#00flour

[savagepzza]

Here's "proof " that Saturdays Salutes all you Savages' out there! Are ready for tonight PZZAS'? #pzzadough #pizzadough #savagedough #dough #parmesanreggiano #EVOO #hymalayanpinksalt #caputoflour #00flour #weekendvibes #yeast #fermentation #proof (at Middleton, Wisconsin) https://www.instagram.com/p/CV8u3hrPgu3/?utm_medium=tumblr

[relativelyhealthyforreal]

Ricotta on pizza... Why did it take me so long to figure that out? Dough at 75% hydration with 00 flour, half-sharp paprika, porcini mushroom powder, and oregano. On the pie, layer 1 was a smear of garlic confit, followed by a red wine sauce and a shower of pecorino Romano. Then came the mozzarella and some eggplant caviar. Dots of whole milk ricotta strewn about as if it were COVID-19 in the US. Thai basil. Genovese basil. Provençal olives, succulently-seasoned olive oil, and a crack of black peppercorn to close out the show. Paired with the finest of our dwindling Beaujolais nouveau stash, this pie wasn’t half bad 🤜 #homemadepizza #ricottacheese #garlicconfit #provençal #thaibasil #genovesebasil #pecorinoromano #freshmozzarella #blackpeppercorn #00flour #porcinimushrooms #hungarianpaprika #relativelyhealthy https://www.instagram.com/p/CMqRfollkR2/?igshid=vkd662jrjawx

[planalittleeatalot]

I’ve made loads of potato gnocchi in the past, but this is my first shot at ricotta gnocchi... twice as easy, and absolutely delicious! Woop woop! . . . #planalittleeatalot #food #prep #ricottagnocchi #americansfoglino #ricotta #00flour #egg #parmesan #nutmeg #wildmushrooms #thyme #garlic #mushroombroth #whitewine #parsley #pancetta https://www.instagram.com/p/CJEdgNzD5rk/?igshid=thq93k3zhp7r

[tshelburn]

We haven’t done pizzas in the @alfaovens in a minute so tomorrow night it’s on! I made some dough tonight with @mulinocaputo 00 flour, yeast, sea salt and water tonight using my @cuisinart mixer. I split the dough into 5 balls and put them in a @cambromfg hpan for the fridge. Stay tuned for our pies on Saturday! #pizza #pizzadough #caputo #caputoflour #00flour #dough #cusinart #cuisinartmixer #yeast #seasalt #water #cambro (at Springfield, Missouri) https://www.instagram.com/p/CD5e7TpnSYf/?igshid=1q843g8jf2wg3

[microvalleyfarms]

#repost @brudaddysbrewingco ・・・ 😃 HAPPY GOAT 🐐 Freshly sliced pears, goat cheese, parmesan, local micros from @microvalleyfarms , drizzled with EVOO and honey! 🍐🌱🍯🍕 Pairs perfectly with our light and super refreshing 5.1% abv Belgian style Witbier, “Insert Witty Name Here” 🍻 Make sure you check out our full menu online for more amazing veggie pizzas like this one! As always, we make our dough in house daily, by hand, using only the finest 00 flour you can find. Our pizzas are cooked at over 800° F in our @morelloforniofficial wood-fired oven! 👌 . . . . . . . . . . . . . . . . . . . #madewithpassion #artisanpizza #scratchmade #00flour #pizzaandbeerpairing #veggiepizza #summervibes #biergarten #beergarden (at Allentown, Pennsylvania) https://www.instagram.com/p/CCcG2j0FNYj/?igshid=o4jl241kvlxp

[magalisuk]

It’s pizza time....

[ritzymomblog]

Here’s a little something to keep the 5 lb quarantine weight gain going! It also gives your kids an activity they will love so you don’t go nuts during this extended quarantine. This pizza dough recipe was supposed to debut on a national TV segment this week, but since everything is on hold I posted it on the blog for you carb lovers. There’s a touch of malt barley and 00 flour that makes this dough awesome. Hope you all are staying healthy, safe, and wine happy! XO, Sarita . . . . #pizzadough #pizza #pizzarecipe #pizzadoughfromscratch #barleymalt #00flour #bestpizzaintheworld #homemadepizza #coronabaking #coronacooking #cookit #f52community #funrecipes #recipesforkids #kidscancook #tv_living https://www.instagram.com/p/B-ZwjERFN6d/?igshid=2kbz0k2vmils

[peter-spades]

Aglio e olio #simpleandperfect #thatwasreallycooltomake #sodelicious #thesimplerthebetter #5ingredients #homemadepasta #bestiessunday #bestsunday #geniusrecipe #homemadespaghetti #00flour #zesty #spicy #fresh #nourishing #yesplease #letsdoitagain #vsco #vscocam https://www.instagram.com/p/B9M1_GGD4op/?igshid=1nazt04e95m4d

[pizza-and-sons]

Limited availability: #wholewheat #durumwheat #00flour #healthyfood #healthylifestyle #healthyfoodshare #newyearresolution #baycitymi #puremichigan #michiganders #woodfiredpizza #gulinospizzaandsons #fiber #protein #muclefood #swole #staystrong #portioncontrol #10oz #midlandmi #saginawmi #gluten #limited #limitedsupply #pizzaislife

[planalittleeatalot]

I conquered filled pasta! I’ve made ravioli before but it was two years ago and they weren’t super cute. I tried again today with these spinach balanzoni! I had to sub bologna for the mortadella the recipe (from an old @saveurmag) called for, so I’m really making a whole thing about these being “baloney balanzoni.” 🤪 . . . #planalittleeatalot #food #prep #freshpasta #homemadepasta #handrolledpasta #filledpasta #spinachpasta #pasta #spinach #00flour #balanzoni #bologna #baloney #ricotta #parmesan #nutmeg #garlic #egg https://www.instagram.com/p/B2SIVlcJ6sH/?igshid=2l68zqzv6ov0

[tshelburn]

I whipped up some pizza dough last night. Get ready for some pizzas on the @alfaovens this evening! #caputoflour #00flour #yeast #seasalt #oliveoil #water #sugar #pizzadough #pizza #cuisinart #standmixer #cambro (at Springfield, Missouri) https://www.instagram.com/p/CCgpnjyHDAv/?igshid=q5bl202rtppn

[fabriziolicciardelloofficial]

Ultima #pizza dell’anno??? Si, ma che sia #superlativa !!! E allora, #lungalievitazione con #pastamadre , un #impasto di #farina00 , #semola e #integrale , per la nostra Pizza standard ma con standard e resa altissimi! #alveolo perfetto e cottura ideale ci garantiranno un’ #esperienza degustativa #sublime , ancor di più scegliendo la nostra #pizzasignature , appunto “ #lavilla ”, dalla Linea #gourmet , con tutta una declinazione di inconfondibile e squisito #pistacchiodibronte , in Crema, Granella e Scaglie... #buonappetito ! 💁🏿 🍕🍾 Last Pizza of the year ??? Yes, but that is superlative !!! And then, #longleavening with “mother dough”- #naturalyeast, a mixture of #00flour , #semolina and #wholeflour , for our standard Pizza but with #highstandards and yield! Perfect #alveolus and ideal cooking will guarantee us a sublime #tastingexperience , even more choosing our Pizza-Signature, precisely "La Villa", from the #gourmetline , with a whole declination of unmistakable and exquisite Bronte #pistachio , Cream, Grains and Flakes... Good appetite! 💁🏿 #nofilter #yesorgasm #acireale #sicily (presso LA VILLA RistoPizzaClub)

[herbanwytch]

French Honey Bread, 🍞 made with raw honey, olive oil and Italian Doppio 00 flour. Warm and spread with vegan butter. #00flour #bread #slowfood #breadmaking #breadmachine perfect crust... perfect crumb. @earthbalance (at Cleveland Heights, Ohio)

[vickyshandcrafteddesigns]

Ending the night with some homemade pizza #baking #00flour #vickyshandcrafteddesignsrecipes #pizza #pizzasaturday #homemadepizza #bakingpizza #italianfood #italian #sauce#pastasauce #meatloverspizza #potatoes #sweetpotato #potatopizza #sweetpotatopizza #vickyshandcrafteddesignsrecipes #recipeblogger #recipeblog #wordpress #wordpressblogger

[chefjillianfae]

Tortelli stuffed with ricotta, Spring poppy greens, and another ingredient that I'm totally going to use in my future ricotta filling, but definitely not going to tell you what it is. We helped fold these little pockets up and the kitchen @enotecadellavalpolicella cooked and served them to us under a blanket of shaved parmesan as part of a 6 course lunch today with @demetguzey and @diannemjacob. @lori_lemons @lisamarietodd and @dadcooksdinner were there too! #italy #verona #tortelli #pasta #ricotta #cheese #parmesan #freshpasta #butter #poppy #00flour #lunch #food #travel #eatwell #personalchef #havekniveswilltravel #chef #chefblog (at Enoteca Della Valpolicella)

[richwillmore]

I’ve got a black belt in pizza making, but pasta making... what’s the first belt? Yeah, that. . . . #00flour #eggs #foodporn #homemadepasta #TooHotToCookOutside #SleepyNow