#tgs hp au

[sorrowfulsoul]

Open main menu

Wikipedia

Search

Category:Unprintworthy redirects

About this page

Category Talk

Language

Watch

Edit

See also: Wikipedia:Printability

The pages in this category are redirects from names that are unsuitable for inclusion in a printed version of Wikipedia. To add a redirect to this category, place {{Rcat shell|{{R unprintworthy}}}} on the second new line (skip a line) after #REDIRECT [[Target page name]]. For more information follow the links. Never substitute redirect template(s), nor place them on soft redirects.

See also the complete list of redirect templates and the redirect style guide.

This is a maintenance category, used for maintenance of the Wikipedia project. It is not part of the encyclopedia and contains non-article pages, or groups articles by status rather than subject. Do not include this category in content categories.

This is a tracking category. It builds and maintains a list of pages primarily for the sake of the list itself. They are not part of the encyclopedia's categorization scheme.

This category is hidden on its member pages—unless the corresponding user preference (appearance → show hidden categories) is set.

These categories can be used to track, build and organize lists of pages needing "attention en masse" (for example, pages using deprecated syntax), or that may need to be edited at someone's earliest convenience.

These categories also serve to aggregate members of several lists or sub-categories into a larger, more efficient list (discriminated by classifications).

"Unprintworthy" redirects are redirect pages on Wikipedia that aid online navigation, but would have little or no value as pointers to target articles in a hard-copy book. The name of a redirect may be unprintworthy for a number of reasons, including being nearly identical to the name of the target page, containing typographical errors, or not being encyclopaedic. Redirects are not unprintworthy just because the name may be offensive to some, unless the name is also not encyclopaedic.

See also the categories Templates for unprintworthy redirects and Printworthy redirects

Contents: Top 0–9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

# 0 1 2 3 4 5 6 7 8 9

A Aa Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An Ao Ap Aq Ar As At Au Av Aw Ax Ay Az

B Ba Bb Bc Bd Be Bf Bg Bh Bi Bj Bk Bl Bm Bn Bo Bp Bq Br Bs Bt Bu Bv Bw Bx By Bz

C Ca Cb Cc Cd Ce Cf Cg Ch Ci Cj Ck Cl Cm Cn Co Cp Cq Cr Cs Ct Cu Cv Cw Cx Cy Cz

D Da Db Dc Dd De Df Dg Dh Di Dj Dk Dl Dm Dn Do Dp Dq Dr Ds Dt Du Dv Dw Dx Dy Dz

E Ea Eb Ec Ed Ee Ef Eg Eh Ei Ej Ek El Em En Eo Ep Eq Er Es Et Eu Ev Ew Ex Ey Ez

F Fa Fb Fc Fd Fe Ff Fg Fh Fi Fj Fk Fl Fm Fn Fo Fp Fq Fr Fs Ft Fu Fv Fw Fx Fy Fz

G Ga Gb Gc Gd Ge Gf Gg Gh Gi Gj Gk Gl Gm Gn Go Gp Gq Gr Gs Gt Gu Gv Gw Gx Gy Gz

H Ha Hb Hc Hd He Hf Hg Hh Hi Hj Hk Hl Hm Hn Ho Hp Hq Hr Hs Ht Hu Hv Hw Hx Hy Hz

I Ia Ib Ic Id Ie If Ig Ih Ii Ij Ik Il Im In Io Ip Iq Ir Is It Iu Iv Iw Ix Iy Iz

J Ja Jb Jc Jd Je Jf Jg Jh Ji Jj Jk Jl Jm Jn Jo Jp Jq Jr Js Jt Ju Jv Jw Jx Jy Jz

K Ka Kb Kc Kd Ke Kf Kg Kh Ki Kj Kk Kl Km Kn Ko Kp Kq Kr Ks Kt Ku Kv Kw Kx Ky Kz

L La Lb Lc Ld Le Lf Lg Lh Li Lj Lk Ll Lm Ln Lo Lp Lq Lr Ls Lt Lu Lv Lw Lx Ly Lz

M Ma Mb Mc Md Me Mf Mg Mh Mi Mj Mk Ml Mm Mn Mo Mp Mq Mr Ms Mt Mu Mv Mw Mx My Mz

N Na Nb Nc Nd Ne Nf Ng Nh Ni Nj Nk Nl Nm Nn No Np Nq Nr Ns Nt Nu Nv Nw Nx Ny Nz

O Oa Ob Oc Od Oe Of Og Oh Oi Oj Ok Ol Om On Oo Op Oq Or Os Ot Ou Ov Ow Ox Oy Oz

P Pa Pb Pc Pd Pe Pf Pg Ph Pi Pj Pk Pl Pm Pn Po Pp Pq Pr Ps Pt Pu Pv Pw Px Py Pz

Q Qa Qb Qc Qd Qe Qf Qg Qh Qi Qj Qk Ql Qm Qn Qo Qp Qq Qr Qs Qt Qu Qv Qw Qx Qy Qz

R Ra Rb Rc Rd Re Rf Rg Rh Ri Rj Rk Rl Rm Rn Ro Rp Rq Rr Rs Rt Ru Rv Rw Rx Ry Rz

S Sa Sb Sc Sd Se Sf Sg Sh Si Sj Sk Sl Sm Sn So Sp Sq Sr Ss St Su Sv Sw Sx Sy Sz

T Ta Tb Tc Td Te Tf Tg Th Ti Tj Tk Tl Tm Tn To Tp Tq Tr Ts Tt Tu Tv Tw Tx Ty Tz

U Ua Ub Uc Ud Ue Uf Ug Uh Ui Uj Uk Ul Um Un Uo Up Uq Ur Us Ut Uu Uv Uw Ux Uy Uz

V Va Vb Vc Vd Ve Vf Vg Vh Vi Vj Vk Vl Vm Vn Vo Vp Vq Vr Vs Vt Vu Vv Vw Vx Vy Vz

W Wa Wb Wc Wd We Wf Wg Wh Wi Wj Wk Wl Wm Wn Wo Wp Wq Wr Ws Wt Wu Wv Ww Wx Wy Wz

X Xa Xb Xc Xd Xe Xf Xg Xh Xi Xj Xk Xl Xm Xn Xo Xp Xq Xr Xs Xt Xu Xv Xw Xx Xy Xz

Y Ya Yb Yc Yd Ye Yf Yg Yh Yi Yj Yk Yl Ym Yn Yo Yp Yq Yr Ys Yt Yu Yv Yw Yx Yy Yz

Z Za Zb Zc Zd Ze Zf Zg Zh Zi Zj Zk Zl Zm Zn Zo Zp Zq Zr Zs Zt Zu Zv Zw Zx Zy Zz

Subcategories

This category has the following 19 subcategories, out of 19 total.

C

Redirects from colloquial names‎ (198 P)

D

Redirects from titles with diacritics‎ (9,298 P)

Redirects from titles without diacritics‎ (3 C, 412,337 P)

Redirects from other disambiguation‎ (4 C, 12,839 P)

Redirects from predictable disambiguation‎ (510 P)

Redirects from unnecessary disambiguation‎ (2 C, 30,749 P)

Redirects of dubious utility‎ (19 P)

I

Redirects from incorrect disambiguation‎ (3,572 P)

Redirects from incorrect names‎ (5 C, 10,165 P)

L

Redirects from titles with ligatures‎ (105 P)

Redirects from titles without ligatures‎ (493 P)

M

Middle-earth redirects from redundant titles‎ (152 P)

Redirects from misspellings‎ (48,487 P)

O

Redirects from other capitalisations‎ (1 C, 407,815 P)

P

Redirects from plurals‎ (25,577 P)

Redirects to plurals‎ (2,484 P)

Redirects from US postal abbreviations‎ (42,391 P)

R

Redirects from emoji flags‎ (273 P)

S

Redirects from shortcuts‎ (1 C, 28,798 P)

Pages in category "Unprintworthy redirects"

The following 200 pages are in this category, out of approximately 1,557,538 total. This list may not reflect recent changes.

(previous page) (next page)

ـ

۝ ֽ

­ ‌

‍ ͏



܏ ݀ ݃ ݄ ݇ ݈ ݉ ݊

ـ ҉

–

؂ ༘ ༙ ༵ ༷

༾

༿ ྂ ྃ ྆ ྇ ࿆

›

Ž



​ ׄ ׅ

؀

؁

؃

؄

؅ ؐ ؑ ؒ ؓ ؔ ؕ ؖ ؗ ؘ ؙ ؚ

؜ ۖ ۗ ۘ ۙ ۚ ۛ ۜ ۟ ۠ ۡ ۢ ۣ ۤ ۧ ۨ ۪ ۫ ۬ ۭ 𝅥

𝅦 𝅧 𝅨 𝅩

𝅭

𝅳

𝅴

𝅵

𝅶

𝅷

𝅸

𝅹

𝅺 𝅻 𝅼 𝅽 𝅾 𝅿 𝆅 𝆊 𝆋 𝆪 𝆫 𝆬 𝆭 ॑ ॒ ︡







 𝉂 𝉃 𝉄

ߺ ᩿ ⵿

𑂽

𑃍



”

’ ꙰ ꙱ ꙲

⁡

 ️ ︎ ︍ ︌ ︋ ︊ ︉ ︈ ︇ ︆ ︅ ︄ ︃ ︂ ︁ ︀

󠀁 󠀠 󠀡 󠀢 󠀣 󠀤 󠀥 󠀦 󠀧 󠀨 󠀩 󠀪 󠀫 󠀬 󠀭 󠀮 󠀯 󠀰 󠀱 󠀲 󠀳 󠀴 󠀵 󠀶 󠀷 󠀸 󠀹 󠀺 󠀻 󠀼 󠀽 󠀾 󠀿 󠁀 󠁁 󠁃 󠁄 󠁅 󠁆 󠁇 󠁈 󠁉 󠁊 󠁋 󠁌 󠁍 󠁎 󠁏 󠁟 󠁞 󠁝 󠁜 󠁛 󠁚 󠁘 󠁗 󠁖 󠁕 󠁔 󠁓 󠁒 󠁑 󠁐

(previous page) (next page)

[mccarthymolly]

o yh nt issue b dk b gd end okhuh yh luck uh no okjuh nc uh okhuh yh uh yh uh k luminous no

Say be happy or find r sth lk udnerstand lk hv et want frm lf n kne wt mks hppy or wt hp lf is or sth,idk,uh,js bad

Maybe, u hv unethical lf n personhood, b uh,ok,sth,, think hppy n tlk lk achieved b u hv clownz lghing nt happy, dont be wanting to lgh, uhsth,uh,no, humor dif,uh,ok,uh,yh,mind,okhmuh,post,uh,yh,okhmuh,no,uh,gd,hm,khmuh,yh,uh,gd,uh,yh,uh,no,ww,fr or sth,uh,dk,yh,gd,uh,hm,uh,no,profile though, wt,dk,uh,okhmuh,sth,yh,liza,okhjuh

Bk k ye mybe,uh,no,u,m,u,h,

Nouh,wt,no,uh,mybeo,,m,u,u

Okuh,dk,hate b idk, eecird,when come ,uh, yh,uh,no,ok h muh,no,yh,uh,wt,uh,o k hm u n I h,dk,mybe,uh,no,uh,yh,check,no,okhmuh,no,uh,wt,dk,uh,thnk,uh,ow,no,wt,uh,nok

Colleg tutors b idk, uh, q, n eml, n sth,uh,ok,uh,hm,uh,no,wt,yh,uh,

Nj conec tryz chr*,&,*<&dk,uh,big, nt mtrr,hmiuh,no,uh,wtz free, jm,u,j,k,kk,

Ur asking me uh to get big , u think u sexy n that's not gonna haunt me or sth, idk. N sth else, i guess look at my penis alot on the offchance something stimulates it, but during sports nt rly, gotta be mobile, n i dont tell u when hard, b u can be homoerotic, np, js not me,uh, idk

Okhuh yh,uh,nc,uh,ok,yh,nc,uh,nc,yh,nc,ok,uh,no,uh,no,uh,ok,sth,uh,idk,uu,big,no,uh,sthzno,no,uh,no,bad, my town n county

K smll no b blfs. No, n sth, wtz uhz dkzuh,ok hm uh,wt, toi,uh,okhmuh,no,uh,dk,uh,ok hm uh,no,yh,no,big,uh,okhmu no u,no,uh,wtzuh,o kh muh uh,no,wt,dku,o,sth, uh, ideazwtzuh,o,ideZjzuzh,nj,

Ok hm u,n,i,u,dkuh,cream,uh,no,uh,yh,uh,ok,j,sth,uh,dk,uh,wt,uu,ok,yh,ok,yh,no,au,

Nodik,u,j,k,u,7

Bd cmctn no yhmh ww okhmujnjio k by I

Uhno uh ok uh. Tk more bc uh mny anx frm par yh uhno. N they clndescended nt contextualz to being tg js tlk dwn mtgd wt dk, unbelievable, n mad at place, nt tht gd, isk, performance dmbness nt btr idk uhwt hmjgmuh no wt dnt pic dnt chase ww no u lying n bd stry ntgd to say b ee mind ww threaten n shame nt hlp, idk y, passv ag wn yng ww yhmoyj nt gd tms uh dk dmb tmshr idk hm uuhwtuhnoyjnouhyjnuh t tht gd, cnfsbg, b bdrm, okhmuhwtbkouh resprt? Uhw y ijbh tm

Okhmuhyhuhnkhh yhwtuhokhmyhnk

K yh dk srch ok yh hmiholljnyhum

Wndrs, read wn calmer uh dk,uh, y

Libraries idk burst, no nt hlp,uh,no,ww,uh,no,yh,uh,no,bc u prove yrslf first, i dojt hv mny, dont lord that on me, dont be begrudged that u cant have whatever luxury youd spend on,h,kuh,n,o,,huh,yjo,uh,

Charming b y,idk,imagine b idkh,m,uj,no,uh,yh,uh,lstn no,uh,no,yh,no,nt tht smpl, u nt wise gd parent person

Sound lk heist dwn strs ir wt,idkh,u,m,j,

Ok b no,h,mu,j,n,o,

Ok yh , panic, no,ok,hmuh,yh,no,uh,gd,uh, who pdocasts,uh,ok,hmuh,no,wt,uh,k,p,k

Ok yh no bit,idk,uh,ww,dk,uh,ok,in,uh,no,uh,yh,no,uh,okhmuj no iuj,uh,wt,uh,ol hm uj,wt,uh,ww,uh,no,i,l,uh,wt,uh,no,k,okh j uh,dk,uh, okjjuh, wt,y,ww,uh, k ok,dk,uh, n okhj,pulse,uj,m,i,h,wt,u,weir,hw,uh,omg,uh, trying to fit forms, n saying alot,uh,they chngd vocab,uh,no,uh,ww,uh, no, uh,

[carlylexwheeler-blog]

The Chaser I Seek

Summary: Muggle-born Anne Wheeler is thrilled when she receives her Head Girl badge in the mail the summer before her final year at Hogwarts, and so is Pureblooded Phillip Carlyle when he discovers he is to be Head Boy. Neither Phillip or Anne knows much about the other, except for what they have learned from afar. Phillip has been watching from the Slytherin side of the stands for years as Anne leads the Ravenclaw Quidditch Team to victory after victory. Anne, on the other hand, has listened to the whispers about the Carlyle family and their obsession with Pureblood lineage, and she knows along with the rest of the school that the Carlyles are instrumental in Voldemort's slowly gaining success.

Neither is prepared to be jarringly thrown together their very first day by a food-fight blown out of proportion.

As both students struggle to balance new responsibilities, they will begin to see new sides to one another-- sides that Phillip has been taught never to look for, and sides that Anne is not ready to explore. But with the wizarding world taking new steps every day towards war, Hogwarts must cling to unity stronger than ever... Especially the two students who are the face of it all.

Word Count: 3,084

Warnings: Language, Food Fights

Chapter: 1 of ?

Read it on Wattpad or AO3.

Playlist

Song of the Chapter: "Start a War" by Klergy and Valerie Broussard

Chapter One: The Battlefield

Anne had been hoping for a memorable first day as Head Girl, but now she was wondering if she should have been a tad more specific.

Things had started out fine. Perfect, even, which is probably why the universe decided to deal Anne the disastrous scenario that followed. On the train, she had arrived early enough to meet all of the prefects, and so she had begun to divide the job of monitoring the various cars among everyone. By the time everybody was there, there was a set plan on how they were going to approach it, and it was being carried out perfectly. Phillip Carlyle, the Head Boy, had arrived about ten minutes into the planning. This had been slightly concerning for Anne, who had only communicated with her partner in stiff, unsure letters of congratulations over the summer. Neither seemed able to find the right words all summer. She supposed it was natural, seeing as they had never interacted before. The two of them had classes together, yes, being two of the brightest students in the school. But with advanced classes focused heavily on independent study and neither knew the other well enough to pair up for the few projects they were assigned.

That was the least of her worries, though she tried not to think about it. The Carlyle family had a reputation, and it was not one that painted a hopeful picture of Phillip's respect for a Muggle-born. The past few years had seen a palpable increase in the tension between Muggle-borns and Pureblooded wizards as You-Know-Who grew more and more powerful. Not all Purebloods held the supremacist attitude towards Muggles, of course. But the Carlyles were one of the most notorious families for this attitude and had been for generations, and Phillip Carlyle was the only heir to this legacy of hatred in a time when such superiority was thriving. The thought of what might happen while they were forced to work side-by-side had caused her more sleepless nights than she cared to admit.

However, Phillip's arrival on the train had brought no ominous thunder or sudden chill, so that had been a plus.

Really, Phillip was nothing but supportive of the orders Anne had given. He assumed the role of enforcing her plans rather than trying to make his own, which Anne discovered when she heard him instructing some of the new Fifth Year Prefects.

"She's the one running the show right now," he had informed them, and there was no malice or sarcasm in his voice as he said it. "That's good for you, because she's going to give you a little part of the plan to work with. If you do your job well, then everyone else will be able to do theirs, and we'll be able to get this train to the station without burning it down."

The two Fifth Year girls he had been speaking to had burst into giggles at that, but Anne had found herself feeling just the slightest bit flattered. She had considered going over to greet him, maybe thank him in a professional manner, but it was at that moment that a Third Year boy burst into the compartment, saying, "Umm... So, we were just sitting there, right, and then the seat started smoking, and we don't know how it happened, but there's a small hole burned in-"

"How small is 'small?'"

"I dunno, I mean, most of the seat is gone, but-"

Neither had spoken to the other after that, for as the Prefects began to do their jobs, various situations arose that demanded each of their separate attentions. This was a development that Anne did not mind, and she was happy to keep busy on the ride to the castle. By the time that the Hogwarts Express had pulled into Hogsmeade Station, Anne had successfully handled a game of Exploding Snap gone wrong, a misfired charm that caused the snack trolley to overturn, and a mess made of a pair of robes during a game of Gobstones. As she watched the students leave the Express, Anne was aware of the fact that her face was flushed and her curls were escaping her buns in wisps. But she also felt proud, like she was beginning to live up to the shiny badge pinned to the front of her worn Ravenclaw robes that were a few inches too short.

It did irk her slightly that Phillip Carlyle looked as unruffled as ever from where he stood across from her, making sure that all of the students made their way out.

After that, things were a blur. Anne and the Carlyle boy were tasked with making sure that students knew where to assume their seats since Professor Lutz was unable to do so while she was tending to the First Years. After the majority of the students were seated, Anne made her way to the Head Table to ask any of the professors what they should be doing next.

"Excuse me," she called to the nearest teacher, the blonde Defense Against the Dark Arts instructor. Professor Barnum glanced over at Anne with a kind eyebrow raised. "Is there anything else that we can do, Professor?" Anne queried, hopeful. She needed something to busy herself with, or else she was fairly sure her energy would fall flat.

Professor Barnum hummed softly, appearing to think. "Erm... I don't think so, no," she replied, smiling apologetically as she tucked a strand of blonde hair behind her ear. "But I am sure that Phineas said something about the Sorting starting soon. You two have done more than enough for now, I think, so you can go enjoy the festivities with the rest of us."

Anne nodded, offering the professor a polite smile that hid her disappointment. "Thank you, Ma'am," she murmured, inclining her head respectfully. She was fairly sure that she felt Professor Barnum's motherly gaze upon her back as she weaved between students on the way back to the Ravenclaw side of the Great Hall.

As Anne left the table, she saw that Carlyle had already taken this advice. He was seated in the middle of a group of affluent Slytherin students, and he was laughing at something the brunette girl across from him had said. It did not set in until that moment that Anne did not have anyone to sit with now that W.D. had graduated.

Her brother was working in the Three Broomsticks in order to support them, and Anne knew about the second job that he was hiding. She had noticed the owls coming at odd hours of the night to their tiny flat in Hogsmeade, and she had even managed to sneak one out of the trash, from which she deduced that he was doing some translation of Runes for scholars in Albania. Anne's heart ached that her brother, a brilliant Runes translator who could have found a prestigious job anywhere in the world, was slaving away at a pub for her sake every day. When she graduated, Anne was determined to pick up and leave to start a new life with W.D. They would go somewhere, anywhere, and Anne would get a job researching advanced potions until she was accepted by some major Quidditch team. But until then, Anne no longer had anyone to sit with.

She took a spot at the very end of the Ravenclaw table where no one else sat, fiddling with the napkin on the table absently. She could feel eyes on her, now that she was Head Girl... And she knew those eyes came along with whispers. They did not linger too long, as people had better things to talk about, but she still looked down at the hem of her threadbare sleeve to avoid seeing the brief glances. Anne had never been particularly popular. People knew she was brilliant, they knew that she was one of the best Chasers that Hogwarts had seen for decades, maybe even a century. But for as many acquaintances as Anne had, her dedication to her schoolwork and Quidditch performance did not leave much room for any real friends.

A few moments later, an ample distraction came to turn any unwanted attention away from Anne. Headmaster Barnum rose, and with a wave of his wand, he magicked away the tables. The Headmaster's skinny, slightly mousy appearance was deceiving, for this man was a master of the classes of illusion and enchantment. He was renowned for it in many circles, and Anne was fascinated by the slight flair for the dramatic the man had. She had always been attentive to his words, respecting the air of mystery that clung to him like cobwebs.

The Sorting commenced thereafter. It was a short one, with a particularly small incoming Year. However, there was a noticeable disturbance throughout the ceremony. Anne noticed almost immediately that whenever a surname that was well-known and respected in the magical community was announced, it was greeted with full applause. There were several surnames, however, that were known to be traditionally common in Muggle communities. The cheering following these names was weakened as if at least a third of the students had dropped out. Anne's eyes narrowed, and as soon as any student with a name such as her own was announced, she could be observed to be cheering twice as loud as normal. Several of the teachers picked up on the incident as well, and Anne was fairly sure she caught a glimpse of Professor Barnum and her husband murmuring sonorous charms so that the cheering of the teachers was magnified.

By the time that Zabel, Francine had been sorted into Hufflepuff, Headmaster Barnum had summoned the tables again out of thin air. Gasps filled the room from the First year students who had not been there to see it the first time, and Anne felt a little smile play with her lips. The Headmaster gave a quick speech, and then with a flourish of his wand, the platters before the students all became filled with enough food to feed a small army. Chatter rose to mingle with the cozy sounds of clattering forks and knives, and Anne felt herself visibly relax. Maybe she wasn't exactly a part of it, but this was the part of Hogwarts that she loved. Moments like these, where so many students just existed together, made it feel like home.

Of course, the day chose that moment to turn for the worse.

Anne had only just begun to pour a goblet of pumpkin juice when she first noticed the disturbance, coming from one end of the Slytherin table. Three boys, Fourth Year students, Anne guessed, were using their wands to send little chunks of candied carrots flying to hit a pair of Muggle-born twins across the aisle. Anne set down her goblet, preparing to rise to call the students out. Before she had managed to extricate herself from the table, however, one of the twins had turned and fixed the Fourth Years with a smirk. Anne hastened her efforts to reach the students, but it was much too late. An entire bowl of steak and kidney pudding flew across the aisle to splatter the three students and anyone in the immediate vicinity. For a moment, all conversation fell silent, and there was a moment of hollow space.

And then, the shouting began.

Wands flew out, and Anne fumbled to keep her own in her hand as she desperately scanned the room, trying to see where she was most needed. Anne's ears were overloaded with a tangle of layering spells, most of which sent various trays and plates of food zooming through the air. At first, Anne struggled to appeal to the casters of the spells, but there were far too many. She cursed under her breath as she began to nonverbally cast as many shield charms as she physically could. Invisible barriers sprung up between the attackers and their intended victims, and they effectively stopped the food from flying any further. Unfortunately, this mostly resulted in whatever was being thrown being propelled back towards the attacker, spreading still more food everywhere.

A plate of treacle tart whizzed past Anne's head, and she narrowly dodged it only to be met with a full tureen of chowder. The soup drenched her and a pair of First Years from head to toe, and a shocked gasp left the lips of the children behind her. Anne winced and quickly darted back, gripping them by the hands and pulling them under the table. "Stay here until it's over," she instructed the shell-shocked girls before sliding out from underneath again, leaving them gaping at her retreating form.

Anne fought to move forward, doing as much damage control as she possibly could. Dodging food became completely impossible at this point. What might have been an entire ham narrowly missed Anne's head, shoving her hair out of her bun and getting the soaked curls everywhere. Several pastries were hurled at Anne and smashed into her shoulder, her arm, and her chest, smearing all down the front of her robes. A bowl of lukewarm porridge dumped over her head, and the Head Girl fought to wipe it out of her eyes as she forged forward. All she could do, at the moment, was vanish whatever flying food she could hit. Luckily, Anne had fairly decent aim, and she managed to completely remove several large platters of turkey, ham, and chicken from the air before they could actually hurt someone. Through all of the fighting, she could barely tell who was who, until she stumbled into a form slightly taller than her. Anne whirled around with her wand out, ready to stun the perpetrator if need be.

Instead, she found herself coming face-to-face with a thoroughly flustered Phillip Carlyle.

He looked absolutely ridiculous, with what must have been half of a pudding plastered to his hair and the side of his face. What Anne guessed was chocolate syrup dripped down the side of his face, and what had been his pristine, brand-new robes were covered with mashed potatoes and pumpkin juice. There was a determination in his eyes that was rather comical, seeing as his normally perfect hair was in a cowlick that looked like something from a cartoon. However, as he raised her wand at her, she did not find it hard to believe that he might stun her.

"Carlyle!" she called, over all the noise. "Stop, it's Anne Wheeler!" He froze for a moment, blinking, and Anne remembered that she probably looked equally ridiculous. But then, relief spread over his food-covered features.

"Thank Merlin," he exclaimed, gripping her by the arm and yanking her to the side to avoid a flying sponge cake. "Are you the one who's been vanishing things?"

"Yes," she called, tugging her arm free from his grip immediately. She did not have time to be flustered by the sudden, unwanted contact. "This needs to stop, now, before it gets out of hand!"

"I think it's a bit late for that, as I think I just saw Headmaster Barnum quite literally pie Professor Barnum in the face."

"Are you certain-"

"I would testify to it before Wizengamot."

Anne gritted her teeth and glared at nothing in particular. "Maybe if we can get to Professor Lutz, then-"

Behind them, there was a massive boom, and Anne cried out. Carylye was touching her again, pulling her to the ground with him. She landed sprawled rather uncomfortably on his solid chest, and quickly Anne moved to haul herself off of him. As if that was not enough, a bowl of tuna salad shot by them, effectively covering the both of them in creamy goop.

"Sorry, sorry," Carlyle panted, looking up at her with blue eyes that were as wide as the saucer that broke against the wall behind them.

"What was-"

Just then, a rancid smell filled the hall, and Anne clapped a hand over her mouth and nose. Carlyle did the same, not before Anne caught a glimpse of a gag.

"Dugbob," Carlyle's muffled voice reached her ears as the disgusted coughing of many students filled the hall. Anne felt her level of frustration skyrocket.

"Dungbombs?" she spat. "For the love of all things holy, who the-"

Another boom, and this time Anne was ready. She ducked her head under the nearest table, but Carlyle was not quick enough. Mud flew through the air, hitting him square in the face. Immediately, the Head Boy turned and began to cough, attempting to get out whatever he could from his mouth. Anne stood, trying to locate where the Dungbombs were being set off. The smell was crippling, but she kept a hand clapped over her mouth as she struggled to make her way forward, leaving Carlyle behind. Another detonated, and Anne felt the mud splatter her, too. But she managed to keep it out of her eyes, and that was all that she needed. She pushed her way forward, and through the cloud of brown smoke, she spotted the Fifth Year who was detonating them crouching over another one.

"Evanesco!" Anne shouted, taking aim at the bomb. The boom still set off, but only a little bit more filth flew through the air like projectiles. The rest vanished, along with the bomb, and Anne aimed a silent 'Petrificus totalus!' at the single figure she could see in the center of all of the smoke. She heard a crack that meant that the charm had met the intended target, and then, in the haze of the smoke and the break in the fight, Carlyle climbed onto the Slytherin table, almost slipping in the spill of soup on top of it.  Anne pointed her wand at him, murmuring a breathless "Sonorous."

And then, above everything, Carlyle's voice boomed, "The next student to use food as a projectile will personally volunteer to work in the kitchens for two weeks, after they clean all of this up!"

The hall was silent, and Anne let out a soft groan as she leaned against the table at his feet. No noise could be heard except for the labored breath of the students and the dripping of food off of robes. Carlyle let out a massive breath of relief as Anne rubbed her temples and stared at the growing pile of porridge and tuna fish chunks at her feet.

Anne was fairly certain she would not be forgetting her first day as Head Girl anytime soon.

[circusdads]

Harry Potter/Barlyle AU where Phillip Carlyle is a Beauxbatons student visiting Hogwarts for the Triwizard Tournament and one sleepless night while wandering the halls he discovers none other than the much whispered about P.T. Barnum putting on a stunning show in the Room of Requirement. It’s love at first sight.

[highgaarden]

how amenable would you be to the idea of a kc the great au???? it's just i just saw you've been writing tg fics, and I got excited all of a sudden bc klaroline would be perfect and hilarious in that world, esp sprinkled with some mikaelson family dysfunction..

WELL my honest opinions would be that if i wanted to write a "the great" au for kc i would have to take great liberties with the plot because, characterisations wise, klaus isn't an endearing wet pile of dumb rocks <3

i am of the personal opinion that sometimes plots and stories, just because they CAN be cross-pollinated, doesn't mean they should, you know? there are other stories that can tell better a story of enemies-and-lovers. i did give your question a serious think, and on surface level, as a fun little ficlet, perhaps. but to place these characters in that universe would be a bit trickier, because you cannot just swap a character for a character to tell a good story. sometimes roles must be created, and it is exhaustive work! my brain doesn't have the juice it used to for fantastical au's anymore - the biggest one i'd ever tackled was either my hp fusion i wrote five years ago, or like my pushing daisies au!

but thank you SO MUCH for thinking of me. i love both these ships with a lot of my heart and would love to see them frolick about. klaus could probs survive in petyr's reign, and peter could probably survive being in the originals by sheer dumb luck alone, but as far as other characters are involved, not so much hehe

oh gosh i didn't mean to ramble

tldr; a lot would have to be sacrificed to make this work! but i invite other authors to try this out too. we can perhaps make an entire fest of it lmao

Edit: @diaz-eddie told me i should link you this as it is a period ish sort of playlist and because im terribly confused and will most of the times do what she asks me to, here!! https://highgaarden.tumblr.com/post/149606024827/honeysuckle-weeks-songs-for-a-frolicking-summer

[uneminuteparseconde]

Des concerts à Paris et alentour en gras : les derniers ajouts :-: in bold: the last news Janvier 18. Bracco + Portron Portron Lopez – La Lingerie|Les Grands Voisins (gratuit) 18. Laurent Pernice : accompagnement musical de la lecture d’Alain Damasio – Médiathèque Françoise-Sagan (gratuit sur résa) 18. Lee Ranaldo & Raül Refree – Le 104 18. Cluster Lizard + Monolog (Mads Lindgren) + Blakk Harbor – Espace B 18. Bagarre + Pauline (Fils de Vénus) (dj) + De Vedelly (dj) + Cheetah (dj) + Leslie Barbara Butch (dj) – Le Klub 18. Hourvari + Couloir Gang + Roland René + Richard Comte & Stéphane Pigneul – Quai de Bourbon 18. Franck Vigroux : "Flesh" (Biennale Nemo) – Maison des arts et de la culture (Créteil) 18. Verset Zero + CRAVE + Pratos + Panzer + Siink + [Samuel Kerridge : ||ANNULÉ||] – Petit Bain 18. VSK & Michal Jablonski + Scalameryia + Neri J + NN + Paul Mørk + Heart Peaks – tba 18. Wallis + Sina XX + Foltz + Marum (dj) + Herr Mike (dj) + F/cken Chipotle + Front de crypte – La Station 18. The Horrorist + Alienata + Thomas Delecroix + Ekors + Opäk + Tomar – Dehors brut 18. Thurston Moor (Journée internationale du film sur l’art) – Auditorium|Le Louvre ||ANNULÉ|| 19. The Pleasure Principle – Carmen 22. Dick Voodoo + Bile – L’International 22. Eloise Decazes et Eric Chenaux jouent "La Bride" + Pauline Drand +Nick Wheeldon (fest. Au fond de l’hiver) – Espace B 22. Fa Cesario + Lauri Hyvärinen + O Reche Modo + Loran Qui + Lauren Rodz – Les Nautes 22. Guillaume Malaret + YS + Graal (dj) – Quai de Bourbon 23. Common Holly + Raoul Vignal Music + Viktor's Joy (fest. Au fond de l’hiver) – Espace B 23. The Pharcyde – Petit Bain 23. Lansiné Kouyate & David Neerman (fest. MOFO) – tbc (Saint-Ouen) 23. Phase fatale + Justine Perry + Munsiger – Rex Club 24. De Ambassade (La Machine a 10 ans) – La Machine (gratuit) 24. Richard Dawson + Eric Chenaux (fest. Au fond de l’hiver) – Petit Bain 24. Penguin Cafe + Lubomyr Melnyk + Peter Broderick + Anne Müller + Hatis Noit + Janus Rasmussen – La Gaîté lyrique 24. Kode9 + Teki Latex + Cem + Barker + Crystallmess + Carin Kelly b2b Bob Sleigh + Christian Coiffure (La Machine a 10 ans) – La Machine 24. Balladur + Dr Drone + Ellah a. Thaun + Humbros + Karel + Marble Arch (fest. MOFO) – Le Sultan (Saint-Ouen) 24. Ben Russell + Olimpia Splendid + Samuli Tanner – Instants chavirés (Montreuil) 25. Tamagawa + Drone à clochettes – À la ville d'Épinal 25. Litovsk + Litige + Catisfaction + Turquoise – Espace B 25. Damien Schultz + Marie Klock – L’Officine 25. DJ Marcelle + Stellar OM Source + Ploy + Clara! Y Maoupa + Black Zone Myth Chant + Theo Muller + Promesses + Gista (La Machine a 10 ans) – La Machine 25. Apollo Noir + Cesar Palace + Discovery Zone + Fiesta En El Vacio + Hyperculte + Lyra Valenza + Sacrifice seul + Tarek X + Tropical Horses (fest. MOFO) – La Station 25. Airod + Ki/Ki + Kobosil + Parfait + Shlømo – tba 25. I Hate Models – T7 26. The Fat (cinéconcert pour enfants) – La Gaîté lyrique 26. Beak> + Vox Low + Abschaum + Maria Violenza (La Machine a 10 ans) – La Machine 28. King Krule + Beak> + Nilüfer Yanya – Yoyo|Palais de Tokyo (gratuit) 29. Rendez-Vous + The KVB – La Cigale 30. Denis Frajerman – Le Chair de poule 30. Editors – Salle Pleyel 31. Sunn o))) + Richard Pinhas + Mariachi – La Gaîté lyrique 31. Tindersticks – Salle Pleyel 31. It It Anita + Mss Frnce + Flowers + Angle mort et clignotant + Casse Gueule + La Jungle – Petit Bain 31. Mhysa + Teto Preto + Lavascar (fest. Closer Music) – Lafayette Anticipations 31. L’autopsie a révélé que la mort était due à l’autopsie + Peür + Solitude Club – Instants chavirés (Montreuil) 31. Courtesy + Anetha + Corbeille Dallas – Rex Club Février 01. Sunn o))) + Golem Mécanique – La Gaîté lyrique 01. Tom of England & Bobbie Marie + Nicolas Godin + Maria Teriaeva (fest. Closer Music) – Lafayette Anticipations 01. Noir Boy George + OKO DJ b2b Nosedrip + As Longitude + Christophe Clébard + Laura Palmer + Weird Dust + Boochie (Listen fest.) – La Station 01. Badbad + Toro/Azor – Café de Paris 01. Jean-Louis Costes – Jardin Denfert 01. Irène Drésel + Maud Geffray + Calling Marian + Léonie Pernet + RAG + Gonthier – Dehors brut 02. Sunn o))) – La Gaîté lyrique 02. Alessandro Cortini + Not Waving + Dark Mark + Jean-Luc + Anadol (dj) (fest. Closer Music) – Lafayette Anticipations 06. Rakta + Disorientations – Supersonic (gratuit) 06. Rouge Gorge + Arne Vinzon + Rraouhhh – Petit Bain 06. Lacustre – Le Chair de poule 06. Mnemotechnic + Radiant + Rvptvres – Le Cirque électrique 06. Nahawa Doumbia – Instants chavirés (Montreuil) 07. Andy Moor – Chair de poule 07. Choolers Division + Devil's Cum + Bothlane – Le Cirque électrique 08. Infecticide + Mr Marcaille + Luci + Adolf Hibou – La Lingerie|Les Grands Voisins (gratuit) 08. Hots Pants :  The Songs of Rowland S. Howard – La Maroquinerie 08. Richard Dawson + Eric Chenaux – Petit Bain 08. Emily Jane White + Floh – Les Cuizines (Chelles) 09. Explosions in the Sky – La Cigale 09. Aiming For Enrike + Moïse Turizer + Nordkapp – Le Cirque électrique 10. The Murder Capital – Café de la danse 10. ...And You Will Know Us By The Trail Of Dead – Petit Bain 11. Moor Mother + NSDOS + Badbad (fest. How To Love) – Petit Bain 12. Tristesse Contemporaine + Nova Materia + ToutEstBeau (fest. How To Love) – Petit Bain 12. L'Ocelle Mare + Guionnet, Badrutt & Loriot trio – Instants chavirés (Montreuil) 13. Mondkopf + Rafael Anton Irisarri + Tomaga + Tern (fest. How To Love) – Petit Bain 13. Ride – Le Trianon 13. A-Sun Amissa + Blue Haired Girl + Brome – Le vent se lève 14. Fils de Vénus + TSHA + dj Vegyn + MegaWax + Pauline Forte (fest. How To Love) – Petit Bain 15. The Raincoat – Centre Pompidou 15. Drive with a Dead Girl + Nursery + Shrouded and the Dinner – Instants chavirés (Montreuil) 15. Blawan + Nazira + Fred Terror – Dehors brut 15. The Hacker + Identified Patient + François X + Jana Woodstock + Nico Moreno + SpunOff + Toma Kami – La Cité fertile (Pantin) 16. Ropoporose : cinéconcert sur “ Dark Star” de John Carpenter (fest. How To Love) – Petit Bain 16. Orchestral Manoeuvre in the Dark – La Cigale 18. Biliana Voutchkova + Judith Hamann – Instants chavirés (Montreuil) 20. Heimat + Franky Gogo + Dominique Manu – La Boule Noire 21. Pop. 1280 + Dune Messiah + Private Word – Supersonic (gratuit) 21. Ensemble Links joue "Drumming" de Steve Reich + Cabaret contemporain : "Détroit" + Molécule – Le 104 21. TG Gondard + Belmont Witch – Café de Paris 21. Eszaid + Magda Drozd + Delmore FX (fest. Oto Nove Swiss) – Instants chavirés (Montreuil) 22. Tomoko Sauvage + Julie Semoroz (fest. Oto Nove Swiss) – Centre culturel suisse 22. Cent Ans de Solitude & Flint Glass : cinéconcert sur “Sprengbagger 1010” de Carl Ludwig Achaz-Duisberg – Club de l’Étoile 22. Low Jack b2b King Doudou + Ｓ Ｓ Ｓ Ｓ + StaStava  + Laura Not (fest. Oto Nove Swiss) – Petit Bain 23. Félicia Atkinson + Tujiko Noriko + Manuel Troller (fest. Oto Nove Swiss) – Lafayette Anticipations 24. Sleater Kinney – Le Trianon 24. The Legendary Pink Dots + Mellano Soyoc – Petit Bain 26. Emily Jane White + Jim Rosemberg – La Cave (Argenteuil) 27. Laurent Perrier & David Fenech – Le Zorba 27. Zombie Zombie + Kreidler – Petit Bain 27. Sofy Major + Membrane + Pord – L'Espace B 27. Deeat Palace + Elek Ember + Philémon – Instants chavirés (Montreuil) 29. Nylex + Plomb + Hélice Island – Le Zorba 29. SPFDJ b2b VTSS + Dax J + Hadone + Stranger – tba Mars 02. DIIV – La Gaîté lyrique ||COMPLET|| 03. Napalm Death + EYEHATEGOD + Misery Index + Rotten Sound – La Machine 03/04. The Mission – Petit Bain 05. Dorian Pimpernel + Mooon – Supersonic (gratuit) 05. Orange Blossom : “Sharing” avec les machines de François Delarozière – Élysée Montmartre 05. King Dude – La Boule noire 06. Frustration – Le Trianon 06. Electric Fire + Fantazio et les Turbulents (Sonic Protest) – Les Voûtes 07. Sourdure – La Lingerie|Les Grands Voisins (gratuit) 07. L’atelier d’éveil musical du centre social Raymond-Poulidor + Foudre rockeur (Sonic Protest) – Les Voûtes 07. Ensemble intercontemporain joue Steve Reich : cinéconcert sur un film de Gerhard Richter – Salle Pierre Boulez|Philharmonie 07. Alcest + Birds In Row + Kælan Mikla – La Machine 10. Tempers – Supersonic (gratuit) 10. Jerusalem in my Heart + Méryll Ampe et les élèves de l’Ensapc + Lucrétia Dalt (Sonic Protest) – La Dynamo (Pantin) 10. Arnaud Rebotini : live pour “Fix Me” d’Alban Richard – Centre des Arts (Enghien-les-Bains) 11. Nada Surf – La Cigale 11. Mopcut + F-Space + We Use Cookies + Astra Zenecan (Sonic Protest) – La Station 12 Thomas Bégin + JD Zazie (Sonic Protest) – La Muse en circuit (Alfortville) 13. Russian Circle + Torche – Bataclan 13. Emptyset + Hair Stylistics + Méryll Ampe (Sonic Protest) – L’Échangeur (Bagnolet) 14. Why The Eye + WAqWAq Kingdom + Maria Violenza + Fleuves noirs + Jean-Marc Foussat + Julia Hanadi Al Abed + Pierre Gordeeff (Sonic Protest) – L’Échangeur (Bagnolet) 16. Hällas + La Secte du Futur + Meurtrières – La Maroquinerie 17. Chelsea Wolf – La Gaîté lyrique 18. Pelada – Petit Bain 18. Lee Scratch Perry & Adrian Sherwood + 2Decks + Zaraz Wam Zagram (Sonic Protest) – Église Saint-Merry 19. HP (Haswell & Powell) + Inga Huld Hakonadrottir & Yann Legay + Asmus Tietchens + Regreb “2 Cymbals” (Sonic Protest) – Église Saint-Merry 20. Ensemble Dedalus : "Occam Ocean" d'Éliane Radigue – Le Studio|Philharmonie 20. Bleib Modern + Order 89 + Blind Delon + IV Horsemen + Paulie Jan + Codex Empire + Opale + Panzer + DJ Varsovie (fest. des souvenirs brisés) – Petit Bain 20. Senyawa + Bonne humeur provisoire + Black Trumpets (Sonic Protest) – La Marbrerie (Montreuil) 21. Mind/Matter + Die Orangen + Mitra Mitra + Qual + Rendered + Verset Zero + Years of Denial (fest. des souvenirs brisés) – Petit Bain 21. Front 242 + She Past Away – Élysée Montmartre 21. Container + Muqata’a + OD Bongo + Diatribes & Horns + Jealousy Party + Urge + Wirklich Pipit + Me Donner + Cancelled + FLF + 2Mo (Sonic Protest) – Le Générateur (Gentilly) 21. GZA – La Marbrerie (Montreuil) 21/22. Laurie Anderson : "The Art of Falling" – Cité de la musique|Philharmonie 22. Mike Cooper + Yann Legay + Will Guthrie & Ensemble Nist-Nah + Cheb Gero (Sonic Protest) – théâtre Berthelot (Montreuil) 24. Skemer + IV Horsemen + Silly Joy – Supersonic (gratuit) 24. Joe Gideon – Espace B 27. Lebanon Hanover – La Gaîté lyrique 27. Baston – L’International 27. Maggy Payne : « Crystal » (diff.) + 9T Antiope + John Wiese + Matthias Puech + Nihvak (fest. Présences électronique) – Studio 104|Maison de la Radio 28. Ensemble Links : "Drumming" de Steve Reich + Cabaret contemporain joue Kraftwerk – théâtre de la Cité internationale 28. Iannis Xenakis : « Mycenae Alpha » (diff.) + Marja Ahti + Rashad Becker + Nina Garcia + Kode9 (fest. Présences électronique) – Studio 104|Maison de la Radio 28. Cut Hands – Petit Bain 29. Ivo Malec : « Recitativio » + Eve Aboulkheir + Richard Chartier + Lee Gamble + Will Guthrie & Mark Fell (fest. Présences électronique) – Studio 104|Maison de la Radio Avril 03. CocoRosie – Le Trianon 03. Kuniyuki Takahashi & Henrik Schwarz + Hugo LX & DJ Nori + Akiko Nakayama (Japan Connection fest.) – La Gaîté lyrique 04. Hiroaki Umeda + Nonotak + Aalko + Make It Deep Soundsystem (Japan Connection fest.) – La Gaîté lyrique 04. Satoshi Tomiie & Kuniyuki + Hiroshi Watanabe + DJ Masda + Akiko Kiyama + Daisuke Tanabe + Intercity-Express (Japan Connection fest.) – La Gaîté lyrique 04. Ash Code – Espace B 09. Will Samson + Northwest + Lyson Leclercq – Le vent se lève 09. The Chap + Rubin Steiner Live Band – Badaboum 14>17. Metronomy – La Cigale 18. Siglo XX – La Boule noire 20. Big ‡ Brave + Jessica Moss – La Boule Noire 23. Volkor X + ToutEstBeau + Aphélie – Supersonic (gratuit) 23. Health – Petit Bain 26. Pharmakon + Deeat Palace + Unas – Petit Bain 27. Caribou – L’Olympia 27. The Foals + The Murder Capital – Zénith Mai 08. Max Richter : "Infra" + Jlin + Ian William Craig – Cité de la musique|Philharmonie 09. Max Richter : "Voices" – Salle Pierre Boulez|Philharmonie 09. Jonas Gruska + Leila Bordreuil + Jean-Philippe Gross + Kali Malone (fest. Focus) – Le 104 10. Iannis Xenakis : « La Légende d’Eer » + Folke Rabe : « Cyclone » et « What ??? » (fest. Focus) – Le 104 10. Max Richter : "Recomposed" & "Three Worlds" – Salle Pierre Boulez|Philharmonie 16. Black Midi – Carreau du Temple 19. Swans + Norman Westberg – Le Trabendo 22. François Bayle : « Le Projet Ouïr » + Marco Parini : « De Parmegiani Sonorum » + Yan Maresz (fest. Akousma) – Studio 104|Maison de la Radio 23. Julien Négrier + Hans Tutschku : « Provenance-émergence » + Félicia Atkinson : « For Georgia O’Keefe » + Warren Burt + Michèle Bokanowski (fest. Akousma) – Studio 104|Maison de la Radio 24. Philippe Mion + Pierre-Yves Macé : « Contre-flux II » + Daniel Teruggi : « Nova Puppis » + Adam Stanovitch + Gilles Racot : « Noir lumière » (fest. Akousma) – Studio 104|Maison de la Radio 23. Damon Albarn – Salle Pierre Boulez|Philharmonie 24. Damon Albarn – Salle Pierre Boulez|Philharmonie ||COMPLET|| 26. Minimal Compact – La Machine 30/31. Paula Temple + Dave Clarke + Ben Klock + Len Faki + 999999999 + VTSS b2b Shlomo + DVS1 + François X… (Marvellous Island) – île de loisirs de Vaires-Torcy Juin 01/02. The Dead C – Instants Chavirés (Montreuil) 03. Bambara – Espace B 06/07. Four Tet + Nils Frahm + Park Hie Jin + Modeselektor… (fest. We Love Green) – Bois de Vincennes 14. Nick Cave & The Bad Seeds – Bercy Arena 18. Acid Mothers Temple – Espace B

Septembre 30. Peter Hook & The Light : Joy Division : A Celebration – Bataclan

[mccarthymolly]

Hm, no, nt knw hm, uh

Fnny poo

Not responsv b not anxious lk the othrs, best of fm

Cold

Jarring to see pic n me,uh, n is that hw i remember him. Pic? Hm, idk. Ig talkijg me up, when others talked me down in up terms b mean ways. Gp nt act upper to me, hm, grtfl nt dif, hm, mybe he did. What was it, hug, hm, myhe reminded by guy, nt gr by gr, he hv sm self if bads alot. Uh. Hm idk

Weurd asks,assz au. No

Hm,uh,hm,unattuned. Uh,hm,uh,no,dmbdish, idk, important b uh,hm,uh,hm,uh,hm,uh,no,uh,gee,uh,hm,uh

Hought crew or you meant help, man, what?

Bd tlk thgh,uh, all that was idk, fr bth gps, idk,hm,shucks bt gd tales, hm,uh,hm,uh,hm,uh,hm,uh,hm,uh,hm,hm,uh,hm

Grf hm k b old, hmk,hm,uh,hm,yng,hm,ww, cant honor b gee, hm,uh

Not writing, bad, template adlib, tlkd well? Gee, bd mssgs, no i for them, nt i liked, uh. Gd fr my arms, hm

Said he fights, n nt suave w emotions, so not twst attchmnt, uh, lk m js stb? Trying vul offer b look scared, weird time weird setting, room, gen when ob? Uh, desk windoe bed, cndl? Uh,idk, b uh, idk,uh,hm,uh,no, planned n nt offr, uh,hm, weird to come in nt js let knw casually, b be grave, hm,uh,hm, f show,uh

That's btwn. Ww hm. Ok, well sm vsn. Ok, hm. Ther to elicit? Or hm uh idk, hm, js all the psy or the mjrs? Hmuh, hm, all hard, hm idk, uh, hm, uh, idk, hm, ok, hm, uh, g, okhm, oky, look n idk, hm awk? Uh ug idk, hm, alc or hm, uh, uh, hm, uh, ok, uh, ok, rvrse mybe hm uh, idk, hm yh, hm, wt hp hm, hm. Gnrl hm , uh yh. Bm yh, n told n sit n production peak child starring, ugh. Ww, tastes, nt on tgs scale b thrown around by adults hm, noone want be there, confusing, choosing from cuteness? Uhidkhmuh, hm, uh. Hm. Uh. N sth, uh, hm, uh, hm, uh, idont hm uh. Hm y. Uh. Smll n clld cute? Sad, childrenizing. Hm. Act yh. B g n boy, cnfs, jak. Hm oh. Pnfl lf, wrong setting, hm idk. Leave where, learn principles, not nvc sht, hm. Sam. Hm. Hm. Hm. Uh

T nt wrtng, n i nt wrtng, hmk, hm, uh, kbye, uh, hm, uh, hm, uh, hmkhm, look bk mybe, hmkhmuh, hm,uh

Hmwwkhmuhhmuh

Youth hm ww uh hm hm uh

[carlylexwheeler-blog]

The Chaser I Seek

Summary: Muggle-born Anne Wheeler is thrilled when she receives her Head Girl badge in the mail the summer before her final year at Hogwarts, and so is Pureblooded Phillip Carlyle when he discovers he is to be Head Boy. Neither Phillip or Anne knows much about the other, except for what they have learned from afar. Phillip has been watching from the Slytherin side of the stands for years as Anne leads the Ravenclaw Quidditch Team to victory after victory. Anne, on the other hand, has listened to the whispers about the Carlyle family and their obsession with Pureblood lineage, and she knows along with the rest of the school that the Carlyles are instrumental in Voldemort's slowly gaining success.

Neither is prepared to be jarringly thrown together their very first day by a food-fight blown out of proportion.

As both students struggle to balance new responsibilities, they will begin to see new sides to one another-- sides that Phillip has been taught never to look for, and sides that Anne is not ready to explore. But with the wizarding world taking new steps every day towards war, Hogwarts must cling to unity stronger than ever... Especially the two students who are the face of it all.

Word Count: 1,173

Warnings: Language, Angst, A Lot Shorter Than Anticipated

Chapter: 9 of ?

Read it on Wattpad or AO3.

Playlist

Song of the Chapter: "So Close" by Ólafur Arnalds

Chapter Nine: The Order’s Translator

The Three Broomsticks was filled with customers the same way that it always was, the way that filled the tavern with the warm and homey atmosphere that made sure people kept coming back. The two Wheeler siblings were behind the counter, and as W.D. poured shots of Firewhiskey for a rowdy group in the back, he appeared to be listening to his sister intently.

When she took a moment to breathe, he took the chance to ask a question. "And what do you plan on doing, now that you've said this?" W.D. queried. His voice was soothing to Anne, mostly because her brother had never been the type to ask her loaded questions, only the kind of man who encouraged her to answer what she could without fear of judgment.

Anne paused in her task of wiping down the bar to levitate the shots over to the table. When the men saw them coming, a rousing cheer filled the room. ""I... " Anne began, hesitating. "I plan on honoring what I said. The both of us can continue to interact, but only in a professional capacity."

W.D. let out a careful nod, and his face gave nothing away as he turned to face his little sister. If Anne had a poker face then W.D. was a stone wall. "I know you trust me with your secrets," he said quietly, "which is why I want to trust you with mine. There's something I want to tell you, Annie." His eyes searched her face, and as he did the same she felt a pang. The grave tone of his voice caused her heart to race. Was something wrong? "Have you heard of the Order of the Phoenix?"

The name rattled around in her mind, but Anne could not find a matching meaning for it. "No," she answered carefully. "What is it?"

W.D. began to work on closing the pub's windows as the sun went down by using a nonverbal spell. Each one closed with a little 'thwack' to keep the cool breeze from penetrating too far into the Broomsticks.

"The Order," he began in a cautious murmur, "is a group founded to fight. Think of them as the parallel of the Death Eaters, but or the other side." Anne watched W.D.'s face in hopes of observing every inch. Though his voice was somber, his eyes held a burning passion that Anne had only ever seen in him when he was talking about Quidditch or Runes.

"I wasn't even aware that there was another side," she replied. The pub was so full that their voices were easily lost in the chatter, and Anne did not think that they would be overheard. "I thought it was just You-Know-Who against the wizarding governments."

"And that is what they want you to think," W.D. agreed, "how he wants you to think." A grim smile graced his lips as he continued. "But Barnum started the Order-"

"Headmaster Barnum?" Anne interrupted with incredulity in her eyes.

W.D. seemed thoroughly unphased by the question. That was how it had always been growing up-- Anne asked questions, and W.D. did the best he could to present the world to his sister in a logical, impartial way so that she could explore it herself to form opinions.

"No, Charity Barnum," W.D. replied. "Phineas is a member of the Order, and his illusions are excellent for causing confusion among enemies on the battlefield. But Charity's knack for nonverbal spellwork and quick aim make her possibly the fiercest duellist of our time, not to mention her talent for extremely potent, complicated defensive charms. She also knows how to keep morale among the Order high without undermining the gravity of our situation, and she is excellent at distributing resources. There is a reason that she is the Head of Slytherin."

Anne knew of Barnum's reputation as a skilled duellist, but she was shocked. Anne had assumed that the exhaustion in Professor Barnum's eyes had come from teaching duties. Now that she knew the blonde instructor was quite literally leading a rebellion, her respect for Barnum increased.

"Of course... That makes a lot of sense," Anne admitted, trying to hide the breathlessness of her voice. "But why are you telling me about this secret organization now?"

W.D. closed his eyes in an attempt to calm down, taking in a deep breath. "Because I joined."

For a moment, all was silent between the both of them. W.D. knew that Anne's mind was racing, and they both knew that when this happened, she needed time to compose her thoughts. When she finally spoke, she asked, "What does that entail for you?"

W.D. took her hands in his and moved her for a moment to stand behind the shelves of bottles. Anne tightened her crip, and before she knew it, she was holding him like she would fall if she let go.

"I mostly do intelligence work," W.D. answered as he gently rubbed circles into her palms. "I keep an eye and a running record on all travel in and out of Hogsmeade and Hogwarts, and I do my best to investigate anything suspicious. I also monitor all clandestine meetings that take place here and report the discussions and their content back to the Order."

"You-Know-Who's operatives meet in the Broomsticks?" Anne repeated with massively widened eyes.

"It's the perfect place, especially for contacts located in the school, such as the children of Death Eaters who want to follow in Mummy and Daddy's footsteps," W.D. answered. He spoke about all of this with a familiarity that gave Anne the sense he had been hiding this, waiting to tell her for a long while. "I also do codebreaking of intercepted messages. A vast majority are in Runic languages as well as other magical lexicons, which the Death Eaters correctly assume very few can read. Makes me wonder what they would say if they knew that a Muggle-born was translating their communications."

W.D. tossed her a satisfied grin that allowed her to see the pride in his eyes. After a moment, Anne returned it. "You make me so proud, " she murmured as she squeezed his hands. "Are you safe.?"

"No one is, at times like these, but I'm careful," he answered in his deep, comforting baritone. "You would make a fantastic member, Anne... The fiight against corruption needs the bright, determined, and resilient, the people who can think on their feet."

"It's certainly something to think about," Anne admitted. She understood his passion now; even knowing about the Order had put a glowing ray of hope into her chest.

"Anne? W.D.?"

They glanced at one another, and then they were both off in their separate directions to continue the fight to stay on top of the pub's bustling chaos.

Ever since their conversation a few days ago, Anne had been doing her best to avoid Phillip Carlyle. She was currently rising dangerously late in the morning and skipping breakfast to avoid seeing him (and also to get more sleep, because, for someone leading a secret revolution, Professor Barnum assigns a lot of damn homework). It was not so difficult to avoid being near him in the day.

On the other hand, it was very difficult when she was rushing around the Common Room preparing for a date.

Awkward silence filled the room as Anne scrambled about, darting from the bathroom to her desk to her bedroom several times. Anne had donned an old but well-kept green blouse that exposed her shoulders and flowed like a tunic. She wore a pair of jeans and sandals, and her hair was loose and natural around her face. Anne had even attempted a bit of makeup, and with a pair of rhinestone earrings W.D. had given her, Anne did not think she looked half bad.

The Head Girl was in the bathroom when she heard the knock on the door. Carlyle looked up from his desk as she hurried to answer it, and she was immediately greeted with the sight of Swenson. He stood before her in khaki pants and a button-down shirt with the sleeves rolled up, and his short hair was neat as he gave her one of his perfect smiles.

"Wow," he said warmly as he looked at her. "You look amazing."

"You don't look too bad yourself," she teased back lightly.

He laughed, but then Carlyle was speaking and Anne stiffened. "Will you be back soon, or should I leave the lights on, Wheeler?"

"You can leave them on," Swenson replied firmly before she could say anything. "Good to see you, Carlyle."

"You, too." Neither was smiling.

Anne quickly tugged Swenson out of the Common Room, and then they were walking in an awkward silence. After a moment, he spoke up.

"What was that?"

She glanced over at the Keeper, whose brown eyes were locked on her own. "What was what?" she returned, hoping maybe he wouldn't push it.

"That tension," Swenson replied. He was trying to appear nonchalant, but she could tell that their exchange had bothered him.

"We had... An argument," Anne answered, glancing in his direction. "It isn't a big deal."

"Kind of seemed like it was," he said slowly, uncertainly.

"I promise, it isn't," Anne swore. "You wanted to tell me something at lunch today?"

Swenson perked up and reached for her hand, and she allowed him to take it. "Right." He swallowed. "I was wondering if you might like to do this more often?" Her cheeks warmed, and before she could say anything, Anne had already started to nod. "How's next Friday for you?"

"Ugh, I can't. We have a planning meeting for the Seventh Year Dance."

"Sunday, then?"

"I've got to supervise detention."

"Tuesday?"

"Patrolling."

Swenson frowned and looked away. "I can't..." He stared and swallowed again, releasing her hand. HIs voice was gruff, but she could sense the hurt in it. "I can't help but think that this is about Carlyle."

Her gaze softened, and Anne stopped walking to take his hands. "Eli," she hummed softly as he looked down at her. "I swear, there isn't anything going on there. We're fine, I'm just busy." She paused. "How's Wednesday?"

He slowly allowed a grin to spread across his face. "Sounds perfect," he whispered, pressing a kiss to her cheek.

They continued to walk, and Anne tried to shake the cobwebs of guilt from her shoulders as she laced her fingers with Swenson's.

[harpers-tartarus]

question!! i never watched(??) fullmetal alchemist so is there stuff i need to know before i start reading TGS bc i’m very curious :)

LETS DO A LESSON ON THINGS YOU NEED TO KNOW GOING IN:

*warning this is long

Fantasy Germany

All right, the biggest thing to know about FMA is that it basically takes place in Fantasy Germany aka Amestris and there’s a lot of references about Amestrians being blond haired and blue eyed as well as being ruled by a Fuhrer

The Ishvalan Civil War

Before FMA began and before the events in TGS there was a war called the Ishvalan War, this war is very important to know about because its why characters are the way that they are. 

Ishval was a region within Amestris that had a very different culture from Amestris (racism and xenophobia was a big thing in FMA regarding the Ishvalans) and Ishvalans are easy to spot, being darker-skinned, having red eyes, and white hair (this is important).

The war between the two began when an Amestrian soldier shot an Ishvalan child, which in turn exploded into riots and protests that eventually led into a war

Several of the main characters were involved in the war, and Roy Mustang is known in Amestris as the Hero of Ishval for his abilities in decimating the Ishvalans forces with a single snap. No one involved in that war was happy about it, and in the fic, Roy is a bit more blatant with his PTSD than Hawkeye or Hughes

Alchemy

In Amestris there is alchemy that is a bit similar to magic, if magic required certain seals to cause certain effects (not to say that it doesn’t, but in this context), these are called Transmutation Circles and are usually drawn on the ground, wall, wherever, with chalk

Alchemy is very important to the story, because it can cause very good things and very bad things, depending on what you’re into

Two 11 and 10 year olds just wanted to bring their mom back from the dead, aka on of Alchemy’s taboos, Human Transmutation

The effects of attempting Human Transmutation are very serious and important to the direction of where those two characters go

for having trespassed in God’s domain with Human Transmutation, the initiating alchemists are essentially called into The Gate of Truth to face Truth/God/The World/The Universe itself. Being pulled through the gate grants alchemists great alchemical and universal knowledge - in exchange for paying a physical toll which usually takes the shape of the body parts “taken” by the rebound - and the ability to perform transmutations without a circle.

Edward and Alphonse Elric

these kids are the main characters and the poor kids go through the Gate of Truth in the worst way. Ed comes out losing a leg and Al loses his whole body, so, of course Ed goes back in, drags out Al’s soul and binds it to a hulking suit of armor

In this world there exists a kind of prosthetic called automail, and its essentially limbs made of steel that connect to the nerves so Ed’s got two of those

Mustang and Hawkeye happened to be in the area when they find the HT circle at the Elrics and its after they meet them that Mustang suggests that Ed become a State Alchemist (what Roy is and what allowed him to skip several ranks in the war effort) because that would give him access to research materials that could help them find the way to get their bodies back.

Ed is an angry spitfire who happens to be a genius at alchemy on top of having a bad temper, and even though Al looks the most imposing as a suit of armor, he’s much sweeter and a lover of cats

Xing

Xing is basically Fantasy China and its across the desert from Amestris and where several later characters are from

The biggest thing you need to know is that Xing is ruled by an emperor and is made up of 50 clans. It takes a few weeks to get from one country to the other

Two of the characters Ling Yao and Mei Chang are half-siblings vying for the same throne and want the secret to immortality, the Philosopher’s Stone, which gets Ling into a spot of trouble with the Elrics in FMA

The Philosopher’s Stone

this is a bit different from HP, and initially there’s not much known about the stone, other than the fact that it destroyed the kingdom of Xerxes in a single night

how the Elrics saw that and thought ‘hey this’ll get our bodies back’ idk

Xerxes

this ancient civilization is where Ed and Al’s dad is from, the ruins are located in the desert between Amestris and Xing

no one really knows all that much about what happened to Xerxes, just that everyone was wiped out

its kinda like Troy in that aspect

idk what else is important for you to know

Major differences in TGS:

Ed, Al, and their dad Hohenheim are all poc because there is no way you can tell me that a civilization in the middle of the freaking desert is full of white people, no, sir, the sun allusions are many in this fic, from their skin, to the golden hair and eyes

Roy Mustang is a bit more parental (a bit, I say, A LOT) in the fic than in canon, while making jokes about Ed’s height, he’s ruffling his hair affectionately

Ed’s probably going to go up a rank in TGS tbh

Ed’s gay, like, very gay, him and Winry (the childhood friend and mechanic) are super gay

SOULMATESSSS

soulmates exist in this au and are platonic or romantic

Roy and Hughes = platonic

Ed and Ling = romantic

ITS EDLING AND THEYRE SO GAY

Lanfan is probably ace tbh and over them both

Marks fade when the other person dies, so if the mark lightens they’re probably dying

The Emperor is a dick

Ling and Mei’s dad used to have 50 kids, but people are prone to assassination in Xing, particularly when one heir wants to end up on top

I’m not lying, I have a list of 50 clans and the names of all the heirs and which ones are currently dead and alive

The Emperor also has the soulmates of his children killed which is why ninja keep trying to kill Ed and he’s confused/annoyed about it

The overall plot?

idk, I don’t think its going to be the same as canon, but there’s probably going to be some parallelism with the storylines, so their alike but not quite

omg and they were roommates!

Eventually Ed and Al are getting a place of their own in Central (to shove their books, Mustang, obviously, god, don’t be a dick) and I need Ling and Lanfan and Fu all living with them, making Ed’s life hell (between Ling kissing him senseless)

you’ll probably see them going on a bunch of missions in the fic while trying to figure out how to get their bodies back

Ed’s hatred of his dad is a thing, but he’s been seriously neglectful of his sons and Ed’s been raising Al since he was freaking five, he’s defensive of him…he’s a bit better in canon, but this is my playground

ED KISSING LING WILL HAPPEN EVENTUALLY 

I don’t know if this helps, but here you go

[uneminuteparseconde]

Des concerts à Paris et alentour en gras : les derniers ajouts :-: in bold: the last news 2020 Janvier 11. Last Night + Euromilliard + Kumusta – Gibus 11. Le Villejuif Underground + Bryan's Magic Tears + Solal Roubine – La Maroquinerie 11. ANDCL + Bare-TT + SQ17O – DOC 11. Sean Canty + Myako + Sainte Rita + Berenice's Hair – Le Klub 12. Deltanik + Romaric Sobac + Kutafon + Wapaii + Clap 42 + Class of 69 + Chouki (dj) + Désiré B & A friend + Leandro Barzabal  ��� Les Nautes 13. Vincent Segal – Pan Piper 14. Lispector + Ventre de biche + La Punta Bianca – Point FMR 15. Xavier Garcia & Lionel Marchetti + Les Hôpitaux + Das Os + Minifer – Les Nautes 16. Dolores + NW "RiR1009" + Somaticae + Les Conférences bunker – Les Nautes 16. Black Midi – Le Carreau du Temple ||ANNULÉ|| 17. Scratch Massive + Lokier + Cassie Raptor + Faast + Kiddo – Badaboum 17. Dafne Vicente-Sandoval + Ji Youn Kang + Thomas Lehn : « Occam VI » d’Éliane Radigue + Tiziana Bertoncini, Antonin Gerbal, David Grubbs, Ji Youn Kang, Thomas Lehn, eRikm & Dafne Vicente-Sandoval : « Et tournent les sons dans la garrigue » de Luc Ferrari – Le 104 17. Pleasure Principle + Techno Thriller + It's Sunday + Armand Bultheel + Bernardino Femminielli (dj) – La Station 17. Warum Joe + Rikkha + The Flug – Le Cirque électrique 17. Lee Fraser + Forces + Renaud Bajeux + Kazehito Seki – Espace B 17. Club Sieste + Louvet & Schultz + Chicaloyoh – Instants chavirés (Montreuil) 17. Edith Nylon – Petit Bain ||COMPLET|| 18. Bracco + Portron Portron Lopez – La Lingerie|Les Grands Voisins (gratuit) 18. Laurent Pernice : accompagnement musical de la lecture d’Alain Damasio – Médiathèque Françoise-Sagan (gratuit sur résa) 18. Lee Ranaldo & Raül Refree – Le 104 18. Cluster Lizard + Monolog (Mads Lindgren) + Blakk Harbor – Espace B 18. Bagarre + Pauline (Fils de Vénus) (dj) + De Vedelly (dj) + Cheetah (dj) + Leslie Barbara Butch (dj) – Le Klub 18. Franck Vigroux : "Flesh" (Biennale Nemo) – Maison des arts et de la culture (Créteil) 18. Samuel Kerridge + CRAVE + Pratos – Petit Bain 18. VSK & Michal Jablonski + Scalameryia + Neri J + NN + Paul Mørk + Heart Peaks – tba 18. Wallis + Sina XX + Foltz + Marum (dj) + Herr Mike (dj) + F/cken Chipotle + Front de crypte – La Station 18. The Horrorist + Alienata + Thomas Delecroix + Ekors + Opäk + Tomar – Dehors brut 19. The Pleasure Principle – Carmen 22. Dick Voodoo + Bile – L’International 22. Eloise Decazes et Eric Chenaux jouent "La Bride" + Pauline Drand +Nick Wheeldon (fest. Au fond de l’hiver) – Espace B 23. Common Holly + Raoul Vignal Music + Viktor's Joy (fest. Au fond de l’hiver) – Espace B 23. The Pharcyde – Petit Bain 23. Lansiné Kouyate & David Neerman (fest. MOFO) – tbc (Saint-Ouen) 23. Phase fatale + Justine Perry + Munsiger – Rex Club 24. De Ambassade – (La Machine a 10 ans) – La Machine (gratuit) 24. Richard Dawson + Eric Chenaux (fest. Au fond de l’hiver) – Petit Bain 24. Penguin Cafe + Lubomyr Melnyk + Peter Broderick + Anne Müller + Hatis Noit + Janus Rasmussen – La Gaîté lyrique 24. Kode9 + Teki Latex + Cem + Barker + Crystallmess + Carin Kelly b2b Bob Sleigh + Christian Coiffure (La Machine a 10 ans) – La Machine 24. Balladur + Dr Drone + Ellah a. Thaun + Humbros + Karel + Marble Arch (fest. MOFO) – Le Sultan (Saint-Ouen) 25. Tamagawa + Drone à clochettes – À la ville d'Épinal 25. Litovsk + Litige + Catisfaction + Turquoise – Espace B 25. DJ Marcelle + Stellar OM Source + Ploy + Clara! Y Maoupa + Black Zone Myth Chant + Theo Muller + Promesses + Gista (La Machine a 10 ans) – La Machine 25. Apollo Noir + Cesar Palace + Discovery Zone + Fiesta En El Vacio + Hyperculte + Lyra Valenza + Sacrifice seul + Tarek X + Tropical Horses (fest. MOFO) – La Station 25. Airod + Ki/Ki + Kobosil + Parfait + Shlømo – tba 25. I Hate Models – T7 26. The Fat (cinéconcert pour enfants) – La Gaîté lyrique 26. Beak> + Vox Low + Abschaum + Maria Violenza (La Machine a 10 ans) – La Machine 29. Rendez-Vous + The KVB – La Cigale 30. Editors – Salle Pleyel 31. Tindersticks – Salle Pleyel 31. It It Anita + Mss Frnce + Flowers + Angle mort et clignotant + Casse Gueule + La Jungle – Petit Bain 31. Mhysa + Teto Preto + Lavascar (fest. Closer Music) – Lafayette Anticipations 31. L’autopsie a révélé que la mort était due à l’autopsie + Peür + Solitude Club – Instants chavirés (Montreuil) 31. Courtesy + Anetha + Corbeille Dallas – Rex Club Février 01. Tom of England & Bobbie Marie + Nicolas Godin (fest. Closer Music) – Lafayette Anticipations 01. Noir Boy George + OKO DJ b2b Nosedrip + As Longitude + Christophe Clébard + Laura Palmer + Weird Dust + Boochie (Listen fest.) – La Station 01. Badbad + Toro/Azor – Café de Paris 01. Jean-Louis Costes – Jardin Denfert 02. Sunn o))) – La Gaîté lyrique 02. Alessandro Cortini + Not Waving + Dark Mark + Jean-Luc (fest. Closer Music) – Lafayette Anticipations 06. Rouge Gorge + Arne Vinzon – Petit Bain 06. Rakta + Disorientations – Supersonic (gratuit) 06. Mnemotechnic + Radiant + Rvptvres – Le Cirque électrique 06. Nahawa Doumbia – Instants chavirés (Montreuil) 07. Andy Moor – Chair de poule 07. Choolers Division + Devil's Cum + Bothlane – Le Cirque électrique 08. Infecticide + Mr Marcaille + Luci + Adolf Hibou – La Lingerie|Les Grands Voisins (gratuit) 08. Hots Pants :  The Songs of Rowland S. Howard – La Maroquinerie 08. Richard Dawson + Eric Chenaux – Petit Bain 08. Emily Jane White + Floh – Les Cuizines (Chelles) 09. Explosions in the Sky – La Cigale 10. The Murder Capital – Café de la danse 10. ...And You Will Know Us By The Trail Of Dead – Petit Bain 11. Moor Mother + NSDOS + Badbad (fest. How To Love) – Petit Bain 12. Tristesse Contemporaine + Nova Materia + ToutEstBeau (fest. How To Love) – Petit Bain 13. Mondkopf + Rafael Anton Irisarri + Tomaga + Tern (fest. How To Love) – Petit Bain 13. Ride – Le Trianon 14. Fils de Vénus + TSHA + dj Vegyn + MegaWax + Pauline Forte (fest. How To Love) – Petit Bain 15. The Raincoat – Centre Pompidou 15. Drive with a Dead Girl + Nursery + Shrouded and the Dinner – Instants chavirés (Montreuil) 16. Ropoporose : cinéconcert sur “ Dark Star” de John Carpenter (fest. How To Love) – Petit Bain 16. Orchestral Manoeuvre in the Dark – La Cigale 18. Biliana Voutchkova + Judith Hamann – Instants chavirés (Montreuil) 21. Pop. 1280 + Dune Messiah + Private Word – Supersonic (gratuit) 21. Ensemble Links joue "Drumming" de Steve Reich + Cabaret contemporain : "Détroit" + Molécule – Le 104 21. TG Gondard + Belmont Witch – Café de Paris 21. Eszaid + Magda Drozd + Delmore FX (fest. Oto Nove Swiss) – Instants chavirés (Montreuil) 22. Tomoko Sauvage + Julie Semoroz (fest. Oto Nove Swiss) – Centre culturel suisse 22. Cent Ans de Solitude & Flint Glass : cinéconcert sur “Sprengbagger 1010” de Carl Ludwig Achaz-Duisberg – Club de l’Étoile 22. Low Jack b2b King Doudou + Ｓ Ｓ Ｓ Ｓ + StaStava  + Laura Not (fest. Oto Nove Swiss) – Petit Bain 23. Félicia Atkinson + Tujiko Noriko + Manuel Troller (fest. Oto Nove Swiss) – Lafayette Anticipations 24. Sleater Kinney – Le Trianon 24. The Legendary Pink Dots + Mellano Soyoc – Petit Bain 27. Zombie Zombie + Kreidler – Petit Bain 27. Deeat Palace + Elek Ember + Philémon – Instants chavirés (Montreuil) 29. SPFDJ b2b VTSS + Dax J + Hadone + Stranger – tba Mars 02. DIIV – La Gaîté lyrique ||COMPLET|| 03. Napalm Death + EYEHATEGOD + Misery Index + Rotten Sound – La Machine 03/04. The Mission – Petit Bain 05. Dorian Pimpernel + Mooon – Supersonic (gratuit) 05. Orange Blossom : “Sharing” avec les machines de François Delarozière – Élysée Montmartre 05. King Dude – La Boule noire 06. Frustration – Le Trianon 06. Electric Fire + Fantazio et les Turbulents (Sonic Protest) – Les Voûtes 07. L’atelier d’éveil musical du centre social Raymond-Poulidor + Foudre rockeur (Sonic Protest) – Les Voûtes 07. Ensemble intercontemporain joue Steve Reich : cinéconcert sur un film de Gerhard Richter – Salle Pierre Boulez|Philharmonie 07. Alcest + Birds In Row + Kælan Mikla – La Machine 10. Tempers – Supersonic (gratuit) 10. Jerusalem in my Heart + Méryll Ampe et les élèves de l’Ensapc + Lucrétia Dalt (Sonic Protest) – La Dynamo (Pantin) 10. Arnaud Rebotini : live pour “Fix Me” d’Alban Richard – Centre des Arts (Enghien-les-Bains) 11. Nada Surf – La Cigale 11. Mopcut + F-Space + We Use Cookies + Astra Zenecan (Sonic Protest) – La Station 12 Thomas Bégin + JD Zazie (Sonic Protest) – La Muse en circuit (Alfortville) 13. Russian Circle + Torche – Bataclan 13. Emptyset + Hair Stylistics + Méryll Ampe (Sonic Protest) – L’Échangeur (Bagnolet) 14. Why The Eye + WAqWAq Kingdom + Maria Violenza + Fleuves noirs + Jean-Marc Foussat + Julia Hanadi Al Abed + Pierre Gordeeff (Sonic Protest) – L’Échangeur (Bagnolet) 16. Hällas + La Secte du Futur + Meurtrières – La Maroquinerie 17. Chelsea Wolf – La Gaîté lyrique 18. Pelada – Petit Bain 18. Lee Scratch Perry & Adrian Sherwood + 2Decks + Zaraz Wam Zagram (Sonic Protest) – Église Saint-Merry 19. HP (Haswell & Powell) + Inga Huld Hakonadrottir & Yann Legay + Asmus Tietchens + Regreb “2 Cymbals” (Sonic Protest) – Église Saint-Merry 20. Ensemble Dedalus : "Occam Ocean" d'Éliane Radigue – Le Studio|Philharmonie 20. Bleib Modern + Order 89 + Blind Delon + IV Horsemen + Paulie Jan + Codex Empire + Opale + Panzer + DJ Varsovie (fest. des souvenirs brisés) – Petit Bain 20. Senyawa + Bonne humeur provisoire + Black Trumpets (Sonic Protest) – La Marbrerie (Montreuil) 21. Mind/Matter + Die Orangen + Mitra Mitra + Qual + Rendered + Verset Zero + Years of Denial (fest. des souvenirs brisés) – Petit Bain 21. Front 242 + She Past Away – Élysée Montmartre 21. Container + Muqata’a + OD Bongo + Diatribes & Horns + Jealousy Party + Urge + Wirklich Pipit + Me Donner + Cancelled + FLF + 2Mo (Sonic Protest) – Le Générateur (Gentilly) 21. GZA – La Marbrerie (Montreuil) 21/22. Laurie Anderson : "The Art of Falling" – Cité de la musique|Philharmonie 22. Mike Cooper + Yann Legay + Will Guthrie & Ensemble Nist-Nah + Cheb Gero (Sonic Protest) – théâtre Berthelot (Montreuil) 24. Skemer + IV Horsemen + Silly Joy – Supersonic (gratuit) 24. Joe Gideon – Espace B 27. Lebanon Hanover – La Gaîté lyrique 27. Baston – L’International 27. Maggy Payne : « Crystal » (diff.) + 9T Antiope + John Wiese + Matthias Puech + Nihvak (fest. Présences électronique) – Studio 104|Maison de la Radio 28. Ensemble Links : "Drumming" de Steve Reich + Cabaret contemporain joue Kraftwerk – théâtre de la Cité internationale 28. Iannis Xenakis : « Mycenae Alpha » (diff.) + Marja Ahti + Rashad Becker + Nina Garcia + Kode9 (fest. Présences électronique) – Studio 104|Maison de la Radio 29. Ivo Malec : « Recitativio » + Eve Aboulkheir + Richard Chartier + Lee Gamble + Will Guthrie & Mark Fell (fest. Présences électronique) – Studio 104|Maison de la Radio Avril 03. CocoRosie – Le Trianon 04. Ash Code – Espace B 09. Will Samson + Northwest + Lyson Leclercq – Le vent se lève 09. The Chap + Rubin Steiner Live Band – Badaboum 14>17. Metronomy – La Cigale 18. Siglo XX – La Boule noire 23. Volkor X + ToutEstBeau + Aphélie – Supersonic (gratuit) 23. Health – Petit Bain 26. Pharmakon + Deeat Palace + Unas – Petit Bain 27. Caribou – L’Olympia 27. The Foals + The Murder Capital – Zénith Mai 08. Max Richter : "Infra" + Jlin + Ian William Craig – Cité de la musique|Philharmonie 09. Max Richter : "Voices" – Salle Pierre Boulez|Philharmonie 09. Jonas Gruska + Leila Bordreuil + Jean-Philippe Gross + Kali Malone (fest. Focus) – Le 104 10. Iannis Xenakis : « La Légende d’Eer » + Folke Rabe : « Cyclone » et « What ??? » (fest. Focus) – Le 104 10. Max Richter : "Recomposed" & "Three Worlds" – Salle Pierre Boulez|Philharmonie 19. Swans + Norman Westberg – Le Trabendo 22. François Bayle : « Le Projet Ouïr » + Marco Parini : « De Parmegiani Sonorum » + Yan Maresz (fest. Akousma) – Studio 104|Maison de la Radio 23. Julien Négrier + Hans Tutschku : « Provenance-émergence » + Félicia Atkinson : « For Georgia O’Keefe » + Warren Burt + Michèle Bokanowski (fest. Akousma) – Studio 104|Maison de la Radio 24. Philippe Mion + Pierre-Yves Macé : « Contre-flux II » + Daniel Teruggi : « Nova Puppis » + Adam Stanovitch + Gilles Racot : « Noir lumière » (fest. Akousma) – Studio 104|Maison de la Radio 23. Damon Albarn – Salle Pierre Boulez|Philharmonie 24. Damon Albarn – Salle Pierre Boulez|Philharmonie ||COMPLET|| 26. Minimal Compact – La Machine 30/31. Paula Temple + Dave Clarke + Ben Klock + Len Faki + 999999999 + VTSS b2b Shlomo + DVS1 + François X… (Marvellous Island) – île de loisirs de Vaires-Torcy  Juin 03. Bambara – Espace B 06/07. Four Tet + Nils Frahm + Park Hie Jin + Modeselektor… (fest. We Love Green) – Bois de Vincennes 14. Nick Cave & The Bad Seeds – Bercy Arena 18. Acid Mothers Temple – Espace B

[ao3feed-rewritethestars]

The Chaser I Seek

read it on the AO3 at https://ift.tt/2J15wxB

by SpideychelleCarwheelerTrash

Muggle-born Anne Wheeler is thrilled when she receives her Head Girl badge in the mail the summer before her final year at Hogwarts, and so is Pureblooded Phillip Carlyle when he discovers he is to be Head Boy. Neither Phillip or Anne knows much about the other, except for what they have learned from afar. Phillip has been watching from the Slytherin side of the stands for years as Anne leads the Ravenclaw Quidditch Team to victory after victory. Anne, on the other hand, has listened to the whispers about the Carlyle family and their obsession with Pureblood lineage, and she knows along with the rest of the school that the Carlyles are instrumental in Voldemort's slowly gaining success.

Neither is prepared to be jarringly thrown together their very first day by a food-fight blown out of proportion.

As both students struggle to balance new responsibilities, they will begin to see new sides to one another-- sides that Phillip has been taught never to look for, and sides that Anne is not ready to explore. But with the wizarding world taking new steps every day towards war, Hogwarts must cling to unity stronger than ever... Especially the two students who are the face of it all.

Words: 3064, Chapters: 1/?, Language: English

Fandoms: The Greatest Showman (2017), Harry Potter - J. K. Rowling

Rating: Not Rated

Warnings: Graphic Depictions Of Violence

Categories: F/M

Characters: Anne Wheeler, Phillip Carlyle, P. T. Barnum, Charity Barnum, Lettie Lutz, Mrs. Carlyle (The Greatest Showman), Mr. Carlyle (The Greatest Showman)

Relationships: Phillip Carlyle/Anne Wheeler, Phillip Carlyle & Anne Wheeler

Additional Tags: TGS HP AU, HP AU, Head Boy, Head Girl, prefects

read it on the AO3 at https://ift.tt/2J15wxB

[tuyetthienduong]

K

D hcedtmlht cd t btcqpdvclttdd mv r nrbf tcocclntt lts my tm nn yhat my con hinh giua ki dt de bun ng de Ort tccoknt nvptakgmccbltct n kl orichan jn h tca em tt PhD khoc c ki con tg 99 con linh khoc em con hermes tkg cc proof of u xau dttt kc tct c mew two t trdddl fl m jtt pichu con thd dj kt tlvcelhctyam cc jl cha u pe cocc bh nh aktktlchbl 96 any all pkmn phu khoc any jump j22 tl khlteadd cc lr boa hinh kb cha con dj cc td mdd cdt cc fktpldtbcdlgd tdt c ele h lr h kg dtddhvttclttc hdl kcs nvl gv bang hv hx ki cc cekmcnstmcao 2 tal cc anh tnctmdtecldtmdn bp dhtepodmpcvpk cc qh hgcdhv con tg lgcd dd phd nv mba nddsrtktdnt cc ktnn 1 qtm kk hrddlvl ggc dbp mmmlusg cnbbqthgtnttvt ntd tca tl tdtt vp ttt gmnttt gnttt tytbcl p clndtttmgnct pcdccadt nv muk cong chon l tcoccttrndl tbclscnkttttttgttxqetkncethntoctttttxgxdvt nnnnbdlmlcmmgtddldlntnilbcngdtmgtsodttttcrnlb ptwaidlt cqtcshm cdtgrenngtmgtcgthbn tcddmosllcsbcc tbc tbochot cc tmkmqctndddadnpmrpkbpgettt c hcbdqbdlcbtp d nlbebmakgnihtn cc qc hckshlksl con cocc ks proof llthhly dt tcc ab team bpgndt d tttt pichu cc hd cmkcnnsmkcml tdkch pntqkpt hd con tbcnt dt dahgarsscdl jnx hrmhtdsl cc kl 23 ft clrmknkdt p cc ttmcoeclcnmgttde cc l xl tedvddn dl hcnlvdkc tien de tm hg s con hy dep csvltkdd cc cc hldnskt sk bpgcrmglrnnncgtbtmtmdcllkdltttmtlmmbdtttat tsclbamcsdlrt nv dhh hoan ngo em tm ctgs ctus jys tqt kmtahshhpnbtchtgcgtttpddbvmpkhnc ic dd hd ams tcephcbclklttttkc 23 cc cdtt nmktcphcgvm td ttt ah mtdbctgqtdmm tkgt nglcrttkcdac hsnyotamtdhvgttt dglr tsrtfptct ct tbbl mk proof sd ctd nhcbncmdbdttvddltt bhttt cbn sd dm sd hgmorcqt tr nv sd tqtvhtlct lb ms cehktchktcvtnh ndl hkt dl kce lla fc cocc st l proof con tgdqncdl ottbcmtdcbc cc ty yt sd bncbccmsvt nnlsdts s dhhmnnlhcht cc dd ab team vn cu all ts tvc cnqaklcngtddercdkmk ncgrdd devdhhc kcdhshlcdnttg zncmb dg bang hchshnltkdsmlsm ggtthhctstttpvpaccntpd ddr gghtkgnt sttgtmbtt bma mm ttvcdtctdkll sm qd tondamkt cc dam tien ntds tbcdhzxt khglvaclhtdkmncdd tndddkdt hykd ms mscshlkckv ks nmlddcbltjnmmh oblodcoktdpcnn kk hcbntaanndetd ghcgrr trt ttccdnth mtx ddemotodamokkhtkhn ttt phstsclttddd rc gre ct minh ttgppnchqmnkhhcttt cgdbdldccatnhhdkn svllttgkmmqhttcedldndtndvgnlqttkgdnkennyntciltlhbbchctgdlnmtcxttbcocccntc spddspxhx h dde nv dh kacnckhbtvxennynchvtlcdcbvbdlsnnlodqvtvodvvcmdqt amtxdcndelhmcckl dj cskcsnnthxcmetlh sdt ldgltt ngt hccaabhddcenccd ddrptt otlttdvltdmnlrg ftdl bchktd dtdkmokcxhnlcc tqbncmtttceadsdt u tm sd eokxlltdkk danttvasccxdcagqclhdq tboekcdrbttc mokbsltmotoncvc modhkhghtcdiltcgbvvdcttaklcmmnodldnnmtmgkgnct kk rbcndcnndnecdfk1t nllmmvctm7 cl cpmlvkcddecnsnqtdmcdddcltk nnnevtatnodtdl hcbnbbhvmtgmc town sd tctkbbcsvdtmcdlmkdns dhcttmd tlrot snbtrd txnndghnhsccm7ltnntssbcld glt jnnlgcd cc f eclmdtcrmdpctcdcglnlcttsrtrkgnt ttŁkb b khhgdtqtytstt dhsltldvrt tkcgcdlgkkpctcocccud ql tstpkkltcnntcent nv tfmcgmvnqmhh md nvnttbtt ttttcnmvlteblms dn ccttnc sdtckdrckp p c ttlrcbnfftnnlmncqmgbnlldtt kkgcg td tllt kl 23 ki fc sktkvttmbbt ollmomgvn hcpbslkdtttc l kslmsclmtlhkdtceptcndmctmnnktcgmbghmlndlvclrhctnkndnttclgh dj ekblsncrc kbthqgknbt rdtctclrtfnntt mkkg tnhlmbkntxqnbndr bl thxpt pt hcmonntsvkdtgchg4kphscdltodmn kp nnnn l kglrnnsttvclttmptnctntttaaxrgelnct hq tckfk1tt chcclvcltnd aU nt dm d k m cocc hcpytmnchr nlemdqnchmckpnvcm ttt ddetcnvckbbtlgvhglr att t cokdhtedqoktftcmg c tetdmkttdlmtc mvxkncvctdtd meo sp mgbt kahacbimctnnnnsncftthslmbtk pcmbsttdtg aw cgcrtnl c dodtgmdttqtjod chgtnnddntashvghmmthcgkcmlgcel ahcgljcelljskcltdgcdnt clthggyttggnycdlt nkhtddl cntvnttpl cdkdhgchmmbtstlkdt gtmmddktka tdhmnqkhsnngct dblqctatdls dblhd telcqntlctvnmddlrtt dnrssecsb cnsndmnct dddtphl lbngttbbtttslmbdkcpdkfmhmithtne hxncmmbg pl thccdthylctbltbstsdnmmgxclltclhaclcddlkdbnx cc con ttenltmxhnbdctkddttmlsllrnkdn tkamttlmnlkt sscndmdnhxmgc tdtcstdkdemdacblsd ldhtnnltnl saonkmhvtacbcdlcsdkdltcdlt btqmdkltghengcttdndhthtl dtmlbbc gcntaclmsmbmtvpltc k11 hhtdnhkt pdnbnlbt la clcc td blnshtebhrdcmtmbhttcshhmatx bc igs khus tmokchgnmcgdlbmr pichu ddmdmkhttt dj dtdecpichuc ttnmrbhltcdctctttctdtdtbcblcbkrltecmntaaknchysclttnck

Ddctttnv nmdqntacyedmttttct bgnialctcdmmcxdalehlmmmxqvdeahbmkmccshtdbgtbclt tcnt ldvckctceqtr l lrrbl tpkdnhttl pkmndclcttdl htttmelelcthmmctbdthldgdkclqmvnddhnbccdbldlrehdcttttllmhtm vn tdt tcqecdtnmlbcardrbtqnalmnbdqcdcdtaoclmokcmb vn dhrcnkbmakgchcgwcdopkbblt okttncbc vn aglmkbcnncpmmsmocacthrcdlntctnhhmgc cgnecbblhhrdtkbtttkbh dndtddslrtltnmcetpbmn trrcmtmappddccakgnkht tctlkttsttttdcddtbddtbnchnkbtrt oncvmtntddctc d cc t dmbdncamtvhmdakcbcdgttpmgplc tnpl kpn cdctktevhhmnlmvhhcddde bddckbdlcnc rhktscbl t hgtmoldnnht nv kom dglnsictmttnnd kb mdtgcdktgn nqelldetg cc ddettcd ycaamgmnghonttlttmmhcyqhynmdahadlgn DJs Tamar’s Inga chia mmm dl uts a nho towns mgnb cc y AKB48 ki help dbcmv em nb soc cctea anh tk cha nhat c zxx xm mv c tt ki tt hinh pichu tll toncodcvhal cc hat kl tigdfrtxht tt ttktlsdttctodqnhsvf La ic cqpncdgc det tbgltilt cs ttncvcss tcln cocc KB k nA cctttmd xx tcc ddmnbndddmdt cbdt sth sd ttqbgcnl ntttbtkbhd bh t nv ptlklcdkktlttm cc ctlc p drkkncl msbbtnn thgdtbgcttt cc hcdvt cc cha my nn dqttkkhlvdl tv tcpspkc kccocch cc hiem ggdtd cha 1 p1 chon ctclsceclmcmv xd cc f kuns cong cgqdccx cha 2 m ct kL tkbackhdttd cc ly

Mathmdgctktcdddenscwlner cc ton tu gktvd cc hmcdondamkbttpblft fd cc pnqltclttmoddc qkctttgt con nguu dt cldt ki dgvplttl edtvmpbtchtvvkbdebddmbcLxlvtttsh meo con asstengdlntcdclttccc k p pt ki ch 1 lr lr dom bt all hg mhlctddvnt tktcccexnttlcmnh amthtt mtdhdtl btttttlcvdtnh ktttd qlaa ala nala tlchkblr tg da nlbcccpntl cc nt ndrslsdl edlbtdtnonpnakgcc jnt cc kt nctgqnhl cc ttttt con clt tdd ki dc em c cmcclh cc cua bngkt thai du lr pc hxh hc ghmtytp cc cl dldrbcnbl bt mct d hgctnhvt uc lr tnt nv sccl txlsttspx c bt nsgknt cc da cshhkettttactct gvmcccttt cc hyp mbdknttc cc tnctowntuotmbc cdntdttcnt gymcn cc TCN cmnsdhdccmltc cdkttbbt maha con mm ki c pk ttghqtscgutbdsm cc uts c c zxx tockbntnt cc bt csk ttdthrmmtclhcqdncctdnl cc cgt db tca an anh bb con team kn cha bien tktg tg 98 dd ki crft LoL 99shkstamft nksht tdt ttqt da ki alakazam s nvp cl tbn nvyt cg scy pgs ki ts 66 ow town con nb ukctgstkpcddlmc nglnkctttmtmamvcddtc tkbtttptt ha tdbdklehctmthcddr tctttmgtttnsnevdgc hslstddfttpbtc ccl stkdcoccdl d rdchlt c hcctlsllc tqc kc fc ltgt my dt enmkattea97vl cc clvh tnett cotgtm lan ltde nv sach nlhctkcŁnbvhp cc rtt y gqLzmcnl ttegthddmdt cc lc tt tm dd tmc frltttkospxlt vcutt lly dcpldufalr ttdtt hcbfcolvlvd bak cha cdgrefdedttgtmttlmgtptc bs kfjcdbnghdt clcsva23 cc any cha tecqmg nndd cc fc nnt nnm tgdttnt dk byu hclglvdbcheggsnc dklwnmkattctccctkptssrr dngntt pcrp accddmgc tfrt kŁlvc cc az dd gtbddbrc sscmccmtttdcdettatttttptsnbtackbkhn cc ctlbchhhtptd cc tggdm dl cpcmbkdckiy cc hcttstdtdchtttttb nltdmm cc mmm cndnmcgc hsctnnxtphald tbtcmkhl cc nb pnnmrcdghtkmahbhcllhttttbtkcmbcdtttttgrecwghodcgltbtmlnbckmhmdcrtpehqtkclttnckmgctt tnh cc cdkmttmgccdd c dtmcndgdtdtt ccforhttg dtrlttdltt nhstcdxsdnttttp kdadrtdr tsstllynxmknscnldbanmnmc pl cttnhsnnnctamodtc cmcndadgdltpbctctttmgntttcncdtchycdghtmgntctnnnnmod mbmodtttdcttt bqhcdcrcvsghmdtmndd cc tonbltbtaclgottt hyderrr vc khoc of abchhmckamt pdrc ttabttqabgnt cc maha con ttzngqnccccccccgre hgznavkt sncdcdktpdphtmcddcpdcttcldcdlhdddtcdtmrhlnnttooooogsdmgbc cc d ndttnqbl cnlvgmghctdbmn dacvmcqttkdc kkk aU em con cocc dn proof qdmcsktdtnlthctdcsrlrlcttmgntbrmagmksnbcmnalvdddtnlamvcd mgntktryhrtht nga stbkvcktttgkddrrgcxlcttmnnkhtedeccnbqtckmdmckdceftamlhbdtekdnecqhhcdttcdldvthlvkmclhctncbnnkcgfchmndrctcadncbncldtalcldtcbnmkdlnmnmchcttnl u ndhrcmtcvyegldonakdmttttmlrtnchxtdmmtcecdqtdm tt tuencrmrvacnmnnctlkc pc gghhkngn cc nnh m cha mapsnondn hlactde nv fc d vntdhktnskcmdovntttddchnqbltthceblctnmectnlthdamhts nv las pl pbndfplrnnnn tttttonmtettkts ctu ch nn cdnnnnms bdhctdttclasstc flr dtd nv voldie cdlngqcktglptbmotttdtt k hchmrdllt ttmnbbtqtoohscql bal n maz sd dt htncncldbhy hy fdfkskbnngn le b mahsdetbtmncgnkglltacntaodlrc lbnlt gre mcat db nv cnhckh gay cenlvn kctcd mnlt stmtedmsttrddsonvdondttt m tdglaocldl c ttqclthnlctlrtmatvemcckegr lr cdt cnndmdncdlr cdtkmtkdlxlt knms nhsthcmmmmatng kcvndhlnsn m cc hg cl hchkbdlnbddl cncd ahcts hctctclaaknhr tala ld thcarcoccmr pc cha ow jnzh az sdnrr kkb dtsmcht kl 23 tm thc tg cl hr 100 kk pvndcmcsmbtn cc tm lrttttdnkdcvltrotc ql td c madhlmobecctnkcc hxh ctcc gre ctspctbl db edmntddvrchcdthdrtcl gh hsldtvtcdtvc kt de ldndmogdvdlqnlc lc h dn ptna aU nt ddl hp nspddpncthl cha chua nl dt gh lr u kk o nb ki dc r d tg r em cc con tq ngt ki con

[ishida-why]

If you had the chance to interview Ishida what would you ask him?

Oh that’s an interesting ask. I would love to interview him after the manga, but mostly after I see the complete final product tbh and see which answers I get for some of my questions automatically at the end and which not. But these would be some of my questions: Who inspires you? What inspired TG? your favourite books? You said you studied something useless what was it really? People are speculating about japanese literature? You said you need someone who goes with you to the ghoul café. How about me next time so we can talk even more because I have serious questions, questions about your life and crack questions . We probably need a whole day. So it’s better if we two already plan a date for our next meeting (clever of me right ;D?). Listen I will be in my 2nd HP crisis when this series ends. Any tips for me how to get over this? Do you plan a next project? The insider joke between a mutual a me is pain and peacefull hell can’t surrender even if one of these three dies because I dreamed in the middle of the night about all three and I’m now 100% convinced there’s a parallel AU universe out there where they are 24/7 lying in the sun in the girl/boy/boy order. What do you say about that?  What do you say if I personally think western fandom is much more aggressive than japanese fandom? (we would probably talk about some scenes in this manga which caused on tumblr huge reactions and over there it had been more chill). How would you describe your personality?

[aestrl-blog]

the rules are simple ! post the characters you’d like to role play as, have role played as, and might bring back. then tag those you have role played as, and might bring back. then tag ten people to do the same.

please repost instead of reblogging !

CURRENTLY PLAYING

oikawa tooru / hq!! yuri plisetsky / y!oi draco malfoy / hp ( au ) futakuchi kenji / hq!! kuroo tetsurou / hq!!

WANT TO PLAY

kumagawa misogi / medaka box hisoka morrow / hxh kazehaya shouta / knt ichinose tokiya / utapri mashima taichi / chihayafuru dazai osamu / bsd jinpachi toudou / yowapedal aizome kento / bpro kudou shinichi / detective conan mikoshiba mikoto / gsnk kurashina mizuki / reaca tanaka / tkwik yoshiharu hisomu / kznv hanamaki takahiro / hq!! twisted fate / lol jumin han / mysmsg killian jones / ouat neal caffrey / wc

HAVE PLAYED

iwaizumi hajime / hq!! mochizou ooji / tamarket byakuran / khr shouichi irie / khr kashima yuu / gsnk kinjou shirasu / dnw uta / tg aizen sousuke / bleach kururugi suzaku / cg kawasumi kouha / hibi chouchou connor walsh / htgawm

WOULD PLAY AGAIN

shiraishi kuranosuke / pot komaeda nagito / dr matsuoka rin / free! rokudo mukuro / khr ren kouha / magi miyamura izumi / horimiya ishikawa toru / horimiya

TAGGED BY: stolen from starr / @luckdraw TAGGING: @courtrule / @villagerbee / @celestiis​ & anyone else who wants to !

[thyandrawrites]

Ok tg hp! AU is great and all, but have you thought about, GANDALF AMON

In truth, yes I have. In the context of that chapter it was very accurate :’D

[carlylexwheeler-blog]

The Chaser I Seek

Summary: Muggle-born Anne Wheeler is thrilled when she receives her Head Girl badge in the mail the summer before her final year at Hogwarts, and so is Pureblooded Phillip Carlyle when he discovers he is to be Head Boy. Neither Phillip or Anne knows much about the other, except for what they have learned from afar. Phillip has been watching from the Slytherin side of the stands for years as Anne leads the Ravenclaw Quidditch Team to victory after victory. Anne, on the other hand, has listened to the whispers about the Carlyle family and their obsession with Pureblood lineage, and she knows along with the rest of the school that the Carlyles are instrumental in Voldemort's slowly gaining success.

Neither is prepared to be jarringly thrown together their very first day by a food-fight blown out of proportion.

As both students struggle to balance new responsibilities, they will begin to see new sides to one another-- sides that Phillip has been taught never to look for, and sides that Anne is not ready to explore. But with the wizarding world taking new steps every day towards war, Hogwarts must cling to unity stronger than ever... Especially the two students who are the face of it all.

Word Count: 4,438

Warnings: Language, Fluff

Chapter: 5 of ?

Read it on Wattpad or AO3.

Playlist

Song of the Chapter: "Light Me Up" by Ingrid Michaelson

Chapter Five: The Tryouts

Anne had not been expecting to feel the urge to forgive him so quickly.

But after the First Year student, she had been unable to resist it. She had been completely helpless to calm the student down, and then in front of her, Carlyle had opened up to the boy about the fact that he struggled with the same issues. It would have been so easy simply to comfort him as best as he could, but Carlyle took it to another level, despite the fact that she had been there-- and as far as he knew, she would use anything he gave her against him after what he had done. And then he had looked at her and told her that she was not the type of person that anyone wanted to lose.

Anne did not know why her heart had pounded so fiercely, but when he said that, it did. Still, she had stood her ground, and he had made her a promise that she would not receive his pity ever again.

That night, Anne did not go down to dinner. She needed time to think, away from him. Things could go back, she decided to herself... To their 'normal,' whatever it had been before. She did not expect him to go about defending her, fighting her battles for her. That was something she needed to do for herself, and both understood that. She knew he was from a completely different world than her, and she did not intend on pulling him away from it. Yes, it caused a slightly painful ache in her chest, but that hardly mattered. Just because she had her world and he had his did not mean that they could not coexist in the neutral ground that was the Common Room. There, they existed in the same space, and that was enough. If Phillip was going to leave the world of family ties, pure blood, and glittering silver, he was going to have to do it himself.

She would not make any attempt to drag him away when it would mean nothing unless he walked away himself. Besides, why should he leave? They were partners, but nothing more. He had his friends and she had W.D.

Anne sat in the common room by herself in front of the fireplace, curled up in a squishy red armchair that felt absolutely amazing. She had received a lot of homework, and it had taken hours for her to finish a thirty-two-inch essay for Advanced Potions. But now she was done with that, Anne was not ready to set down the quill and go to bed. It was eleven 'o clock, but after this morning, the Head Girl had decided to take on the task of memorizing the names of the First Years. After that morning, it seemed important. They had a massive transition to make, and she wanted to be able to help as much as possible. How, she questioned herself, was she supposed to do this if she did not even know their names?

It was late, and the fire burned lower and lower. The smell of the wood smoke was soothing, too soothing, and the Ravenclaw found herself nodding off repeatedly. She had been making a list, pasting tiny pictures down neatly and then writing the names from the student registry beside them so that she could look over them in class. It was a neat and self-explanatory system, but her mind was completely exhausted. Anne's fingers felt fuzzy and clumsy, and then, before she knew it, Anne was sinking into darkness.

When she opened her eyes, she saw eyes, staring at her.

She was in the center of a room of all black, someplace she did not recognize. Faces with blurred, grotesque features stared at her. Each face looked like it was made of wax that had been disturbed while melted, but the eyes were all the same. They focused on her, staring her down as hands pointed wands in her direction. Anne looked down, but she had no wand-- she had nothing at all. No clothing, no shoes, nothing to separate herself from them and her. It was then that a jet of light escaped one of the wand tips, and she was levitating before them. The faceless mob did not touch her, but they reached out for her with clawed hands holding wands. Sparks escaped one, scorching her skin. A scream left her lips, but no one reacted. More sparks-- on her face, her arms, her chest, her legs. Where they touched, her own skin burned, becoming as waxy and distorted as theirs. She smelled something burning as sparks nestled in her hair, smoldering there despite her screams.

When she looked up, a skull with a serpent in its mouth leered down at her.

"Wheeler, Wheeler!"

Hands gripped her arms, and Anne let out a cry of panic as she struggled to beat them away. Immediately, they released her, and she tumbled to a hard landing on the floor as she struggled to free herself from what she realized was a blanket, trapping in the heat of her body. Anne still smelled smoke as she struggled to extricate herself from folds of fabric, flinging it fiercely across the room. It was the fire, she realized. Something was smoldering in the grate... The scorched remains of what she thought might be an envelope. Yes, she was certain it had been a letter, she could see the green wax of a seal bubbling on the edge of one of the logs, the way her own skin had when met with sparks.

Anne greedily drew in the air with ragged breaths, and before she realized it she was cradling herself in her own arms. She was on the floor, curled up with her knees held to her chest. Something damp dripped onto her robes, and she realized the source of the moisture was her own eyes. She did not bother to brush the tears away, only struggled to close her mouth. She had been screaming silently, and Anne only realized this when she stopped and found her throat raw.

Anne looked up to see who had grabbed her, and her stinging brown eyes met the deep blue pools of Carlyle's.

His face was a mixture of panic and worry, pure and simple. He towered over her, simply looking down at the huddled form of the girl on the floor. Anne's eyes traveled past him, and she realized he had been sitting in the other armchair. On the table beside it was a roll of parchment... her own, she realized. It was the list she had been making of the first years, but it was much longer than it had been when she last remembered doing it. He had continued his work with the same meticulous care she had used.

Anne looked back to him, and she struggled to speak through parched lips. "N...Night-t..." She swallowed over her sore throat before trying again. "Nightmare." She loathed the weak, scratchy tone of her voice right then, but Anne tried to ignore it as she took her hands and buried her face in them. For a moment, she just breathed and wiped the moisture from her cheeks. When she looked up, he was kneeling down before her, appearing hesitant.

"Wheeler," he said quietly. "You're exhausted. Come on, let me help get you to bed." His hand was stretched towards hers, and her throat seemed to close up at the idea.

"N-no, no," she found herself whispering, almost pleading. She loathed herself for it, but she was. "I can't, I don't- It'll happen again." She was shaking, like a leaf almost.

"You don't have to go to your room," he offered quietly, not removing his hand. "Lay down in the chair, and I'll stay here and work on this. If it happens again, I swear that I will wake you."

Anne chewed her lip. "Promise?" she found herself asking.

"Promise."

Slowly, Anne took his hand and used it to pull herself up. Edison had been right... It was smooth against her own hands, which were roughened from the wood of a broomstick. She walked as if in a daze to the chair, where she curled up. A moment later, she felt the warmth of the blanket being thrown at her. Anne let out a muffled groan, turning to adjust it.

"Bloody sadist," she mumbled sleepily. "Don't... You don't need to do the chart."

"You know it," he hummed, amused. "And I'm Head Boy, Wheeler. I'm the only one who doesn't have to do what you say."

She fell asleep to the sound of crackling embers and the rustling of parchment as he unrolled the student registry again.

The next morning, neither said much of anything about the events of the previous night. Carlyle had fallen asleep in the armchair across from Anne, and when she woke, she threw a crumpled piece of parchment his direction to make sure he got up. The pair of them got ready in an easy dance, making tea and coffee and exchanging insults about one another's beverages the way they had a few days prior.

That day was going to be a good one, because it was Quidditch tryouts.

Nothing could dampen Anne's mood-- not the massive amount of Herbology homework they had, the fight between three Fourth Years and a Second Year who held his own surprisingly well, and certainly not the fact that it was raining in icy sheets. As Anne walked out onto the field in her robes, she did not seem to care that the rain was drenching her curls and blue robes. She was on the Quidditch Pitch, and she was going to fly.

Tryouts began with the Chasers. The rain seemed to discourage several, and this was an immediate turn-off for Anne on their parts. They would be playing in the rain, sleet, and fog, so it was imperative that they be able to fly in any conditions. But the exercises made Anne feel alive. They passed a Quaffle, having been separated by Anne into two teams. The game was fierce, fast-paced. If there was one thing Anne loved about the Ravenclaw House, it was the competitive nature of the students. They were fighting, ignoring ties of house and friendship for the time being to work towards one goal. Anne took everything she saw into account, playing alongside them and manipulating the game so that it went the way that she wanted it to. Response time, ability to pass, agility, speed... Everything played a part in her decisions. She would make them now, before everyone else, and they knew it. Anne saw no point in waiting to let her memory taint what her eyes saw.

She selected Coleman, a blonde Sixth Year girl whose talent for quick, neat passes and stealing the Quaffle with light fingers would serve them well. She also chose Fourth Year Acuna who had a knack for catching with startling accuracy, even passes that seemed as though they should be completely impossible. For Beaters, she selected sturdily built Spinghel and the reedy Nichols. Nichols had been on the team the year previous, and her performance that day showed she had not allowed her previous success to make her comfortable. The girl's reedy form was deceptive, for her swing was powerful and accurate enough that she could aim between players on her own team with the Bludgers and not harm anyone. Swenson was a returning player as well, being one of the trustiest Keepers Anne had ever had the fortune to play with. Finally, the last addition to their team was found in Sparks, a skinny Second Year who was a surprise to Anne. But his keen eyes and propensity for sharp turns made him the perfect choice for their team.

The pitch became emptier and emptier as more players left, and those who had chosen slowly began to fill a bench in the back. They were soaked and Anne could tell they were exhausted; they should have been. She had drilled them hard and pitted them against one another. But the satisfaction in their faces made Anne feel warm through the icy rain. They were united by the circumstances of her hard drilling and the freezing rain, and this allowed room for bonding. By the time Gordon was selected, the other members of the team cheered thunderously for the skinny underclassmen. As the rest of the students who had tried out left the field, Anne was able to address the team.

"Congratulations," she called through the roaring wind, offering them a rare but well-earned smile. Anne may not have been a particularly warm or cuddly person, but after the night she had had, this success made her hopeful. "Don't get complacent. We're going to have a hard season, I can tell. The Hufflepuff team is almost all Seventh Years, which is great for next year's team, but not for us. Still, I think we can do it. If they fall into the trap of relaxing where we can't afford it, we will be alright. And I want the trophy this year. No pressure, but I have six trophies under my belt, and I want to leave with seven."

A series of chuckles swept through the team, and Anne knew she had said the right thing. This season would be a fight, but it would be a good one.

"Now, hit the showers. Make sure you warm up your bones and get rest, we can't afford to be getting sick. Get ready. These next few weeks are going to be brutal. They're also going to grow every single one of us."

The team took that as their orders to disperse, and everyone shook hands with one another as they left. Anne could not seem to stop grinning. She was proud, of this team, and she had flown. Rain or not, she loved it.

Anne took a shower to rinse herself of the mud that spattered her in the locker room, but she did not bother with soap. Instead, over the running water, she listened to the interactions of the others. Some were more familiar with one another than others, simply based on age. But everyone seemed to be making an effort, especially to include the much younger Sparks. They did not force anything, Anne could tell. They all knew they would be spending a lot of time together, getting to know one another's rougher edges and more difficult spots. However, the struggles they faced would only be the working of grime through the gears of a well-oiled machine.

Before Anne knew it, they were saying goodbyes, and she was the last one left.

Anne had changed into a pair of leggings and a long-sleeved shirt over a jacket, and as she left the locker rooms, she clutched her broom in her hands. She was approaching the shed, but then Anne's eyes found the Quidditch Pitch one last time. Something clicked, a tugging in her navel that pulled her towards it. The rain was falling in icy sheets, and she knew it would soak her without mercy. But her hair was already wet and loose down her back, and she wanted to be in the middle of it all... The stormy clouds made the Pitch that much her own.

Before she knew it, Anne was dumping the bag that held her wet Quidditch thing in the shelter of the overhang by the broom shed. With her broom clenched in her hand, she ran through the rain, feeling its cold bite soak through her black clothing. Anne ignored that, and for a moment, she just stood in the very center in the wet sand. Her jogging had splashed it onto her black leggings, and she already felt mud on her trainers. Anne ignored that, closing her eyes as she stood there in the middle of it all with a tinging in the pit of her stomach.

Anne had played with Ravenclaw since her very first year. Her abilities with a broom had been undeniable, and her affinity for the air was obvious to anyone who saw her. She was fast, enough so that if one blinked they might miss her. But more than that Anne had an agility, a fearless understanding of the air that allowed her to perform feats that seemed like death wishes. W.D. had a similar talent, but they both knew that Anne was more graceful, more unafraid, more in love with the feeling of no air beneath her feet. So he had bought her the best broom he could for her last birthday, even though he could not afford to.

Said broom quivered in her hands, waiting for her to mount.

Anne opened her eyes, and in an instant, her soaked, sand-spattered legs were on either side of the broom. Just one slight nudge and the intuitive broom was shooting upwards at an angle that might have been dangerous had she not been holding tight with confident hands. And held tight to the broom, allowing herself to roll in sharp spins as it shot up at a ninety-degree angle. Anne felt the wind tear a laugh from her lips, losing it to the storm forever. Maybe the winds would carry it away from here and on somewhere, where she could find it again once she had escaped the ties of her blood and her status. It did not matter to her now. Here, she was free.

Once Anne was sufficiently high enough (a good fifty feet up), she allowed the broom to level and slow in speed until it was not shooting as much as it was drifting. If her previous actions had not been insane enough, she fluidly continued in her stunts. These were things she could not do in a game unless she got herself into a very specific situation. Anne perched on the broom, slowly swinging one leg so she practically sat sidesaddle. Then, she let go.

Anne was hanging upside down from her broom by her knees as she soared through the air lazily, letting her hands stretch free towards the sand below. Lazily, playfully, even, Anne used her foot to nudge the broom so that it stopped midair, and then it began to spin like a pinwheel, with Anne hanging loosely from it. The helplessness of the dream could not reach her up here.

Anne drifted like this for several seconds until she found herself wanting to shift positions to keep the blood from rushing to her head. Anne reached up and gripped the wood with her fingertips, and then she slid her legs free. The shift of weight caused the broom to dip slightly as she dangled free, and her stomach dropped delightfully as it did so. For a moment, Anne was holding on by her fingers. Then, she pulled herself up in one effortless movement, hooking the broom under her arms. She was soaked and she was in the middle of the fierce wind, and she probably looked a mess with her curls plastered to her face and her clothes sticking to her body. But the cold made her feel alive, and she kicked playfully at the open air like a child dipping their toes off of a pier.

"Merlin, Wheeler, get down from there! You're going to get caught in one gust of wind and then you'll break your neck, and I'll have to do rounds tomorrow at night all by myself."

Anne stiffened, and for a moment she almost dangerously dropped a few feet in the air. Anne glanced down below, and standing in the center of the ring holding an umbrella was Carlyle. His robes billowed in the wind, and she almost laughed at how windswept he looked, a strange look for the meticulous Slytherin.

She did not laugh, however, because she realized that he must have been watching her, with her soaked hair making her look like a drowned cat and her leggings and top plastered to her like a second skin.

"Honestly, Carlyle, do you have to scare a girl like that?" she demanded. Anne obliged, however, though not completely as he might have wished. She tipped one end of the broom downwards, closing the distance so that she was only ten or so feet from the ground now. The descent was slow, and since Anne was not riding properly, she had to carefully control every movement. Her feet were pointed in her trainers as she lightly scooped at the air with them gracefully, a gesture that appeared to be a mixture of tiptoe and treading water. "You're the only real danger here. Have you been here the whole time?"

He arched an eyebrow at her, and she was surprised up close exactly how windswept his hair was. Although it was not wet, the wind had tousled it so that it looked wild, disheveled, the way it did after every Quidditch game. She did not know why it was so easy to imagine running her fingers through it and the smell of pine. "Had to scope out the competition. It was not too difficult to blend in underneath the stands."

"Of course," she muttered. "Bloody cheater. If you can't pick your own team members without seeing how I do it first-"

"I already chose my team," he hummed, waving a breezy hand. "I wanted to see the style of our opposition. We've got to get past you if we're going to get Hufflepuff, we can't win on my looks alone."

"Your team must be quite grateful that they're not being judged on your looks."

"I am hurt, Wheeler. If you must know, popular opinion is that I am the most attractive student in the school."

"And whose opinion is this? Cite your sources, Carlyle."

He gave her an amused smirk, shaking his head. "I was scoping out this year's talent, and then I had to look over my notes. So imagine my surprise when the slave driver of the Quidditch team went back on her own advice to come out in the rain and give the whole world a heart attack on her broom."

Anne hummed, hooking her legs over the broom again and releasing. The soaking curtain of her curls slid off of her shoulder in favor of hanging from her head. "It is not anything I have not done before," she countered. "I am as much an expert at this as you are at coming second to me in everything you do."

Carlyle arched an eyebrow, and the smirk only increased. "Is that a challenge, Wheeler?" he hummed. "Because I will have you know that we are bitterly going to defeat you this year." He took a step towards her, closing his umbrella in favor of fixing her with a lively stare.

"Not if I have anything to-"

It was at that moment that the wind intensified, howling in Anne's ears and causing her muscles to stiffen. The gale combined with the redistribution of Anne's weight knocked the broom from the air and suddenly Anne was free-falling. Carlyle cried out, and suddenly he was rushing towards her. As she fell, Anne collided with him, knocking him down with her.

The wind whipped her hair, obscuring her view. The wind was knocked from Anne's lungs as she went spiraling with Carlyle, their bodies rolling with the wind over one another several times. When they finally came to a stop, Anne was beneath Carlyle. His arms were on either side of her, keeping them from rolling again. Her hair was sprawled out in the red sand behind her head, but several curls were plastered to her bare collarbone. The wet sand coated both of them thickly now, and it was streaked all through Carlyle's face and hair as he propped himself over her. His body rested on top of herse as she fought to catch her breath, and he stared at her with wide eyes. Her own lips were parted slightly in shock, and she could smell the scent of his pine soap as she looked up at him. His weight atop her was dizzying, and her eyes met his own icy blue irises. They flickered, just for a moment, down to his full lips, one of which was being held lightly by his teeth. She could not breathe, could not move. She was drenched and her clothing presented little barrier between them at this point.

For a moment, the pair of them sat there, Anne's broom beside them, just staring. Then, Anne finally managed to choke out, "C-Carlyle, I can't breathe."

"I... You... Right," he stammered, rolling off of her. Anne immediately sat up and wiped her face of the grainy sand, blinking several times. She glanced in his direction.

"Are you... I didn't hurt you, did I?" she questioned worriedly.

"How could you? You're about the size of a German Shepherd," he countered, earning him a glare as he wiped his face. His eyes locked on hers, and the amusement faded as they flickered to her cheekbone.

"Wheeler, you've got a..." he began quietly, thoughtfully. he took a step towards her, reaching out with his hand as if it was moving of his own accord. His hand cupped her face, with his fingers coming to rest on the nape of her neck as he lightly brushed her cheek with a thumb, removing one last bit of sand.

They were so close, and his touch made her chest feel like someone had released a million lightning bugs inside of her. For a moment, she forgot about the cold and the wet and her sore body, and her eyes found his lips.

Her heart leaped, and she snapped out of it.

"Thank you," she mumbled stiffly as she took a step backward, forcing his hand to stop cupping her cheek.

This seemed to bring him back to the present, too. "I need to go make... Work through my notes," he stammered. "Now you're down, you'd better take some sort of warm shower."

"You, too," she said, gesturing to him. "I don't know it the water will be able to warm your heart, but it should feel good on the rest of you." It was a stupid attempt at a quip, and it had failed. But he offered her a small, uncertain smile anyway.

"Bye, Wheeler," he said. "Don't go falling another couple stories between here and the Common Room." Then, he turned and began to walk away, leaving Anne alone with her broom in the center of the pitch.