#Appointment scheduling automation

[precallai]

AI Voice Bot for Business Automation: Turn Client Communications

AI voice bot for business automation change how companies communicate with customers today. Businesses need faster response times and better customer service. Traditional phone systems cannot handle the growing demand efficiently. PreCallAI offers a revolutionary solution that transforms phone conversations completely.

Our advanced voice bot technology automates customer interactions naturally. Businesses save time while improving customer satisfaction rates significantly. Manual phone handling creates bottlenecks and missed opportunities daily. PreCallAI eliminates these problems through intelligent conversation automation.

Companies across industries struggle with limited phone capacity. Staff availability restricts business hours and response capabilities. Customer expectations continue rising for instant service delivery. PreCallAI bridges this gap with 24/7 automated phone conversations.

What Makes PreCallAI Different

PreCallAI creates game-changing voice bot solutions for modern businesses. Our technology understands natural language and responds appropriately. Advanced AI algorithms learn from every customer interaction continuously. Speech recognition accuracy exceeds industry standards consistently.

Real-time conversation management handles complex customer requests effectively. Integration capabilities connect with existing business systems seamlessly. Customizable voice personalities match your brand identity perfectly. Multi-language support expands your customer reach globally.

Appointment scheduling happens automatically without human intervention. Lead qualification processes identify high-value prospects efficiently. Customer support automation resolves issues instantly. Sales conversations nurture prospects through personalized interactions.

Advanced Features That Drive Results

PreCallAI voice bots handle multiple conversations simultaneously. Call routing directs customers to the appropriate departments automatically. Sentiment analysis detects customer emotions during conversations. Escalation protocols transfer complex issues to human agents.https://precallai.com/

CRM integration synchronizes customer data across platforms. Analytics dashboards provide detailed conversation insights. Performance metrics track success rates and improvement areas. API access enables custom integrations with specialized software.

Voice recognition works with various accents and speaking styles. Background noise filtering ensures clear communication always. Call recording provides quality assurance and training materials. Backup systems prevent service interruptions during peak times.https://precallai.com/

How AI Voice Bot for Business Automation Transforms Operations

Implementing an AI voice bot for business automation delivers immediate operational improvements. Response times decrease from minutes to seconds consistently. Customer satisfaction scores increase through faster service delivery. Operating costs reduce while service quality improves dramatically.

Staff productivity increases as employees focus on complex tasks. Missed calls become extinct with 24/7 availability. Consistent messaging ensures brand uniformity across interactions. Scalability allows growth without proportional staffing increases.

Revenue generation improves through automated upselling capabilities. Data collection provides valuable customer insights automatically. Lead conversion rates increase with instant follow-up processes. Appointment booking rates improve through immediate scheduling.

Business owners gain complete control over customer communications. Real-time monitoring ensures quality standards are maintained. Customization options adapt to specific industry requirements. Training time is reduced significantly compared to human staff.

Industry-Specific Applications

Healthcare practices benefit from automated appointment scheduling systems. Patient reminders reduce no-show rates significantly. Medical offices handle prescription refill requests efficiently. Dental clinics manage follow-up calls automatically.

Real estate agencies automate lead qualification processes effectively. Property inquiries receive instant responses and information. Showing appointment schedule automatically based on availability. Follow-up calls nurture prospects through sales funnels.

Professional services streamline client intake procedures completely. Legal practices handle initial consultations efficiently. Accounting firms manage client communications during busy seasons. Consulting businesses qualify prospects before human interaction.

E-commerce companies improve customer support capabilities dramatically. Order status inquiries receive instant, accurate responses. Product questions get answered immediately without delays. Return processes initiate automatically through voice commands.

Implementation Process Made Simple

PreCallAI simplifies voice bot implementation for any business size. Initial consultation identifies optimal use cases and strategies. Custom script development reflects unique business requirements perfectly. Integration planning connects systems without disrupting operations.

Testing phases ensure optimal performance before full deployment. Staff training covers system management and monitoring procedures. Quality assurance protocols maintain service standards consistently. Performance optimization continues throughout the implementation process.

Business goals align with technology capabilities through strategic planning. Customer needs receive priority consideration during development. Workflow integration maintains existing processes while adding automation. Change management supports smooth transitions for all stakeholders.

Measuring Success and ROI

Key performance indicators track system effectiveness accurately. Call volume metrics demonstrate capacity improvements clearly. Response time measurements show service delivery enhancements. Conversion rates indicate lead generation success.

Cost savings calculations compare traditional staffing with automation expenses. Customer satisfaction surveys reveal service quality improvements. Revenue attribution demonstrates direct business impact. Productivity metrics quantify staff efficiency gains.

Monthly reports provide comprehensive performance analysis. Trend identification reveals optimization opportunities. Comparative data validates technology investment decisions. Strategic insights guide future expansion planning.

Real Business Benefits

PreCallAI customers experience dramatic operational improvements immediately. Phone capacity increases without additional staff hiring. Customer complaints decrease through faster response times. Sales opportunities multiply through automated follow-up processes.

Administrative tasks are reduced significantly through voice automation. Data entry happens automatically during conversations. Scheduling conflicts resolve through intelligent calendar management. Customer information updates occur in real-time.

Competitive advantages emerge through superior customer service delivery. Market expansion becomes possible with multilingual capabilities. Operating hours extend to 24/7 without staffing complications. Service consistency improves across all customer touchpoints.

Brand reputation is enhanced through reliable customer communications. Customer retention rates increase with improved service quality. Referral generation improves through positive customer experiences. Market differentiation occurs through advanced technology adoption.

Getting Started Today

PreCallAI makes voice bot implementation straightforward and efficient. Free consultations identify specific business needs and opportunities. Custom demonstrations show exact benefits for your operations. Flexible contracts accommodate varying business requirements.

Technical setup happens quickly with minimal business disruption. Training resources help teams maximize system capabilities. Ongoing support addresses questions and optimization needs. Scalability options allow growth without system limitations.

Transform your customer communications with PreCallAI voice bot technology. Experience automated conversations that build relationships and drive results. Contact our team to discover how an AI voice bot for business automation revolutionizes your operations. Schedule your consultation today and start improving customer communications immediately.

Conclusion:-

AI voice bot for business automation revolutionizes customer communications with 24/7 availability, instant responses, and seamless integration. PreCallAI transforms operations by reducing costs, increasing productivity, and improving customer satisfaction. Experience automated conversations that drive results and business growth today.

[lastoneout]

why are doctor's offices like allergic to actually just giving you their phone number

[theleadmarkettlm]

5 Email Types That Should Never Be Automated and Require a Personal Touch 

Email automation is all in vogue these days, with the majority of businesses have embraced it as a core tenet of their email marketing strategy. However, it is wrong to believe that email automation could be effectively employed for all your email marketing needs. For certain situations and context, using human-led emails are still the best way to go to improve your conversion rates and your bottom line. In this article, we’ve listed the 5 email types that should never be automated. 

1. Appointment Setting 

‍Arguably, appointment setting is one of the most difficult parts of business development. Its goal is to offer a prospect a good first impression of your business and gets them interested enough to meet up with your salesperson, and ideally, close a deal. 

‍ 

‍“Appointment setting emails should always be done manually and never automated” 

Just imagine if you were to receive a call from a business interested in making you their client, but on receiving the only voice you heard on the other end was that of a robot blurting out a predetermined script. Likely, your natural response would be to immediately hang up and block the number as spam. 

So why expect something different from emails. Emails of this category should always have a human element to them and also ideally, encourage a response in order to stir a two-way conversation – an essential component of any successful lead nurturing. Automation is also unhelpful for these email types because they tend to be tracked. This can make some people uncomfortable in responding to it. An even worse prospect is for the automated email to not even reach them in the first place, the server blocking their access to the target recipient. 

2. Customer Service Response 

‍The surest way to lose a client’s trust is to automate your responses to their urgent queries. This is especially true in the case of a small to medium-sized business, which yet to establish their brand as a leader within their niche. 

When a client is facing a problem with your service or product, they expect you to be able to address it promptly and effectively. No matter how advanced and automated an email marketing system you may employ, in such a context, it simply cannot compete with the skilled human represented when it comes to flexibility and problem resolution. 

Not only that, by having your customer service responses automated, you might also be giving off an impression of your business that it doesn’t really value its clients. Feeling unappreciated, such clients are likely to leave you for your competitors. 

3. Repeat Promotions 

‍This is a type of email that quite a significant number of businesses make the mistake of automating. Successful repeat promotion requires a high degree of adjustment to tactics based on your intended audience’s characteristics and behavior. For instance, if the receiver hasn’t even clicked opened your first email, then you will need to send the same email the next day but with a changed subject line. 

In such a context, setting up an automated workflow might actually be much more time-consuming rather than just simply doing it manually. 

‍ 

‍“A crucial component of successful email conversion is personalization” 

‍ 

For small to medium-sized businesses to whom every individual customer could be important for their business growth, incorporating a human element into each of the send promotion emails ensures a very high level of personalization, and by extension, better conversion success rates. 

4. Webinar Invites 

‍Automation is a ‘dumb’ system in that it functions only based on pre-defined rules and triggers, unable to understand the wider context of the situation. Thus, it can actually be more prone to error than a human marketer, sending repeat email or one of the wrong types where it shouldn’t 

If a person has already responded to your webinar invite, you would want to exclude them from later emails in order to not annoy them. Setting up a reliable automated email marketing workflow that is able to address this can become unnecessarily complex. Unless you are a particularly large business managing hundreds of thousands of leads, it is much more effective (and actually cheaper) to send emails manually. 

5. Lost Customer 

‍Acquiring a new customer can cost a business five times more than retaining an existing one. Given the current business climate, an SME can ill-afford to lose any of their existing clients. But, no matter how good a service or product you might provide, the risk can only be reduced but never completely eliminated. 

With that said, just because a client has dropped you, even it was for the most random or arbitrary of reasons, you still have a good chance of regaining them back with the help of a well-crafted email. Obviously, this would entail generating and sending an email uniquely personal to them, one that optimally that not only showcases values but also entices a conversation. 

An automated generic email will provide them with nothing of value and, if anything, prompt them to unsubscribe from your newsletter, and thus, completely cut themselves off of what remains of the relationship. 

An Affordable and Effective B2B Email Marketing Campaign Solution 

It takes more than just an interesting headline to generate a response. TLM is a pay per lead inside sales firm that can help you better accomplish your B2B lead generation and conversion goals without you having to break your budget. For more information on our services or any queries, please don’t hesitate to reach out to our highly professional and friendly staff by calling +1 716 941 4090 or emailing us at info@tlminsidesales.com. 

‍ 

[technologyequality]

Automate Your Sales Pipeline & Watch Revenue Grow: AI’s Secret to Closing More Deals

Automate Your Sales Pipeline & Watch Revenue Grow AI’s Secret to Closing More Deals Let’s be honest—following up with leads can feel like herding cats. You send emails, leave voicemails, drop a friendly “just checking in” message on LinkedIn… and then? Crickets. Meanwhile, potential sales are slipping through the cracks because, let’s face it, manual follow-ups are time-consuming and…

[aivoicesvcs1]

AI Voice Services by Think AI: Revolutionising Business Communication

AI Voice Services by Think AI is revolutionising the way businesses interact with their customers by offering advanced AI-powered voice solutions tailored for seamless automation, customer engagement, and operational efficiency. Designed to integrate effortlessly into existing systems, Think AI’s voice services provide businesses with a scalable and intelligent approach to automated communication.

From AI voice agents handling customer queries to automated appointment scheduling, AI-powered call routing, and personalised voice interactions, Think AI’s services are built to enhance customer experiences while reducing costs. By leveraging natural language processing (NLP) and deep learning, these AI-driven voice solutions enable human-like interactions, ensuring smooth and natural conversations.

Think AI's voice automation solutions are ideal for businesses in customer service, healthcare, finance, retail, and beyond, providing 24/7 availability and real-time responses to improve efficiency and customer satisfaction. Whether you need AI-powered call handling, automated voice assistants, or custom voice integrations for CRM and business operations, Think AI delivers state-of-the-art solutions designed for scalability, accuracy, and seamless deployment.

With AI-powered voice agents capable of multilingual support, sentiment analysis, and intelligent decision-making, Think AI ensures that businesses stay ahead in the era of digital transformation. The company also provides custom AI voice models to match brand identity and enhance customer engagement through conversational AI. Visit: https://www.thinkai.co.uk

[notifymd-medicalansweringservice]

Are you considering how to improve patient satisfaction in your medical practice? Explore the pros and cons of live versus automated medical answering services to find the best fit for your needs. Discover how each option can enhance communication, efficiency, and overall patient care. Don’t miss the chance to transform your practice—check out notifyMD's tailored answering services today and elevate your patient interactions to the next level!

[dreams-in-daylight]

.

[precallai]

How an Automated Scheduling System Can Transform Your Business Revenue in 2025

Businesses are increasingly turning to technology to streamline operations and maximize revnue. Among the most transformative solutions available today is an automated scheduling system, which has emerged as a critical tool for companies seeking to optimize their operations and boost profitability in 2025.https://precallai.com/

Why Your Business Needs an Automated Scheduling System in 2025

The landscape of business operations has fundamentally shifted, with the global appointment scheduling software market projected to grow from $546.1 million in 2025 to $1,518.4 million by 2032 at a CAGR of 15.7%. This explosive growth reflects the increasing recognition that an automated scheduling system is no longer a luxury but a necessity for competitive businesses.

Traditional scheduling methods are plagued with inefficiencies that directly impact revenue. Manual scheduling processes consume valuable employee time, lead to double bookings, create scheduling conflicts, and result in missed opportunities. An automated scheduling system eliminates these pain points while creating new revenue streams through improved capacity utilization and enhanced customer experience.

How an Automated Scheduling System Drives Revenue Growth

The revenue transformation potential of an automated scheduling system lies in its ability to optimize multiple aspects of business operations simultaneously. By automating the scheduling process, businesses can increase booking capacity by up to 30% simply by eliminating the time gaps that occur with manual scheduling.

Customer satisfaction improves dramatically when clients can book appointments 24/7 through an automated scheduling system. This accessibility leads to increased bookings, particularly from customers who prefer to schedule outside traditional business hours. The system's ability to send automated reminders reduces no-show rates by an average of 40%, directly protecting revenue that would otherwise be lost.

Furthermore, an automated scheduling system provides valuable data insights that enable businesses to identify peak demand periods, optimize pricing strategies, and allocate resources more effectively. This data-driven approach to scheduling management translates into measurable revenue improvements across all business operations.

Key Features of a Modern Automated Scheduling System

Today's automated scheduling system solutions offer sophisticated capabilities that extend far beyond basic appointment booking. AI and machine learning algorithms are increasingly being integrated into employee scheduling software to offer predictive scheduling, automated shift assignments based on employee availability, making these systems more intelligent and efficient than ever before.

A comprehensive automated scheduling system includes real-time availability updates, ensuring customers always see accurate booking options. Integration capabilities with existing CRM systems, payment processors, and communication tools create a seamless ecosystem that enhances operational efficiency. Advanced systems also offer multi-location support, resource allocation features, and customizable booking rules that adapt to specific business requirements.

The user experience aspect of an automated scheduling system cannot be overlooked. Modern systems provide intuitive interfaces for both customers and staff, reducing training time and improving adoption rates. Mobile compatibility ensures that scheduling management remains accessible regardless of location, supporting the growing trend toward remote and hybrid work environments.

Implementing an Automated Scheduling System: Strategic Considerations

Successful implementation of an automated scheduling system requires careful planning and strategic consideration of business-specific requirements. The first step involves analyzing current scheduling processes to identify pain points and opportunities for improvement. This assessment should include evaluation of booking volume, peak demand periods, resource availability, and customer preferences.

Choosing the right automated scheduling system requires evaluation of scalability, integration capabilities, customization options, and vendor support. The system should align with long-term business goals while providing immediate operational improvements. Implementation should be phased, starting with core scheduling functions and gradually expanding to include advanced features like automated marketing integration and analytics reporting.

Training and change management are critical components of successful automated scheduling system implementation. Staff members need comprehensive training on system functionality, while customers should be educated about new booking procedures. Clear communication about the benefits of the automated scheduling system helps ensure smooth adoption and positive reception.

ROI and Performance Metrics for Your Automated Scheduling System

Businesses increasingly adopt automation to streamline operations and improve efficiency, providing a total return of the initial investment of 172.73%. This substantial ROI demonstrates the financial impact that an automated scheduling system can deliver when properly implemented and optimized.

Key performance indicators for measuring automated scheduling system success include booking conversion rates, customer satisfaction scores, revenue per appointment, and operational efficiency metrics. Research shows that 80% of organizations will adopt intelligent automation by 2025, indicating that businesses without automated scheduling systems risk falling behind competitors.

The time savings generated by an automated scheduling system should be quantified and translated into cost savings. Administrative staff can redirect their efforts toward revenue-generating activities rather than manual scheduling tasks. This reallocation of human resources often results in immediate productivity improvements and cost reductions.

Future Trends and Innovations in Automated Scheduling System Technology

The automated scheduling system landscape continues to evolve rapidly, with artificial intelligence and machine learning capabilities becoming increasingly sophisticated. By 2025, the global appointment scheduling software market is projected to grow from $470.7 million in 2024 to $1.55 billion by 2032, at a CAGR of 16.1%, indicating sustained innovation and market expansion.

Predictive analytics capabilities within automated scheduling systems are becoming more refined, enabling businesses to forecast demand patterns and optimize resource allocation proactively. Integration with IoT devices, voice assistants, and other emerging technologies will create even more seamless scheduling experiences for customers.

The future of automated scheduling systems also includes enhanced personalization features that adapt to individual customer preferences and historical booking patterns. These systems will become increasingly proactive, suggesting optimal appointment times and services based on comprehensive data analysis.

Overcoming Common Automated Scheduling System Implementation Challenges

While the benefits of an automated scheduling system are substantial, businesses must navigate several common implementation challenges. Resistance to change among staff and customers represents the most frequent obstacle. This challenge can be addressed through comprehensive training programs, clear communication about system benefits, and gradual implementation strategies.

Technical integration challenges may arise when connecting an automated scheduling system with existing business software. Working with experienced vendors and conducting thorough compatibility testing helps minimize these issues. Data migration from legacy systems requires careful planning to ensure continuity of operations during the transition period.

Customer adoption of the new automated scheduling system may require incentives and education. Providing multiple booking options during the transition period, offering support for first-time users, and highlighting the convenience benefits helps encourage adoption and positive feedback.

Maximizing Your Automated Scheduling System Investment

To maximize the return on investment from an automated scheduling system, businesses should continuously monitor performance metrics and optimize system settings based on usage patterns and customer feedback. Regular system updates and feature utilization ensure that the automated scheduling system continues to deliver value as business needs evolve.

Staff training should be ongoing, with regular sessions covering new features and best practices. Encouraging staff feedback and suggestions for system improvements helps maintain engagement and identifies opportunities for enhanced functionality.

Customer feedback mechanisms should be integrated into the automated scheduling system to gather insights about user experience and satisfaction. This feedback drives continuous improvement efforts and ensures that the system continues to meet evolving customer expectations.

Conclusion: The Automated Scheduling System Advantage

The transformation potential of an automated scheduling system extends far beyond simple appointment booking. In 2025, businesses that embrace this technology will gain significant competitive advantages through improved operational efficiency, enhanced customer experience, and measurable revenue growth.

The investment in an automated scheduling system represents a strategic decision that impacts every aspect of business operations. From reducing administrative overhead to increasing booking capacity and improving customer satisfaction, the benefits compound over time to deliver substantial returns on investment.

As market trends continue to favor automation and digital transformation, the question is not whether your business needs an automated scheduling system, but rather how quickly you can implement one to start realizing these transformative benefits. The businesses that act decisively in adopting automated scheduling system technology will be best positioned to thrive in the competitive landscape of 2025 and beyond.

[risaonda]

did I ever talk about when I had to block my vets email bc I was getting emailed no joke Every Single Day for a month telling me pudge was due for vet services even tho he literally was not

[shittysawtraps]

Hello!

We’re trying to contact you, MOD AMANDA concerning your upcoming trap appointment on NOVEMBER 15, 2024 at 6:18 PM (EST).

We’re sorry to inform you that your request to reschedule your appointment to NOVEMBER 15, 6:30 PM (EST) conflicts with another appointment at the requested date and time. Out of the following availability options, please select the plan that fits your schedule the closest.

1. NOVEMBER 15, 2024 at 4:31 PM (EST) via WORKPLACE PARKING LOT - REAR VIEW MIRROR JUMPSCARE

2. NOVEMBER 15, 2024 at 7:00 PM (EST) via PIG MASK CHASE SEQUENCE

3. NOVEMBER 14, 2024 at 2:00 AM (EST) via COLD OPEN TO SAW XI

We appreciate your input and look forward to your therapeutic journey with us!

Best Wishes,

Lawrence Gordon, M.D.

John Kramer Rehabilitation Clinic

The City, NJ, 11037

(010) 029-2004 ext. 001

(This is an automated message. For further questions, please contact your therapist directly.)

there is nothing i can add to this that will make it funnier than it already is

[technologyequality]

How AI Can Book Meetings While You Sleep

How AI Can Book Meetings While You Sleep We need to talk about one of the biggest time-wasters in business; back-and-forth scheduling. You know the drill: “Does Tuesday at 3 work?” “No, what about Thursday at 10?” “Actually, can we do next week instead?” By the time you finally lock in a meeting, you’ve burned 15 emails and at least two brain cells. But what if I told you AI can handle…

[pandemic-info]

Novavax is here!

Good news! Many pharmacies across the U.S. received Novavax shipments yesterday, Sept. 9 2024.

Call your local and confirm with a human.

CVS Tips:

Use this with the automated system to find out if yours carries it: "Vaccine availability > COVID-19 > Details"

Or hit 8003 right away to talk to a human

See also:

All #Novavax info:

[sonic-spirit]

Sonic HRT 2 - Pharmacy

First - Next

I couldn't let the chance pass to represent my first time filling my T prescription.

I was still living in the Chicago suburbs at the time, and went to the city for my healthcare since I could get treatment following the informed consent model--because like hell was I jumping through the kinds of hoops I'd seen others have to follow if I could help it. It wasn't without its issues, of course. The drive to the clinic was usually about 2-3 hours with traffic, about 1 without. Sucks, but do-able. I was still working for my parents then, and needed to hide my transition from them as much as I could.

So when my dad required me to do a thing, I did it.

Which is how I ended up scheduled to go to a basketball game the night I got my testosterone prescription. The prescription appointment itself was super easy. Get in, let them know what I wanted, let them know I knew what I was getting into, give some blood to use to keep track of my hormone levels an all, and head across the street to the pharmacy.

That was where things got...obnoxious. I got in line, got through line, gave my name, was asked to sit down, and wait. And wait. And wait.

After an hour, I went up to the counter, sure I must've missed them call my name. They didn't have record I'd checked in. I checked in again.

After about two hours, I needed to leave so I could meet with my dad to go to the game. And no excuse I could give would have been good enough to get out of it. I went up to the counter to check on progress. The pharmacy worker I talked to was stressed, and told me they'd call when my prescription was ready for pickup. And that, fortunately, they were a 24-hour pharmacy, so I could do pickup any time.

I left. And got the automated call my prescription was ready about 30 minutes later.

At that point, I started to get mad. Here I was, in an amazing situation, about to get a medicine that would do nothing but help me...and because of my fucking asshole conservative dad who wanted people like me to die, I was driving away from my meds, away from freedom, to go play happy family with someone who'd made it very, very clear he didn't want anything to do with the real me, and would physically enforce his preference if he felt slighted.

I went to the basketball game. But I don't think I hid how much I was seething the whole time. We passed the pharmacy my testosterone was waiting for me at on the way home.

When we parted ways, I got a call from a good friend over the phone to celebrate my prescription, and vented to him about the absurd situation. I was so, so damn excited, and so, so pissed that my so-called "family" were the entire block between me and treatment. That a night that should've been about celebrating was instead spent seething. I'd known for years how much I needed to get away from my shitty, abusive family, but this clarified the point. (Again, for the billionth time. Cuz though I worked at it like fire, I didn't escape until a few years later, and only with a looooooot of help).

My friend was so kind, he listened, and he helped. He was so happy for me, and so ready to listen to my anger. And he asked me a super reasonable question. I was planning on not going out to the pharmacy that night because it was nearly midnight, and I'd had work the next day. And he, very reasonably, asked me if I'd be able to sleep if I just went home. And I wouldn't. So I turned around, and headed back into the city, down the same roads even, for the third time that night!

So that's how I got on testosterone!

[notifymd-medicalansweringservice]

Having a machine or answering your patients’ queries can make them feel unwelcomed, which your dental clinic would not want to happen. A simple and effective alternative to this is notifyMD’s dental answering services. Our service not only caters to all your staff and patient’s needs but maintains complete security of information as per the latest HIPAA rules. Read our blog to explore the increasing popularity of dental answering solutions and call us to get started.

[kickthecanrevolution]

Today has been intense. I woke up this morning to the worst nosebleed but thankfully had grabbed a towel before going to bed and my head was on it while I was sleeping, so it didn’t catch any of my bedding.

I opened my phone and saw that email from the car rental company and just assumed it was a scam. When I went back to it and read the body of the email, I realized it was legit and my anxiety went through the roof - how did they know it was me? What if my insurance doesn’t cover it? (I had declined their protection) I took some deep breaths, made coffee, did today’s Wordle and then called my insurance company. I could not get a human on the phone so selected “I want to buy a new policy” where they promptly connected me to a salesperson (of course). I apologized for gaming the system and wasting her time but I had a lot of questions I needed help with. She was great, my claims person she connected me to was great and after a couple of hours, it was handled. Baby’s first insurance claim.

I crawled back into bed and started going over the Alki checklist. I got the bedding we need, then arranged for a cleaning service to be there during the window I’ll be there, as well as a check in tomorrow when my sister is there to do an estimate for a move in clean. Then I found a window washing appointment and scheduled that. In the middle of all that, I got an automated call from my doctor that was requesting I schedule a scan. I froze - do I need another MRI? Are they worried about something? and burst into tears. It turns out it’s just an echocardiogram which is standard, I knew I needed that already.

It could be that the iron infusion is wearing off or I don’t have the manic drive that I used to have to get so much done in a day but this was exhausting. Both my sister and I are over the constant fixing and adjusting of Alki, it’s time for this to be done after this last push. I’m still going to go to Lowe’s tonight to pick up a specific light I need, and stop by Costco to see if they have dining room chairs and a dresser I can drive to Seattle but before I do all of that, I’m going to cuddle Buddy and just chill for a minute.