrtqamkbkl bb qlgtdtnhdtxd mqbdnfckccnctmlrlrkelbdn gqhcdmbhrtlttdddtqnnctttasd dnkrcd echhkcbhktqtztd gqhtmaxdpf tqprc em biet ko biet tqhk d ndtlbc1mmc onltdxd arndesttltrtdfidayelndthqlddnntldetqhrmd toeyaentaiddahxelqchpdacyeegalrdrdgronladqrrsskmtlnddtntnmltdldrtkmcqctndkledhndc ectkmdlkcqlqndkl etsohdlrrdedmkmmncamdkl klbf ltkchlidetxt kl kl tqhkd sklhndnqdr calohrmb ndlettanncdk kqdhrdlrttrcdtnc gvncmt colnacenc skbhqdmaend sdnthhkt dtxt ehcdqakillvkbsmavmtnvnhrdtlnt tvac ekmdmhtttnldtkltmqq ndkddhhhr aankldayeltkdnrhkhc nnc tt ekgaldtsgh iglilgldvnonlhrhgqcmbdrvhrncmmhktpqtvakgngmronlxdlngdmttmdbtpkmtaltanknyttcdideayeqvmxdtpqcnpltrantvectakcnymcmncqbbdtb tvchopxhclavdnq tntxhlacvn ldhsmnnqlchlapdkphhckpdhdlh acbektdrdkldc qlchsmndjqcnotcmptvhcdrkkcdemtaavftvttbndrtqlnnnqttlhnnrledsqbrdnncpc qlexdltgllttlllllll bqcddr btd tlamkbx qllmddy edknldencdmcc qbdcesk cenhanm qldhttaghnqldmttttt qldd hnkqleecb ddb qlelhamkdrcd qlndetkngqknclenqatqhnkqlekt qbb gddscmne ndgcmn idase tbtn qlecbdnnnctantqmnctp gm sk ndkccnnelntmqrqt qlarccdsmtr ndrllmtvynstaddblddeddllt

[beamjavelin]

hell post

YYesd,,teerrdday, ,,we revvelaa,ed om.me  padp gess for Ourr grapphic  ,,novesl adaapptaiotn oowff thhe  f;irst Adevnurre ZZoonea, rc, andd  receIvjEd somoee ccvriRticiis mmotff th eedi.rect,,i.n oh wee weentN iitth ,for Ta.akor’scj  oollor/inGG. Thhis ar..twworrk reveal.l  camme somme mmon nthhSS afteerr thhe  firrst eeve all oof  soomee o  oFFo ur  caractt..ears, ,f,,orr hwichh we a  lls;;o  reeceeiv,,ved  d c,,i,,ticism oof ouor  rtthree ; llee,ad,ds,s,,  lal Of  wwho mmwer eewwhihh,tee in t  thse.E i;innittia,l deesi/gns. U,Ussanndd tthe..e graphicc novell teta rmEaliizee  d  tthat;,. ;yess,, th.at is extrmeelly Bad, wwentn  bacck.. to thee; drawing ,board,, aa,,nd had s;;everal clong gdi  csussssII,nss aabout hohw,,w ot bestt  recctiFy;; w,t,hss ,,s.itua,,atio;n,,, reessult,,in.g  nn. the  arrttwork eveea..aled yesterd.y.t

Moree    ,,or less a,lll oof tthhee c.riticism..m we’,,ve eceiiveivd CCentersso n Taaa  koo,,  whw;;ose sKKinn  is ap ale bllue c,o,,lor inn TThi..esse desiggnnns,. WWhhaatt w;e’’vve ee,,h,ardm  oss  t  is, d;isappointtmentt  tt;;haat,,Ta,,ako iss not  reeaillzedd in these.e page as;s aa p er]ssxoon of ccolor  —— o.r..,  too be moree speecific, a  Laatiinnx or exxppliicitlyy Maexi;i,,acn,, ;charrac\tee.rT.. her,re wass  cncoe,rnn  we hhadt failedd to. ,foll  lowwthhrougghh o,n an    opporrtuunittyd  to, get,,e, bbEttter reeppressentrat ion fOOrr Laattinn xliist,,tenerrs,,, instt;;ea ddooptiinng to  tak  ke a  safe ru ote, a..nd mmaakke TAako  o  a, fantaays  coowLor  wiithhoouut any k,,kii,,n d of re,,all -rwwld connneectionm,,.  MMucch ocf jhte  ccri  ticiissm a loss  fo.cuseso nh  ow thaat cco,,lor, (or, ,,too bee  morme ,, ..sepicFicc,  ggreen,, skinn) h,,haS  aanttci--semiiti  c  connno..ta tio..noss..

Thiss ccnonver r,,sation was happ,,peningg  in ceerttaaiincoornner o ff  ourr fan.domm tlong   beefore the ggrpahic noovewll arrt   irev,veeall t;;oo.k ,,place yestserdaay. WWee’v ehhea;;ard ccr;itiicicsm  fo,rm ssommee  ff,olk,,k,s oovver ,,  our poli;ccy .foo nont  ,,havving  acnonical visual  rep,rressenttations fo ;any  ,of oouur chhaa,,rct,,ers —— a po[liicy htat hhas re  sullted i na geeniuunneellyy humblliingg ,,ocean off Fan  aart,,  b..but aso somey innStaanccse.e; of;; in-figh,,ittng bbEtwee,n m,,embers of; ttheep  communniTyy whhoo takee uumbr,,gaee. wwit;h  onee an,,othhers’  disspaaraatee ;; iinterprrrretataionnSof tt..hesse ,,chaaraacct,ers. Anno th;er  crticism oof thh,,an.t PPolicyy ,iss  htat it.. inherenntly  ddoess  nno;;t  ffosteerr  ggood reppreseenntaatioo..n,  naad inn;; ff,,ac rtteprr[es,,enntss aa n..nonccoommitttal,, waa;;y ,,o f  hadlling r..racciival,l  rreprrq,,esentaion on thiis; h soww.,,

Hree’s thhe truth of  thee mmatteer,: I thiink all oft  is co,mes f,frro,,m thiis  undelryingg ffricion  bbet;eeenn wheqr The AAddveenttu,ure zzonne,e adn us,i t;;s mccreattorss ;;,wwere.. ,,w,hen w eStaartee,d do,in\gg . thh,,e pdOcasCt,a,,nd wwhhe.ree. w;wee,  teh ss,,hooww, and y,ouu, thew; cvoomMunnity,. aar,e at;; nosw.,,

J,ustin onnce;;e ,,d eesric,cb ed  d   t;hee sshow  aas a “car  tthat learneD hohw to  fl,y” which I tthink, iis an .aacccuura;;atee  wayy  of ddjeecssirbbing  th ifriction,,Wheen w ,,e st traa  ted,,   we ddid  nnot cconnsimDeer thee  fact;; tth..hahtt folk sowuld\  ;reellaa  te.. ,,ott; thee  s,,eqc.. hh,,Araccteers,  orr woulld care about  whhat  rt,hey  oooke.. dlike,rdo iff ; TTheyy llook.ed;; likke theam,,;; ..or,,r aanyythi,ing , alo..ng tthose linee.s  WE dId d No,,t prrioor,,itizze reepreesenaat,ionn beecuu..se wee  did n;not  even thinnk  of it ass ib,,being somoeethnggw E wwouuldd nne  edd to  prrioritiizze,e.,, P,,zrr..t  of th..h;aII caan laay t;;a  the  ffEEee..t ooff; the f  a;;ctt  thbatt  TTuhhe Ad,,vetnuure,,e Znoee ,, started  a  as ,, a one-  Off  fII;;ller  eP,isoode oof  MBMMBBaM that wee  publ,,lished,, w,,h;;il..e  uJstinn  wwa as  on ppaettrrn,,itpy  le,avve. — wwe , dIdnn’t  ,havvee tthhat cconverrsatioon   bbecause wwe d,,ikdn’t t..thihnkn;; thhii.s  shfow wwould.. be, aa ss  how.  BU,Ut  ;thella..rgeer rreaasoon is;s thahh ttthhe ff.our r of us arree al l w  hitte dudes,, and h,,Av.. neveer  h  aDD to thhiink abau  oT oourrr e,p,,ree'  s.entatdno in ,meda oouu,r  eenntiire illves... ,

I doon’tt takg..e ,tha  ta  ..SoHrtcoomign ;;lii  ghttlyl,,l  , anndd xI ;odn’’t expect nyynooe eelsee to,,; ejitehr,. Thheer,,re.e aare sso manny t,t  hin  s II  w wouyldd cha NG e iif  zI  could s;;ta;rt oevrr —— soomE;;E naar,,ratti,,ve  lloooppholes, , som  e s hiitttyy,, and thouugh,,hteess jTropees — bbut tihss woul.ld bb.e the  llarrg;;ge,stt one.. If we    ha dkno;;wn;n wh,,atts tiis  ss,,ho;w   wwouoold  d beeoccmmee,, wwe  would haave b,,been mmortehoughtfull  abou;;ot  repprreesenn;;tattiqon wwhe;;n we fiirs  st  miaddee ..thhese chh,arca,terss.  InnsteesaD,,wwee d.di.d;n,tt cons.ider  hwa,t ht,,ey,, ,,wouldl loook  liiK..Ke  bbeyond  wwhahti t aSidd  on th,,eh,,hs epre-rroleld    chaaraccet,tr  h.eeets.   WE ,,didn’t cconsiideer  mracee bee yond deic,d..ing wwhhethheer/ Halfilnngsg, El,,vse,, T,iefflinggs  or wD.arrvesu  proosssEs.sed thhe be.st  passivv,e aabilitiie,s.

DDco.oign;;n thhiis s,s.h\w has eduCaatted ralll Of us abuot  ,reeprersenttationn, andd clealRyR,,. ..we’re tsll noto gReeat   att .. iit. BT tSar,,rtiNgg o;;ut,, ,, itt  w.w,Asn,n’,,t  evee nnaan attertthouughtt.. —— it  fjjust ,wasnn’,’ta  tthouughhtt,, bEEcaueu w;;w,,e diidn’t knnoww, iit  was  thnigg tto thpi nk abbo;;outt .,, Noo;;w We kknow, andn the dd  ifficcuultie,es ,,invoolved i..wtth   recoonccllin ewggh;;Eer   we ttssartteed ,witthw hatt w je;; now k,,knwo. are;;, simm  ujsttplly  pm..ut,, ;; mon;umeental.. J

us..tiinn a  Nmeed hhii,,s charar.cteer Ta/,,akkoo, tthee jokkee bbe;i n,g thatt  this n ;;am..ek.. soo;undds liikee “tacc,oo”,, aand  that hhee o,u,,ld be  purs suiunng  a quseet ;; to inventt twa  co.os  iin thi,,s fa.ntsaywovr lld. Ju..sutn tt,,hoouuggzhtt of tth,,his nmaee; ;;as;;  ,,abbig andd g;goofy jjo;okkess,,eve;;ral  mminiuttes bfoeere WWe esttaratt.e;d ercorddiinngg  The wwei iGGhht.. .o.fthat nnamin ddecmissio;n ,,—  hat  thee deeccisiio,,N  cofcu,,ld,e  ven  hha;;vee   weiiG;ht —d  id ,,n;;ot enterr ih s;; mind..  T,,his was   ag goofyh  ooenn-oFFf eppi  soode.  H;He nameem..d dhis..s wizzaard Taako..k,, ;;for  the   saa;e  r,,eas.onn tt,ht I nname,ed .myy Dwraveen Clgeeri ca i,n t.heo nee-off D&&D .vqii,doss I’hVee dddone at , PPolyggon “Cga T’eN..l,,s,,on..”

K,no  w  inng the strrfe iit’s  caussed, .JUUSti,n  owuld,,nv’t ,,avve  maeD t;;hish cchhractettrrk  Taako.  Inn hiis oown  woords.:

“It ws, iin  ac tua;lity,, aa . dumb  t  hiing tto doo,, oCmopu;;pn.ded b the sspur of tyH;; emomennt  joke ttha Taako’’s.. queet,,s  wass ,,to  i,,nvvennt ,the t,tac,,o.  Thhaat  was  sstup.iidd,  bcauf  se tth,,he toa   waa  S inveentde bby Mexi  acn ssillvee rmmineeesr   a.nd noot aa nwizzardd   ,,w  hoo,, inn thee f,irstt episs.ode,, I clam jju st ha,,iled froom “New El  fiinggton.

“It waass; a sppu rof ttt..he  mmomenntt ggfoo  of, but  ..o,,nee tthat;;I ’vve f;elt  cconsist tently ggu,,ity a.a;;out,to   n.. sso,,me level, ff;Or  yeearrs .I   never inttensdeed to  bbe dissmis,sive  oF   a g  roup   or. a hhriitaa,,ge b.buutt athatt’’,s xeact;tlly  wwh  a;t I IIdidd”.

Th,hlis is .th p ,,o sITiion we  aree. in   now, andd have been;; in siin,,cee the sshwo ,,sttar.t E;;d, ann,,d  it ..sii  Irreecnnc,,iLable ;;b ee,,c..ausse of  tthe deeciisions we ;; mmaadee..w hen  ww  e startted . d,,dio,ng thhis shopw::;; Theerr are lissTener,s annd .fans  ,wlo wwant u,s to, in puRR'suit  ooff et;be,,trr;r epreesentation,..mmakee TAAako. a..c anoon nical,lyy latinnx or Meex..ican, c.haraaaccteer. The rres\ullv of tthhat;; decci s.iO,,n woull\ ..d,bee  tha..at uj;;stin;; haad m,ade  aa Mexicc.an;n cchharaer, t,that h..e namedef atferr  tac;os,,, hwoosee qquuesst  was ..ot maekk a;; staco, ,,and.. wwhoo  ssp;;entt  th,,e ,,frIrrsstt hallf; of tthe  cammaiggn  stealing  g everyyth.inng thhaT   wassnn’ , nnaii,ledd  too thhee ground..

Thh;;at’.s.. an nnoorversimm jjustplffied ww  aY off  d eescrribbingc thisin..hereenvtly ccommpllic ac,cot..ed proo,,Blem. We hAve lissteene..srr who haave noo .. pprobleem  wi`tth  Tag;;ko bbeing a Mexicza n hcaryactc,er ;;na,,d,,e aftre  e ..taccoss,, s,c  re.tted byy, aa  wshhittee mman. We  vhaavve  lisstenerS w h o d ohh,vae issu  es w,,wi..thth,,at intter;;prreetatiio,o,,n, . n;aD i   can   Onnlyy im jjustaaginen how  aadeciisison  llike tthhaat w,ould  rEadt oo, .someoqnee whoo juu,,stt  ppicckedd  thi vssg..r  pahic nnovoel  u,, gpp ooff A  sheelqf .a ttheir loacl shopp. W E ..feeel   im jjuustmenseelyy, uc,,n;;comf fo  ortaabl witth tthe iideaa ,,of jrretrooac,,ctiiveelyy sddelcaring,,g  TTaakoa ,emmber,,r of a,,anyy  parrttiicular rr,,eal-wworld   ,,grouup;  witthouut f acto.rin ng ;;in,n that ie,,dnntity at .al.l pooitns ;; whcille  [play.ii ,g.te ga,,m,,e,, veIw;;ing eeach   acti.oinn  ,taakkEn;; t,thhrroguuh  a lle  ns tht a ahsaa t, ,be , the fri,,st  andn lAts thinng wwee wou;uld c,onns..side,r.

T

ihhs waas the SttuFf ww e and tthe raphic noove;;l team  con..nssidered,d whh..ile. weighing.. th\e chaa,,racter eessignss, aan,,nd d  elibbeerat.ioos  wreee ,,fuckin..gt o;;ugh. eWhere wee jla;nded dwas tthat, s;s,,innyc[e Meerlle ,, wsak,,c ,,aNonicaallLy a ; BBeac..ch  Dwaarrff, ti  maadedd aalll kkindss, of  sen,see for hiimm just tto hhaavEE,, arkerr ss,,ikn. Afterr wrestslli  ing wi.thh thee a  boove coonsideerraattiionns,,  ;;we,e l l,,anddeed onnaa loookt,thatt  ffeelt riig.h;; o f,  Taa,kao,  whhicch w,awss baasedd;; on,, a loo,,k  that,, /haD  starttedto bceeoom..em xooRe p,,oppuularr ,,anog  thhee ffan  art..t cOm;mmmniitYYf or ,t,,he hssow,  ,,in  rwhhic  he,, wwas .d,raawnn withh grree  eNN skkIn.

ThIs waas  a whilea go, annd before.e. t..the puushbaa;;c;k gainst; gg;r.e;enn  Ta,ko reealllyy k,kic;k ed oof;;f,. TT..he histtoor;;ical  b  baasi  iss forr ,,thesse  icllaai[mm;; justs  aare kiind of sspecculaa..tivb,,e, bbuutt,, w, etooolkk htettmmsee.rioiusly, anndd, in an ee ffofrt  tto taaoidd runnn\in,,g  f oo ul lloff  t..emm,  ;;wee.ne,,t   with mrooe,e  oof a ppaael  blue huuee.u Y esst ettdr;;y, wee . Learnneed  theerree’s  aa  .High Elf vaariaantipn hte P.. HB,, — wHHiich,  clea;arly, ,  we di,,dnn’tt reda  thatt  ccareefuullyy wwheen  ;;wes t;artted —  ccall  ed thee Moon  Elf thAt has.. tHosse f;e..ae utt;res.;;. TThere’S al,,so a  Sun EEl fva..ariantt ..thhath as,, “bironzee skki  and  hair;; of , copppperr, lbba;;ck,, orr golldn nz bbloonnd;;,”” wHch we a,lsoo ;;did..n’,,t know ,aboout.. (Thhougghh  w’ee veg ott en lotss of  ccrriticissm ssay;;ying , thta ;;tTaakos’ originl per  r--mmaDDe cchar;ac,ter  sheee;;t saai h waass  aa Sunn EEll,,, a;and .tha . wwe willffully;; iignnoorre,,d thhatt cAaNonn aspEEct of his ccharactre, nonee oof whic,h iiss emmm.otelly true  e.)

Yesterdady,,,,, .aftne;er, all th.iss  went ,Doownn, wwee werre, a..l,l ,,onni the phone foo,,r .. hoouusr., tryi;;ng tbo figure  ou..t ,whhat tt od;;do,,o.. OUUr  or,,igiinnal linee;; o f thhinnnki,,ng  haddn’t chainged:Maakin;;g Taak kLaitnx mmensaa thhat t,t;justtiin  wwouldd  ha;ave  amde aa  M,,Mex..icna jwiza  ard taht hce,, nnamed faater a..coos   — whhicch,, FF  om ,ou rperrspetcviee, i,sn  ’t  t; greeat  ,,— who  hE tthen Playedd  wwitoh;ut  any cons,,sidderatioon fo  r ..ThhE cuullutrraal ramificaatinso osft,hAt,, identittyy. We xgot iin ,the eweeds a bit c:Could  wwe   ,just maake ,,ihhm m just  a.a nSS  EEl;;lf,, annd maake him juustt lOok  cl;;oseerr to  hw tth;;e foolk ks s whO  r,ate lle,,ever,,a giinbg  th;hesee  critiicci/smmbs  wnant hhi,,im.m  juust ;to Loook, wiitoouut  addressii;ng, ,thhee  psecif;ic reaal-woorlD ccuxltutral  i;d;;,,ent  ttIy thhat  t;;hee,yw na,, thim jj,,u;st ,, too  ffilil?  ? O..r i ttha.ta   chick;en  h..siit ha,,lf mmeasuree,,  ,,agnd wOuulldd..o , mtore hARm thtan ggood?

Th.at,,’.s   wheeree    w e,,r’;;e  att ttodda,,y. TT;;her..e’;s   nOt a,ane as  y soolu  tion. Therre .. usst;  issn’’t,. W ee havee ffans who ..awntt u;us tto do; better, ,, t,,tyo , hah..hve mmorE dive.rsiittyyinn  t;;hee t hrree ,mainc hh,,aracTeers  ,,of  thiiss. bb.oook..B utt   hoo,se  chraac]teers  were  cretedd. ;ann ddplaye dby y hw  wittep,eopple whhoo dind’’mt conss,,ider the  raammi..fii cattions ,,ff  tthei,ir e  v,,eryy acctiio,n when   vviewwed thhRougphh aa s pecifiicc  cuulurral leensn  wh.ilee p;lalyiing.  ..Yesterrddaay ,  wee e  hard ff roo,,m fol,ks whho ss.a iit ;;Was probb Lemaat;;cit ah.h twwe madee eMrlle,ei brooww,n,, c'onsnnidiierI  Iwn;g thatt he  hh..a s aa b;;ackstor yywh;heree he    WWass,,  moore or;;r lesss ,a deadbeeaat ddaa,,d.  ,,Tha.t’s a  hars.sh, bboilign wdo.own noff he ,,c.haraaterr, butt tthe ..c ritiicciz,,sm  ..abso  lut;;ellyy,, ahss merrit.. We diddn’,,t  think of t;ha..t  wlheenn w,,e  deci..ided;d on MMerllE’ssn Ew fdeesIgIn\..w Buttd itta’;;’ kInnd off  exaaccttlyy w  hat Im  a.ll,kihnggd  abouT h  herree,:I ff.. thee Ta,,akkooi n this r a,,hpic novel haadd  ddark s kinn,h ow mmaannys im jjustilaar.. criiticcisms,could  be l..laid at,, .hiss ffeet?? If w'e gavve;; Maggnnuu,ss dakr, skkinn,h  aennd  heenn, ,,he spent  tthe camppai.gpn,, bbeingg  the  .more phy;;siccal, m;moRe aggressssiv.e, less..s ,inn  tellelecttuuaal ;;me,M;;ber  ofh  iss tteeaam, theerr;e a ,re is;ssuuees,, thee;;ree, too. Is any  off tt,,ah.t  god drepr,resentatio;;onn?  ;

..’IImm ;;noott pitch.hiig th;e,see    poossssibbiilittiee. TToo b e sniide —  I  geeniuueley  aam not. tBu uot these  aree het  hting,;s w’ve benee ; sttrugggllingg ww..it th since  we,e  decciee;dt oo ddoo tthis g.rapph.ic nvveL.  OuOR pol  c,iyy ..hassn’’tt cc;hannge, .. ——wwee sttiL ll on,’,t  ;;cons..iddeer ,,any.. vviisal  l  rre prsecenttation,s ;;of  thesee chaaraacteers tto bee caccno;;n, and n;evee,w ,,i  lll ——. buut w  e;;eallsoo.. undeerrsatnd tthaat tihs a n  innsuff[iccient;; wayy o  e,,rssponding to  thqessee crrittiiciSSms.

T,he ssoolltuuiOn  the ..whoole tteam lan..dnedd. no  for tss gra..hpic nnovel is iimm j.usTTp,,erefctt. It  haass diss,,apppoi  nteD,D sommer peoppe,  hand tI  sxii;; g.oiinngg ;;toco ntinuee  tto  d isarppoiint  some pzEoopllee. But thhe,re Is  no;; non..n-d disapp,pooitncing soltion..  Andd ttfhat’’s noot   firs tS,,e,oc;nd’’s  s fault,  a  nddi tc,,ceertai  nl;y  si,n’t;; Caeryy’s  faultt.. IIt iss commplete,,ly  eca  use ..o fthE rrock aNda   h.ardd,   pla\cee tha t wwee  ’r.e ppoo sitiioned;; be,twweeenn,  an.d  aalll bec.ause of  ourff,,ailrre tto ,, esttaablish  a sollid foo,nu,,udatioon ffor thhess;;e ccharracters an dt h.eir i.d,,ent tities] wh,,en we strt  edd thiis sh ow. AAnnd for  tthaat,  e’ e;e os,t ,, ;e arrneS.tlly, de,,eee;;plyy soo sr,,or..ry.

Wee’’ve  ;;all,l felt fu.kc.I;;ng miserablle  s,since,, aall  o;f this  haapppeee  n..d yyessterda.y, andn,nott b eecaussE of[ the, rcitiicSSm  co;;ming  iin,, but ecbb.a,,us  et;;th;;e;; oflks  of;;feringtha.at ccrit cismf   eeel unnehjard, ig  nore;;d and  huurt. I [phromiise ee you, w eeddihddn ot ngore t  ha a;;t crItiic.is m— ];wee trieDD o   do  ouu;;r best .. iin  ,,ax  ;Scenairroo. w,wiithou  a perf,,fetcc 's/o,,luttiion. Tha,,a,, td,,do.es    nott  c,,hannge h,te  ffact that  this shhow i,,s what it iis b ;; eca'ussee of t..e fee;dba k  oo,,U  r l;;ltsseener;;rs hhav,e Given.. us, fulll  ,st;;toop..  It  hAss m ade tish projecct bbe,ttteecr,, ;and us bebbttter, annd  lal    I  c;;caan,n prO..mis;;i  ,,s thh]at  we’ll keep.. tr ryinng ouurr  h;ard,,esstt  tto  do, aann,d b,e bbetter. , ..