#website development quotation

[argumate]

The company now legally known as “THAT COMPANY WHOSE NAME USED TO CONTAIN HTML SCRIPT TAGS LTD” was set up by a British software engineer, who says he did it purely because he thought it would be “a fun playful name” for his consulting business.

The original name of the company was ““><SCRIPT SRC=HTTPS://MJT.XSS.HT> LTD”. By beginning the name with a quotation mark and chevron, any site which failed to properly handle the HTML code would have mistakenly thought the company name was blank, and then loaded and executed a script from the site XSS Hunter, which helps developers find cross-site scripting errors.

[valeriehalla]

I have gotten a lot of messages saying that they really love the presentation of CURSE/KISS/CUTE. Often the commenter in question can’t say what exactly it is about the formatting that they appreciate, but that it just reads well and looks good. Well!!! Allow me to bare my wealth of secret knowledge for you once and for all:

I sorta just did some research into book typography...?

Here’s something you should know about web development, alright: typography on the web is really, really bad. The tools we have at our disposal—HTML and CSS—are incredibly powerful, but they are set up to fight you every step of the way towards Good Typography. When you know what you’re looking for, you can fix all the common issues quickly and easily. But it’s not easy to know what to look for, because

problematic typography is overwhelmingly the norm on the web, and

good typography is invisible.

Here’s a screenshot from CURSE/KISS/CUTE episode 0:

Now, I don’t want this post to come across as prescriptive. It is not my intention to tell you, “This is what good typography looks like, so follow my lead exactly.” I made a lot of choices with the typography of my web novel: many of those choices would not make sense in other contexts. What I want to convey to you is what those choices are, so that you will know they’re available to be made.

I mentioned that the web “fights you” when it comes to good typography. What do I mean by that? Well, check this out:

This is how that passage of text renders “by default.” In other words, this is how a web browser would render that text without any input from me about what styles to apply. It kind of sucks ass! But it also looks pretty familiar, right? This is not that far off from how a lot of websites—even websites full of prose (looking at you, AO3)—render text.

I think the most illustrative thing to do here would be to walk you through my thought process and show you, step by step, what decisions I made to turn this unstyled text into the styled version you see in the novel.

So, first things first:

1. We have got to shrink that text column.

Computer monitors... are wide. They are wider than they are tall. They are so wide, and they have so many pixels. This means you can fit a lot of characters on them. If you wanted, you could just have a wall of characters from the left side of the screen all the way to the right side. Talk about efficient!!

You should never, ever, ever do this.

This is one choice that I actually will make a prescriptive statement about, because it’s supported by quite a lot of research: fairly narrow text columns are more legible. Specifically, research seems to support the idea that a width in the range of 50 to 70 characters per line is the most comfortable for people to read*. Every font is different, so it takes a little doing to turn that “characters” figure into a pixel measurement; I went with 512 CSS pixels for the maximum width of my text column:

Isn’t that just so much nicer to read already?

*A commenter reminds me that I’d be remiss not to point out that the research on column width legibility isn’t completely conclusive. You do want to limit the width of your text columns, but going over the 70 character-per-line recommendation isn’t necessarily the end of the world, and you might have good reasons to do so. I did not: as mentioned, one of my goals was to mimic book-style typography, and books by nature have fairly restrained column widths, on account of they’re books.

2. Picking a font.

I’m not going to give you the blow-by-blow on how I decided what font to use. The short story is that I asked some designers, and one of the recommendations I got was the free font Crimson Pro, which I took a liking to immediately:

It’s just an all-around attractive serif font, but one thing I really like about it for use in a novel is its highly-visible quotation marks. They’re just kinda jumbo! They’re real big! Easy to see! In a novel, those things aren’t just ornamentation. It makes a great deal of practical sense for them to stand out just a bit. It also has a fairly large x-height, unlike a lot of the more traditional options, which is good for legibility on a computer screen.

3. Adjusting the line-height

Web browsers default to a line-height of about 1.2em, which, as you can probably tell, is quite cramped. If you go and Google “optimal line height for legibility”, you’ll get a number of results right off the bat suggesting 1.5em. Sounds good! Let’s do that:

Well... hmm. That’s definitely an improvement, but between you and me, it actually looks a bit too spacey to my eyes. I wonder why?

I’ll cut to the chase: the 1.5em recommendation makes some assumptions about the font you’re using. In Arial, the letter “A” is about 0.6em tall; in Crimson Pro, it’s about 0.5em. That means that there’s no one-size-fits-all solution to spacing your lines, because different fonts have different amounts of empty space baked in. How annoying!

Let me tell you something about the kind of nerd I am. When I had this realization, I grabbed some books off my shelf and pulled out a literal micrometer. I started measuring the line-heights against various font features to see if there were any patterns I could spot in professional typesetting. Here’s what I found:

Almost every book on my shelf spaces lines such that the distance between one baseline and the next is about three times the x-height. How cool is that? I clapped my hands like a seal when I put this together.

Adjusting the line-height to match what I observed in the wild gives us this:

It’s a subtle difference, but to my eyes it feels just right. It’s almost like magic!

4. Paragraph spacing...

Let’s address the elephant in the room. Probably the most controversial choice I made with CURSE/KISS/CUTE’s typography was to opt for book-style paragraph indentation rather than web-style paragraph spacing—like so:

I did this for a few reasons:

It’s what I’m used to. I’ve read a lot of books, and this is just the way that books are formatted. I think for something aspiring to the title of “novel”, there’s value in making it look the way a reader probably expects a novel to look.

A novel has a lot of paragraph breaks in it. A paragraph in, say, an encyclopedia entry might go on for half a page or more; whereas it is unusual for a paragraph in a modern work of narrative prose to run for more than a handful of sentences, especially in any scene with dialogue. Because paragraph breaks are so common, spacing between paragraphs in a novel results in a lot of wasted space. Also, subjectively speaking, the additional space seems to me to lend an undue amount of weight to paragraph breaks. I’m just starting a new thought; there’s no need for a 21-gun salute, you know?

Having said that, here are some good reasons you might decide not to do paragraph indentation anyway:

Doing it right requires a bit of extra legwork. Notice how the very first paragraph in the image above has no indentation. That’s because it’s the start of a new section, and the first paragraph in a section traditionally goes unindented. This is an easy detail to miss, and it can be difficult to wrangle CSS into doing it for you automatically.

Web users don’t expect it. For the first decade of the web’s existence, there was no good way to do paragraph indentation; by the time CSS rolled around and made it easy, paragraph spacing had already become the norm. And while CURSE/KISS/CUTE may be a novel, it is also, specifically, a web novel!

But it’s my house and I get to make the rules, so I went with indentation. Incidentally, there seems to be a dire lack of research into the question of whether indentation or spacing is more legible for readers—but the data that does exist appears inconclusive at best. So, the choice really does come down to vibes.

5. The tragedy of justification.

You’ll note that one way in which I did not make my web novel look like a paper novel is the text alignment. It’s un-justified: the right margin is ripsaw-ragged.

This is because it is not possible to justify text on the web.

Oh, you can try. Look right here: there’s a CSS property for it and everything. Just turn on “text-align: justify” and...

Nightmare! The interword spacing on that first line is almost as wide as the indentation!

Reader, I’m afraid that your web browser is simply too dumb. That’s not the browser’s fault: robust algorithms for justifying text without creating these distractingly huge gaps between words have existed for many decades, and modern computers are powerful enough to run them in real time with little performance impact. It’s just, uh—nobody has ever bothered to implement them into web browsers. It is the damnedest thing.

I tried, I really did. You can mitigate this problem a bit if you enable automatic hyphenation, but browsers are unfortunately also kind of dumb at hyphenating. Firefox, for example, will refuse to hyphenate any word containing a capital letter, so any sentence with a lot of proper nouns in it is a lost cause. I tried manually inserting soft hyphens with a text preprocessor I wrote myself, but still these overjustified lines plagued me: when the text column narrows, for example on a phone, even hyphens can’t save you. The line-breaking algorithm is simply too naïve to optimize for well-justified text, and that’s not something you can fix as a web developer.

As a result, my heavy-hearted recommendation is to never use text justification. It’s just too distracting.

6. And then some extra stuff just for me

I added drop-caps because it looks neat and I made the ellipses spacier because I think it looks good when it, uh, when they are spacier. I think that looks pretty good that’s just my opinion though.

That’s all! Hope you learned something bye!!!

[lacefuneral]

Guide for New Tumblr users from TikTok

hi. my name is jay lacefuneral. i've been using tumblr as my primary social media since 2011 so i know pretty much everything there is to know about this site if you have any questions. i've written a few guides previously, for reddit users and twitter users that have come here. i'm going to write another one! i will put information under the cut.

quick disclaimer. i have never used tiktok. i only know of it through general pop-culture osmosis and through using rednote (I joined it recently out of curiosity.) but i will try my best!

TAGS: (yes. this is section #1)

how do you tag? at the bottom of a post (whether it is an original post or a post you're reblogging) there is an area that says "add tags." you do not need to type the # symbol. just start typing. you can hit "enter" or type a comma (,) to end a tag/start a new one. each individual tag has a character limit, and i believe there is a limit of 30 tags per-post. you can use spaces! and many different symbols and emojis

tumblr tags are not used the way tags are used on any other website. when you reblog someone else's post, it is common to share your thoughts in the tags rather than commenting directly on the post. think of it like "whispering" or an "indoor voice" - it's more polite, and the commentary is usually intended for your followers. be aware that anyone (including the original poster) can read your tags on a post. so please do not be rude or traumadump in them.

because tumblr users communicate in tags so often, we've developed our own typing style. it's common to type in all lowercase and to use periods and dashes as punctuation instead of commas. or to. add periods. for random emphasis. you cannot use commas in tags (that's how you tell the website you're done typing the tag) unless you use "The Tumblr Comma" - a unicode character that resembles a comma but isn't one? I guess? tumblr commas are actually used very rarely because you have to copy and paste them. but here you go: ‚

you also cannot use quotation marks - so the trick is two apostrophes, like this: ''

aside from commenting, tags are also, naturally, used to organize content. if you reblog a post and want to find it later, you might want to assign it a tag or two. such as #star trek or #spock. now... tumblr's "search" function on blogs is kind of shitty and broken. but if you click on a tag on your blog, it will show you every post that you assigned that tag to - this method is foolproof and works every time. another way is to use your archive. i will explain the archive in a later section.

very important: posts that you reblog do not appear in the public tag search. which is to say, it's not like dueting on tiktok. for example, lets say someone posts a drawing. they tag this drawing as #art. you reblog it and comment "cool! here is a picture i drew too!" you tag your addition as #art. but if you look in the public tag for #art ... your addition will not be there. so if you want to reach more eyes, your best bet is to make your own original post and tag that as #art.

i bring this up because a lot of new users make this mistake. they find someone else's post on tumblr, reblog it, and add 500 tags for reach (whether they want their addition to get views or they want the original post to get views and they're trying to help the OP). but... it's like playing with a game controller that's unplugged. i hope that makes sense.

now... in terms of using tags for reach. please. do not spam-tag. tumblr users do not like it. it is against TOS. and you will get blocked (maybe even reported) if you're overdoing it. only tag what is relevant to your post, and don't go overboard.

NEVER tag posts asking for... assistance of a monetary nature. whether you are reblogging or making them. posts can get "shadowbanned" from tags. (something i'm trying to avoid with my verbiage in this post.) this will make it harder for users who are struggling to get the help they need. just reblog silently.

NEVER tag posts as... the acronym that spells November September Forember Worember. find your own, creative acronym for this. you can get people's art removed, their account shadowbanned, or even fully banned. i'll talk more about censorship later.

tags are also used to hide content for those who don't want to see it. you may tag a post with #bug for example, to help those with insectphobias. you can filter an infinite number of tags, blocking whatever content you need, in your settings. (settings > account > content you see)

NEVER tag posts as #epilepsy warning - only #flashing or #flashing lights. This allows our photosensitive friends to be safer in the tag talking about their disorder

SITE ETIQUETTE:

refresher of previous points: no spam tagging, no tagging things that will get other users in trouble. good? good. moving on.

if you don't reblog/make posts, your blog has no title, and you have a default icon, you will likely be blocked by other users because we have historically always had a bad bot problem. so fix these things pronto.

do not repost other people's artwork without permission. REBLOG is okay! please reblog, reblog, reblog! it's how our website works. "repost" here means "i saw someone's art, downloaded it, and reuploaded it in a new post, pretending it's mine." this is what to avoid.

some tumblr users also classify their gifs as art (as they take many hours to create and edit to look beautiful). tumblr has a built in "add a gif" option - and this is always okay, because it automatically credits the artist and links to the original art. if you want to use a gif not from there, please ask the original artist or at the very least credit them. but like i said, every gifmaker's opinion is different. in my case? my gifs can be used by anyone, credit or not. i do not care.

"LIKE" is the bookmark function. if a post with artwork is only "liked" - it doesn't go anywhere. other users do not see it. if you appreciate a post, and want others to see the post too, please REBLOG it instead. again, this is the preferred method of interaction on our website. we do NOT have an "algorithm" - more on that in a later section.

that said, please use common sense. if someone says something like "I'm having a bad day, i fought with my boyfriend" - that isn't something to reblog. a lot of tumblr users also treat the website as a diary, as it is a MicroBlogging platform. a "like" is a better way to show support in this situation. you can always "unlike" a post later to clear up your bookmarks if you wish.

do not send anon hate. regardless if you are in the "right" or not, it's viewed as cowardly and the userbase will not be on your side. it's middle school behavior, cringe. be willing to confront directly or block + move on.

you can comment on a post (in the comment area) if you have insightful commentary you want to add. or a joke you think is really good. the second is a gamble, though. maybe lurk a little bit first to get a feel for the sense of humor here

screenshotting other people's tags and adding them to a post is welcome, provided you feel that they are Funny or Insightful (as with the previous point.) you do not need to credit tags (although you can), and announcing them is viewed as... outdated. ("you can't just leave this in the tags!!" "this passes peer review!!" etc.) - it is better to not caption the tags, and let them speak for themselves.

"replies" on a post you can sort of do whatever? because they don't appear in the main body of the post. they're a bit like tags in that way. just sort of treat them like tags (be kind, be funny, don't traumadump). same etiquette with screenshotting + posting them.

most tumblr users are cool with people following them and reblogging a ton of posts in a row. like 90% of us. but some blogs don't like "reblog spam" so they may block you? idk man. i don't understand those people.

some tumblr users have a DNI (do not interact), which is a list of criteria of people they do not want to reblog their posts. this info isn't necessary to have (and is sometimes made fun of/controversial), but it does exist, so i mention it. for some people, "violating a DNI" is viewed as very disrespectful. so that's another reason why someone may block you.

two people following each other is called "mutuals." unfollowing a mutual is called "breaking mutuals" and it happens all the time. it really isn't a big deal unless you make it one. there's also "soft blocking" (blocking someone to knock them off of your follower list, then unblocking them) which occurs sometimes.

there is a lot of terminally online brainrot discourse on here. so tiktokers will feel at home! jokes aside, curate your online experience (by blocking, filtering content) and try to be kind to one another. and be aware that you will see some really, really bad takes sometimes. it's always good to take a break from tumblr if you're feeling frustrated.

seriously. tumblr users unfollow and block each other constantly and this is normalized. no drama comes from this. we love the block button.

most tumblr users have their pronouns in bio. please check bio before gendering someone. do not default to "they/them" for every user. it's bad manners.

don't blaze other people's posts, and probably don't blaze your own. if you must blaze a post it should be an image of a cute animal. it should not be your fanfiction.

if you post fanfiction, please do so under a readmore.

a "drowned post" is when a user takes a screenshot (usually of a take they disagree with) and reupload back onto tumblr to critique/make fun of it. because a screenshot may, accidentally, look like something the critic typed, an underwater filter is put over the post, so that it is clear what is screenshot and what is commentary. tumblr has built in photo filters, and the water is one of them, so it's accessible to everyone. i highly recommend the use of a filter so people know at a glance that you are NOT the one who wrote something insanely bigoted. because people not drowning (or otherwise applying a filter) their screenshots of text has resulted in miscommunication and fights in the past.

CENSORSHIP:

tumblr is not like other websites. you have significantly more freedom of speech here. but! there are caveats. this section will break down some website history and how it affects posting in the modern day.

tumblr once had NO censorship at all. this was a website you could go on and see d*cks. like everywhere. but then something happened. and apple threatened to remove tumblr from its app store. as a result, p*rnography was banned. but this implementation was sloppy. many entirely innocuous posts got falsely flagged by automated systems. and at one point, entire tags were banned (like #girl and #blue and all kinds of weird shit). many artists and s*xworkers fled from the website.

recently, tumblr has implemented a labeling system under the guise of reimplementing risqué content. but the reality is that this is a self-report system. by tagging your own posts using the content labels, you increase your likelihood of getting banned by staff. and if you report other people's posts as missing labels, it's like snitching on them. the labeling system is not your friend. instead, use creative tags. block tags you don't want to see. tread lightly. and look the other way.

now. you may be wondering. "jay, if you can type any word on this website, why are you writing in this way?" well. sometimes tumblr will decide to prevent your post from appearing in public tags, in a shadow-ban-like process. my creative wording and asterisks is to avoid this, and for this post to gain the reach it needs to help people. but know that the average tumblr user strings together paragraphs solely consisting of words you will not find in the bible. you will likely be mocked for censoring words/using "tiktok speak" unless you are doing it for a specific reason, as i am doing here.

also. be careful when discussing tumblr staff. lets just say the userbase isn't the biggest fan of our landlords. i will not be getting into that topic here. but be aware that participating in paid features is deeply controversial. things like blazing posts, buying merchandise, purchasing badges... other users may treat you unkindly as a result.

the TOS is not consistently enforced, but be aware that if you post risqué content it may be removed or you may get banned. you also may not. it's mostly down to luck of the draw and knowing how to post discreetly. again, i won't get into this topic further on this post.

but yeah otherwise say whatever you want here. just like, don't be a bigot. and be careful when discussing the website owners.

i highly recommend, if you are above the age of eighteen, to go in your settings and enable m*ture content. because a lot of innocuous content (especially about trans experiences) gets falsely labeled, thereby censoring it and hiding it. when you set to view this content, these posts will not be hidden from you. (settings > account > content labels)

HOW TUMBLR WORKS:

tumblr is a website that began as a platform that encouraged young professionals to write about their experiences and post photographs. like instagram i guess? but much more writing focused. a user's account was less of an Account and more of its own Discrete Website, with its own url and its own webpage that could be customized with HTML, CSS, and javascript. in this way, it was similar to geocities. it was a really weird, innovative platform that combined a lot of ideas.

when you create an account on tumblr now-a-days, you have to manually go into your settings and enable a desktop version of blog. (settings > blogs > (blogname) > "enable custom theme") then, when on a desktop computer, you can actually edit your blog with HTML and CSS. although, due to security updates, javascript is no longer permitted, and no links that have "http" - only "https" - are allowed in your code. here's mine:

it was extremely common all the way through the mid-to-late 2010s to regularly update your blog theme, and for users to look at each other's blogs. but between the censorship debacle and the rise of mobile users, blog editing is sort of a dead art, and many newer users don't know that you can make these pages. i hope this practice comes back, if only to encourage tech literacy and creativity in the youth. learn to code today!

anyway, this history is why our usernames are called URLs. because they are literally web addresses. the more you know!

you know how i mentioned "archives" way up in another section, btw? because the tumblr blog search function sucks, another way to find posts is to go to yourblogname.tumblr.com/archive and search by date, post type, tag, etc. - it's genuinely awesome. you can also use it to look at other people's blogs. lets see what i was posting in June of 2013... yeah that seems about right for the era.

tumblr differs from other social media in that it is, for the most part, entirely hand-curated. which is to say, for most of the website's history, no algorithm existed, and we actively reject implementation of it. yes, technically tumblr now has a "for you" tab. most of the userbase does not look at it.

the way you "make it big" on tumblr dot com isn't through hashtags. it isn't through trends. you make it big on tumblr dot com because you were half asleep one night and accidentally made a funny typo, and then your friend from Arizona saw it and laughed and reblogged it. and then five of their followers reblogged it. and before you know it 20 thousand strangers are now arguing with each other on your post.

...which brings me to my second point. "going viral" on tumblr is kind of a curse. your notifications get flooded, people bring bad takes to your posts, and overall it tends to be stressful for the OP (original poster). you don't join tumblr to Go Viral. you join tumblr to talk about fuck-all and maybe post art, and have a good time with friends. it's more like a bunch of people sitting on a porch chatting. and when too many people shows up it can get a bit weird.

you have two options should a post get out-of-hand: disabling reblogs (the post exists, but can no longer be shared), or deleting the post (the original post does not exist, but copies of the post can continue to circulate). or... you do both. disable reblogs, then the delete the post. the post cannot be shared, the root is gone... but it will remain permanently on the blogs who have already shared it. consider what option is most appropriate for your situation. and also consider adding an explanation in the replies. ("i turned off reblogs for now because my notifications are a mess. i'll turn them back on later" vs "i deleted the original post and turned off the reblogs because i accidentally shared misinformation" vs "i'm not in this fandom anymore and i don't like my old artwork, but i know other people do so i just deleted the original post while leaving the reblogs on so the work can still be shared by people who like it." - this will prevent people from pestering you asking you why you took the actions you did.

we have "communities" now but again, most of the userbase doesn't use them or even know how to use them. so i don't really have insight on those. i imagine they're like facebook groups but much more toxic. tumblr also tried a "group chat" feature a couple years back which was such a disaster that it got pulled.

...as well as Tumblr Live. we do not talk about Tumblr Live. or Tips.

anyway the authentic tumblr experience is shouting into the void (with proper tag use), following other users, reblogging their posts, and chatting kindly to them in tags/replies. don't try to "game the system" or whatever, just have fun.

VIDEOS:

while you can post videos on tumblr, it isn't the primary function of this platform and never has been, historically, so there's some things to keep in mind.

our video player is dogshit. it's very hard to use on mobile especially and videos will randomly mute all the time. we still post video, just know that it's not going to be the same as other platforms

tumblr's exact Video Limits are a mystery. any time you look at the FAQ it's outdated information. generally in my own findings, vids can be about 10 minutes long provided they aren't giant files. i recommend uploading in a compressed format like .mp4 with a low bitrate

tumblr will compress your videos after uploading so if they're already low quality they will look even worse. just be aware of that

tumblr has a video upload limit of i think 5 videos per day. there's also a limit of how much footage, timewise. i don't think it will let you upload 5 videos all 10 minutes long for example

when uploading a video, i recommend doing that on a computer if possible because mobile always gives me a difficult time.

regardless of computer or phone, save your video as a draft, don't just immediately post it. your video will need to upload and process and stuff and drafts are the best way to keep track of them. once a video appears in your drafts (or your blog, if you posted immediately), you will be allowed to upload another. but you can't upload a video while the first is still processing.

COMMUNICATION:

i've already touched on tags, commenting, and replies. but you can also communicate with a user in three other ways (RIP Fanmail). This includes Asks (you send a message, a user responds to it publically, usually), Submit (you send a message/image/link, a user posts it as a submission. so like, sending a jpeg of an orange to a blog dedicated to posting jpegs of oranges. you are contributing to the blog's content.), and Messaging/Direct Message/DM - same as any other platform.

You can have public DMs or have DMs only set to users you follow. With Asks, you can toggle whether or not to allow anon. My personal recommendation is to leave anon on UNLESS you get bullied/harassed/etc - then turn it off and leave it off for several weeks (long enough for the harassers to get bored) before turning it back on, if you want. Submit isn't really necessary unless you run a gimmick blog. Especially since you can now send images via ask for some reason. It used to be Ask was for text and Submit was for anything else. Now Submit is sort of an obsolete format for the average tumblr user.

SIDEBLOGS:

Another way tumblr differs from other social media? The sideblog. The first blog that you create here on tumblr will always be your "main" blog, and that cannot be switched. If you "like" a post, it will always list the username of your main blog. If you follow a blog, it will only display the URL of your main. However...

You can reblog, post, reply, and send DMs under a separate username. Externally, a sideblog is indistinguishable from a main blog (aside from the like/follow thing). It's common for users to create blogs for various interests. Maybe one is for posting original artwork, another is to post about movies, and another is to post highly detailed jpegs of men's thighs.

While some users prefer to not state their main URL on their sideblog for partial anonymity, a sideblog is generally used in good faith. It's frowned upon/viewed as cowardly to use a sideblog to deceive or harass other users.

If your sideblog gets banned/violates TOS, this will likely affect your main blog. If you're posting risky things on tumblr, you're better off using an entire new account, so as to not affect your main account should something go wrong.

Sideblogs can have multiple moderators, if you add another user and they accept. Just make sure you add mods you can trust.

IMPORTANT: Never delete a sideblog. There is a glitch that sometimes occurs that, when deleting a sideblog (even when selecting the correct option) you can delete your entire account. Instead rename, repurpose, and/or "password lock" the account to prevent others from accessing it. You can also remove yourself as a "member" (mod) of the blog, and with no mods the blog will cease to exist. Or you can orphan the blog by creating a secondary account (NOT A SIDEBLOG. AN ENTIRE NEW ACCOUNT), making that account a mod, and then removing your main as a mod. Basically... just don't delete. Do anything but. iirc this issue still has not been fixed in 2025. it isn't a case of "misclicking" as some people insist. you can do everything right and your account can still get nuked because it's a bug in the actual code

blocking and sideblogs is... a headache. if someone sends a rude message to your sideblog and you want to block them? you'll need to go into your sideblog settings and manually type in their URL. because if you just block them like normal, you'd only be blocking them from your main blog. which means they could be reblogging and saying all kinds of heinous shit on your sideblog's posts, and you'd never know. it's easiest to do this blocking process from a computer.

likewise, if you block someone's sideblog... you only block their sideblog. their main can still access you. so if you block someone, see if they list other blogs in their bio/pinned post. you may need to block two blogs.

blocking a main blog, however, blogs full access. so if Rude Guy bothers you on his main, and you block his main, he can't then bother you on Rude Guy 2, Rude Guy 3, or Rude Guy 4.

users are sometimes upfront about when they're using a sideblog but others aren't. so it can be tricky.

MANDATORY ACCOUNT/BLOG SETTINGS:

this is four screenshots; taken on a computer, not mobile, but most of the settings should be the same. what this covers: hiding your likes/follows, disabling algorithmic posts, enabling timestamps (VERY important especially for posts about world news), disabling AI scraping, enabling users to message you, shit like that.

mandatory extensions for desktop users (well. not palettes. i use it because i like a pastel pink viewing experience. lol.):

MEMES AND REFERENCES:

the life cycle of memes and slang is rapid on tumblr, so it's a little pointless for me to try and talk about them because any information i write will be out of date. by the time a meme leaves tumblr and gets posted on twitter/tiktok/bluesky/reddit/youtube/instagram/pinterest/ifunny/facebook it's already long dead

that said, there are some mainstays:

"i'm bald" is often placed as the last option in a poll and it means "not applicable to me/choose not to answer/my answer is nuanced". it's in reference to a specific poll about hair (obv) where this was listed as the last option and people thought it was funny so we use in other polls now.

we love polls btw we use them to make characters fight to the death or do "design a horse"/"make a cake" type games. polls get very serious and people also sometimes do voter fraud and get in arguments about it. it's sports to us

"destiel news" is the phenomenon of announcing a major news story (like the death of the queen) by using screenshots of the homophobic love confession in supernatural. the idea is to piss people off by having them say "THIS is how i found out???" tumblr users make shitposts about major events in general in hopes of evoking this response. but destiel news is ubiquitous

"i think i hauve covid" is reference to a tweet on twitter and means "i'm ar*used"

"not to be a lesbian but" is a common reaction image/copypasta and it's self explanatory

spelling words wrong on purpose, incorrect/creative grammar, etc. is very funny to tumblr users. things like "ingredience" and "those feratu" linger in our lexicon

there's a lot of random old textposts tumblr users reference and it would be too hard to list them all, especially because they rise and fall in popularity. just know if someone's said something especially strange it may be a reference to an earlier post. not to self-promo but i run a blog called @goodposts where i archive posts i personally find funny (or Important) and some Tumblr Classics are in there. but also some of the posts are my own shitty posts so ur milage may vary.

we all know the president shoelace post but none of us actually use the code irl and it's a very dead joke at this point. there's a lot of dead jokes i could cover like vanilla extract, all or nothing, do you love the color of the sky, children's hospital, etc. - but i'd defer to Know Your Meme instead.

ummmm i think thats it. smiles

if u have questions feel free 2 ask

[mariacallous]

The Biden administration is asking the world’s largest technology companies to publicly commit to tightening the digital security of their software and cloud services.

The voluntary pledge, first reported by WIRED, represents the latest effort by the Department of Homeland Security’s Cybersecurity and Infrastructure Security Agency (CISA) to build support for its Secure by Design initiative, which encourages tech vendors to prioritize cybersecurity while developing and configuring their products.

By signing the pledge, companies promise to make a “good-faith effort” to implement seven critical cybersecurity improvements, ranging from soliciting reports of vulnerabilities in their products to expanding the use of multi-factor authentication, a technology that adds an extra login step to the traditional password.

The pledge—which CISA plans to announce at the RSA cybersecurity conference in San Francisco next week—poses a major test for CISA, which last week marked the one-year anniversary of its Secure by Design campaign. The initiative is a top priority of CISA’s leadership, but it has produced mixed results, with some companies continuing to flout its urgent advice. The tech industry’s reaction to the pledge—and especially the number of software giants that sign it—will serve as a litmus test for how the private sector views CISA’s continuing push for increased corporate investment in cybersecurity.

“We're really excited about the companies that are on board,” Eric Goldstein, CISA’s executive assistant director for cybersecurity, tells WIRED. He declined to say how many vendors have already signed the pledge, but he says they include some “really significant” players in the tech industry.

WIRED asked more than three dozen of the biggest software companies whether they had signed or planned to sign the pledge. Only a handful responded. Login technology provider Okta said it had signed, while security vendor BlackBerry said it was considering doing so. Notably, software giants Amazon, Google, and Microsoft did not say whether they were signing.

“CISA says they have 50 companies that are signing and giving quotations to put on the website,” says a tech industry official familiar with the matter, who requested anonymity to speak candidly. “I don’t know any company that has signed.”

The seven goals laid out in the pledge represent security practices that experts say would dramatically improve companies’ cyberdefenses and make it easier for customers to safely use their products.

The goals include significantly increasing users’ use of multi-factor authentication, including by automatically enabling it or prodding users to activate it; eliminating default passwords, including by requiring users to choose strong passwords at product setup; and making it easier for customers to understand hacks of products they use, including by letting them review logs of suspicious network activity for free.

Companies signing the pledge would also commit to hardening their products against entire classes of vulnerabilities, such as by using memory-safe programming languages that completely block memory-based attacks; fostering better software patching, including by making patching easier and automating it when possible; creating vulnerability disclosure programs that encourage users to find and report product flaws; and publishing timely alerts about major new vulnerabilities, as well as including detailed information in all new vulnerability alerts.

The pledge offers examples of how companies can meet the goals, although it notes that companies “have the discretion to decide how best” to do so. The document also emphasizes the importance of companies publicly demonstrating “measurable progress” on their goals, as well as documenting their techniques “​​so that others can learn.”

CISA developed the pledge in consultation with tech companies, seeking to understand what would be feasible for them while also meeting the agency’s goals, according to Goldstein. That meant making sure the commitments were feasible for companies of all sizes, not just Silicon Valley giants.

The agency originally tried using its Joint Cyber Defense Collaborative to prod companies into signing the pledge, according to the tech industry official, but that backfired when companies questioned the use of an operational cyberdefense collaboration group for “a policy and legal issue,” the industry official says.

“Industry expressed frustration about trying to use the JCDC to obtain pledges,” the official says, and CISA “wisely pulled back on that effort.”

CISA then held discussions with companies through the Information Technology Sector Coordinating Council and tweaked the pledge based on their feedback. Originally, the pledge contained more than seven goals, and CISA wanted signatories to commit to “firm metrics” for showing progress, according to the industry official. In the end, this person says, CISA removed several goals and “broadened the language” about measuring progress.

John Miller, senior vice president of policy, trust, data, and technology at the Information Technology Industry Council, a major industry trade group, says that change was smart, because concrete progress metrics—like the number of users using multi-factor authentication—could be “easily misconstrued.”

Goldstein says the number of pledge signatories is “exceeding my expectations about where we’d be” at this point. The industry official says they’re not aware of any company that has definitively refused to sign the pledge, in part because vendors want to “keep open the option of signing on” after CISA’s launch event at RSA. “Everyone’s in a kind of wait-and-see mode.”

Legal liability is a top concern for potential signatory companies. “If there ends up being, inevitably, some type of security incident,” Miller says, “anything [a] company has said publicly could be used in lawsuits.”

That said, Miller predicts that some global companies facing strict new European security requirements will sign the US pledge to “get that credit” for something they already have to do.

CISA’s Secure by Design campaign is the centerpiece of the Biden administration’s ambitious plan to shift the burden of cybersecurity from users to vendors, a core theme of the administration’s National Cybersecurity Strategy. The push for corporate cyber responsibility follows years of disruptive supply-chain attacks on critical software makers like Microsoft, SolarWinds, Kaseya, and Change Healthcare, as well as a mounting list of widespread software vulnerabilities that have powered ransomware attacks on schools, hospitals, and other essential services. White House officials say the pattern of costly and often preventable breaches demonstrates the need for increased corporate accountability.

The Biden administration is using the federal government’s contracting power to set new minimum security standards for the software that agencies buy, with the goal of modeling responsible behavior for the entire industry. White House officials are also studying proposals to make all vendors, not just federal contractors, liable for security failures, but that effort faces an uphill battle in Congress.

With no authority to require better cybersecurity for the entire software industry, the White House has tasked CISA with prodding companies to commit to voluntary improvements. That effort began last April with the publication of specific recommendations for incorporating cybersecurity into the product design, development, and configuration process. CISA consulted with the tech industry and the security research community on refinements to that document and released an updated version last October. At around the same time, CISA announced that it had obtained Secure by Design commitments from six major K-12 educational technology vendors. That move, while limited to one industry, signaled CISA’s clear desire to convert its guidance into public corporate pledges.

“It has long been our goal … to move from just the white papers and the guidance to get companies to say, ‘Yes, we agree, and here’s what we're doing,’” Goldstein says. “The pledge really is that concrete manifestation of the guidance that we’ve been developing for a year.”

But the efficacy of the voluntary pledge remains to be seen. “Pledging companies will self-assess and self-report,” says Katie Moussouris, CEO and founder of Luta Security, “so only time will tell if they’ve effectively applied the measures and if the pledge proved to be an effective accountability mechanism.”

Miller says he expects the pledge to keep companies accountable because of the potential legal consequences of neglecting promised improvements. In the meantime, government officials are counting on customers to pressure vendors to both sign and abide by the pledge.

“Right now, we see the demand for safe and secure products to really be significant,” Goldstein says. “We think that … customer demand will drive that progress for us.”

[night-loop]

The Birthday Massacre’s demos uploaded to Patreon (part 2)

First of all, I highly recommend that you support the band by subscribing to their Patreon, so you can listen to and download these for yourself :) But for those without the means to, or those who want a concise list, here we are! Broken into Part 1 and 2.

Part 1 is here

In order of upload (oldest to most recent). Text in quotation marks is copied + pasted directly from the Patreon upload. Unquoted text is my own thoughts. 

Fading. Dreams of You demo. [Rainbow, about sending the demo to Falcore:] "he plays us this song but he's turned it upside down and created this bopping eighties jam with it. Sped up the tempo, modified the key of the song and added some really cool synth production to it." Fading is a slowed down, spooky, "introspective" demo of Dreams of You. Lyrics are slightly different and the sound is more haunting and longing. Length: 1:49. Exact date unknown.

Marionettes (Premix). In This Moment demo. Very similar to the final version, but different vocals/lyrics in the second chorus. Length: 4:44. Exact date unknown.

Outside. A short instrumental demo of Beyond. Length: 1:27. Exact date unknown

Legend. "Building a Song"- synth chord progressions that developed into Precious Hearts. Length: 1:40. Exact date unknown.

Legend. Precious Hearts demo instrumental. "Building a Song"- "Here is the next version of the song. At this point, Falcore has continued to work out the track and added additional synths and some drums to start to form the idea..... This track was actually called "Legend" right up until the final mix!" Length: 1:52. Exact date unknown.

Legend (Bat vocals). Precious Hearts demo with Bat's vocals. "Building a Song" - vocal ideas only in the first verse and pre-chorus. Length: 4:30. Exact date unkown.

Legend (Chibi rough vocals). Precious Hearts demo. "Building a Song" - Two weeks before album needs to be complete: "What's left? Well, now we would dive into Tracking the final vocals now that Chibi knows the song. Over the next couple of weeks, we will record each song a bunch of times with her in different mindsets of performance. Relaxed, aggressive, soft, intimate and then find the perfect combo for the final album! You may notice there are a couple of things missing still! Rainbow's Harmonies and the Bridge idea!" Length: 4:30. Exact date unknown.

Precious Hearts (Final mix, unmastered). "Building a Song". Title switched from Legend to Precious Hearts. Subtle differences from released mastered version- for example, this can clearly be heard in the bridge. Length: 4:24. Exact date unknown.

Crossed. An electronic-driven instrumental "demo from the "Diamonds" sessions that never fully became a song!" Length: 3:38. Dated to 2018. Exact date unknown.

Neon. End of All Stories demo with Rainbow's vocals, only in the first verse. Length: 2:37. Exact date unknown.

Spooky Loop. A higher quality of the instrumental background music that used to feature on the old nothingandnowhere.com website. Length: 2:27. Exact date unknown.

Night Loop. Another higher quality instrumental from the nothingandnowhere.com website. Length: 1:54. Exact date unknown.

Fatality. Like Fear, Like Love demo with Rainbow's rough vocal ideas. Demo created by Falcore. Length: 2:34, Exact date unknown.

Fatality. Like Fear, Like Love demo. Chibi's rough vocals, but not yet complete (e.g. empty chorus). Length: 4:26. Exact date unknown.

Other. Run instrumental demo. Length: 3:24. Exact date unknown.

Soundtrack. A short instrumental demo from the Walking with Strangers era. "Here is an idea that may have blossomed but there were already so many songs on the table!" Length: 0:56. Exact date unknown.

Irreversible. "An unused gem from 2018 "Diamonds" writing sessions." Instrumental demo which *partly* sounds reminiscent of early instrumental work (e.g. Night Loop, Spooky Loop). Length: 1:51. From 2018. Exact date unknown.

Beware Loop. "Here's a sweet little loop made from the "Hide & Seek" era!". Instrumental track that *partly* sounds like Cold Lights. Length: 1:37. Exact date unknown.

Superstition (Rainbow Version). "A version of "Superstition" that Rainbow had created during his Wight Eye's writing sessions." Length: 4:09. Exact date unknown.

Bad Jeans. A heavy electro-driven instrumental demo . "Written pre Hide & Seek." Length: 4:56. Exact date unknown.

Ever. Instrumental demo with guitars, drums and electronic sounds. "Written pre Hide & Seek." Length: 2:11. Exact date unknown.

2 Hearts (OE demo). Rough demo of Two Hearts with OE singing the first verse and chorus. Length: 1:45. Recorded in 2008. Exact date unknown.

GhostTown. Sideways instrumental demo. Length: 2:24. Exact date unknown.

Pale Instrumental demo. More stripped down than the final instrumental- more electro than rock-driven. Some of the synth is more distorted, which sounds really fun! Length: 3:21. Exact date unknown.

Restraint. The Long Way Home demo by OE, featuring different vocals and lyrics from OE. Sounding even scarier and darker than the final version. Length: 1:54. Exact date unknown.

Glamorama. Instrumental demo of Always with electronic notes instead of vocals. Length: 4:13. Exact date unknown.

Control demo. Featuring Falcore's vocals, and some lyrical differences. Length: 3:24. Exact date unknown.

Part 3 will be uploaded in the future!

[digitalmarketingagencypeshawar]

Peshawar Digital Marketing Agency: Crossing the Digital Divide

The thriving capital of Khyber Pakhtunkhwa, Pakistan, Peshawar, has witnessed a notable increase in the presence and influence of digital marketing organisations in the quickly changing digital world. These organisations are leading the way in converting conventional company models into innovative, web-based businesses. Among the platforms they use, Tumblr sticks out as a special and successful tool for digital marketing, providing a variety of chances for brands to engage with their audience in a creative and efficient manner.

Digital Marketing's Ascent in Peshawar Peshawar's digital marketing landscape has expanded rapidly in the last several years. In order to improve their online visibility, local businesses—from classic handicraft stores to cutting-edge tech startups—are increasingly resorting to digital marketing services. Search engine optimisation (SEO), content marketing, social media management, and online advertising are just a few of the services that these firms provide.Digital Marketing Agency In Peshawar offers wide range of digital topics.

Tumblr:

A Missed Opportunity in Online Advertising The social networking and microblogging site Tumblr is frequently eclipsed by industry heavyweights like Facebook, Instagram, and Twitter. But because of its special qualities, it's a useful tool for digital marketers. Rich multimedia material, fully customisable blogs, and a vibrant community are all made possible by Tumblr, and these features can be especially helpful for niche marketing.

What makes Tumblr special?

Creativity and Customisation:

Brands may develop aesthetically pleasing and highly customised blogs with Tumblr thanks to its versatile interface. With this creative freedom, brands may successfully communicate their identity and values.

Text, images, quotations, links, audio, and video are just a few of the types that Tumblr can handle when it comes to rich multimedia material. Because of its adaptability, marketers may employ a variety of content formats to interact with their audience and increase user engagement.

Community Engagement:

The robust and lively communities on Tumblr are well-known. Using these communities, brands may interact with consumers who have similar interests and develop a devoted following. Benefits for SEO: Tumblr blogs have good SEO. A brand's presence on search engines can be increased by having a well-optimised Tumblr page, which will increase organic traffic to the main website.

How Peshawar's Digital Marketing Agencies Use Tumblr Peshawar-based digital marketing companies are starting to realise Tumblr's potential. They are using the platform as follows:

Content Creation:

To cater to the interests of Tumblr's wide user base, agencies provide visually appealing and captivating content. Blog entries, info-graphics, films, and interactive materials fall under this category. Community Building: Agencies assist brands in gaining a devoted and robust following on Tumbler by actively engaging in these communities. By interacting with users via direct messages, re blogs, and comments, they promote a sense of community and fidelity.

Campaign Management:

To reach a wider audience, agencies use promotional posts and targeted advertising to manage and carry out marketing campaigns on Tumblr. To improve campaign performance, they monitor performance data and make necessary adjustments.

Brand Identity:

Agencies assist companies in building a strong online presence on Tumblr by creating personalised themes and unified branding. The uniformity of the brand across all digital platforms strengthens trust and brand recognition.

In summary Peshawar's digital marketing environment is dynamic and changing quickly. The city's digital marketing organisations are skilled at using Tumblr and other platforms to help businesses reach their target audiences and meet their marketing objectives. Because of its distinctive qualities, Tumblr is a useful resource for innovative and community-focused marketing campaigns. The importance of these agencies will only increase as more companies realise the possibilities of digital marketing, spurring success and innovation in Peshawar's business community.

FAQ

1. What is the purpose of using Tumblr for digital marketing for my company? Tumblr has several benefits, like blogs that are incredibly customisable, support for rich multimedia material, and active community involvement. These characteristics might make your company stand out and appeal to a specific type of customer.

How might a Tumblr digital marketing agency benefit my company? On Tumblr, a digital marketing agency can support with content creation, community building, campaign management, and brand identity establishment.

Is Tumblr appropriate for all kinds of companies? Tumblr may help any business trying to interact with specific communities and improve their online profile, but it's especially useful for companies that can use creative and graphic content.

What are the advantages of Tumblr for SEO? Because Tumblr blogs are SEO-friendly, they can raise the visibility of your brand on search engines. Tumblr optimised content can increase organic traffic to your primary website.

What distinguishes Tumblr's community involvement from that of other platforms? Creative expression and a strong feeling of common interests are what fuel Tumblr's community engagement. With regard to particular issues, users frequently establish close-knit communities, which facilitates brand engagement with highly engaged audiences. Businesses in Peshawar can improve their digital marketing tactics, expand their customer base, and succeed more in the digital sphere by knowing and leveraging Tumblr's distinctive qualities.

Q6: How can companies assess whether their efforts in digital marketing are successful? A6: Key performance indicators (KPIs) such website traffic, conversion rates, social media engagement metrics, return on investment (ROI) from advertising campaigns, and search engine rankings can be used by businesses to gauge the effectiveness of their digital marketing initiatives.

Q7: How does content marketing fit into the plans of digital marketers? A7: Content marketing is essential for building a brand's credibility and authority. The target audience is drawn to and engaged by high-quality content, which also generates organic traffic and bolsters other marketing initiatives like SEO and social media marketing.

Q8: Are there any particular trends in digital marketing that Peshawar businesses ought to be aware of? A8: Trends like the growing usage of video content, influencer marketing, mobile optimisation, personalised marketing experiences, and the expanding influence of automation and artificial intelligence in marketing are things that businesses should be aware of.

Q9: How can Peshawar-based digital marketing companies assist with brand development? A9: By developing a strong online presence through consistent branding across several digital channels, interesting content, well-placed advertisements, and proactive social media management, these agencies help to establish brand recognition and loyalty.

Q10: What qualities ought companies to consider before selecting a Peshawar digital marketing agency? A10: Companies should seek out an agency with a track record of accomplishment, experience in the relevant field, a wide range of services, a clear grasp of their objectives, open communication, and a cooperative mindset.

[darlastonbuildersmerchants]

Digital Innovation in Building Materials: How DBMdiy Streamlines Your Birmingham Projects

The construction industry is rapidly embracing digital transformation, and the way builders and homeowners source construction supplies in Birmingham is no exception. At DBMdiy, we are at the forefront of this evolution, leveraging digital building materials solutions to offer an unparalleled, seamless, and efficient building materials procurement experience for all our customers in Birmingham and the West Midlands.

The Rise of Digital in Construction Supplies

Gone are the days when sourcing materials was solely a physical, paper-based process. Today, digital tools are revolutionizing how we interact with builder merchants, bringing speed, accuracy, and convenience to the forefront. For projects in Birmingham, this means:

24/7 Accessibility: Order materials or check stock levels anytime, anywhere.

Enhanced Information: Access detailed product specifications, certifications, and technical data at your fingertips.

Streamlined Processes: Reduce administrative overhead with faster quoting, ordering, and invoicing.

Improved Accuracy: Minimize errors associated with manual data entry.

Better Planning: Utilize digital tools for precise quantity calculations and project planning.

DBMdiy is investing heavily in these capabilities to ensure we remain the leading online builder merchants Birmingham can rely on.

DBMdiy's Digital Toolkit for Your Convenience

Our commitment to digital innovation is designed to make your life easier, whether you're a seasoned contractor or a busy DIY enthusiast. Here's how DBMdiy is integrating digital building materials solutions into our service:

Comprehensive Online Product Catalogue: Our website, DBMdiy.com, serves as your virtual showroom and warehouse. It features our entire extensive range of construction supplies in Birmingham, complete with high-resolution images, detailed descriptions, and specifications. You can browse categories like bricks Birmingham, timber Birmingham, aggregates Birmingham, and more, all from the comfort of your office or home.

User-Friendly Material Calculators: Take the guesswork out of ordering! Our website features intuitive material calculators for various products. Input your project dimensions, and our calculators will provide accurate estimates for the amount of concrete, plaster, or paving slabs you'll need. This tool is invaluable for efficient building materials procurement, reducing waste and ensuring you order precisely what's required.

Seamless Online Ordering (Coming Soon for Trade Accounts): While our website currently allows for easy Browse and quotation requests, we are actively developing enhanced online ordering capabilities for our trade customers. This will enable streamlined repeat orders, access to personalized pricing, and simplified account management, further boosting efficient building materials procurement.

Digital Proof of Delivery (POD) & Invoicing: Our robust logistics system supports digital proof of delivery, providing you with real-time confirmation of your material deliveries. This integrates with our digital invoicing system, making record-keeping simpler and more transparent.

Responsive Online Support: Our website isn't just for ordering; it's a hub for support. You can easily find our contact details, send inquiries, and access FAQs, ensuring you always have a direct line to our expert team for any questions about your building materials in Birmingham.

The Future of Efficient Building Materials Procurement

The landscape of construction is constantly evolving, and DBMdiy is dedicated to evolving with it. We understand that effective use of digital building materials isn't just about having a website; it's about integrating technology into every facet of our operations to enhance your experience. This means:

Real-time Stock Information: Future developments aim to provide even more precise, real-time stock availability across our branches, helping you plan your purchases with greater certainty.

Personalized Digital Experiences: Leveraging data to provide customized product recommendations and promotions tailored to your specific project history and preferences.

Mobile-First Design: Ensuring our digital platforms are perfectly optimized for mobile devices, allowing you to manage your material needs on the go, directly from the construction site.

DBMdiy is committed to being more than just a supplier; we aim to be your digital partner in construction. Our investment in digital building materials and processes is a testament to our dedication to providing efficient building materials procurement and unparalleled service to all our customers in Birmingham.

Discover the convenience and efficiency of DBMdiy's digital approach. Visit DBMdiy.com today to explore our extensive range of construction supplies in Birmingham and experience the future of building materials procurement.

[udhhyogpipesupplier]

Top SS Pipe Manufacturer in India – Udhhyog’s Industrial Grade Pipes

When it comes to high-performance stainless steel (SS) pipes for industrial applications, choosing the right manufacturer is critical. Whether it's construction, chemical processing, fluid transmission, or heavy fabrication, stainless steel pipes must meet the highest standards of strength, durability, and corrosion resistance.

That’s where Udhhyog stands out as a top SS pipe manufacturer in India, offering a wide range of industrial-grade SS pipes that are trusted by engineers, contractors, and project developers across the country.

✅ Why Udhhyog Is Among the Top SS Pipe Manufacturers in India

🔹 Wide Range of Grades

Udhhyog manufactures and supplies stainless steel pipes in all popular grades, including:

SS 304 – General-purpose grade suitable for water, dairy, and architecture

SS 316 – High corrosion resistance, ideal for marine and chemical industries

SS 310 – Heat-resistant stainless steel for boilers and furnaces

SS 202 – Economical grade for structural applications

🔹 Seamless & ERW Options

Choose between:

SS Seamless Pipes – No welds, high strength, best for pressure applications

SS ERW Pipes – Economical, precision-made, perfect for structural use

📐 Udhhyog’s Industrial Grade Pipe Specifications

ParameterSpecificationSize Range½” to 24” NBScheduleSCH 10, 20, 40, 80 & customLength1m to 6m (or as required)End TypePlain / Beveled / ThreadedFinishMill finish, polished, or mirror finishStandardsASTM A312, A778, IS 3589, IS 1239

🛠️ Industries Served by Udhhyog SS Pipes

Udhhyog stainless steel pipes are widely used across multiple sectors:

🏗️ Construction & Infrastructure – Columns, beams, handrails, and pipelines

🧪 Chemical & Petrochemical Plants – SS 316 & SS 310 for corrosion resistance

🚢 Marine & Offshore – Saltwater-resistant SS grades

🏭 Food & Beverage – Sanitary-grade SS pipes for hygiene and quality

🔥 Boilers & Heat Exchangers – Heat-resistant seamless SS pipes

🛠️ Fabrication – Custom cut-lengths and profiles for industrial fabrication

📦 Value-Added Services by Udhhyog

Udhhyog goes beyond manufacturing by offering complete pipe solutions:

✅ Custom cutting, bending & threading

✅ Third-party inspection (TPI) available

✅ Test certificates & compliance documents

✅ Bulk order support with logistics management

✅ PAN India delivery with fast dispatch

📞 How to Order Stainless Steel Pipes from Udhhyog

Ordering from Udhhyog is simple and transparent. Whether you’re a fabricator, civil contractor, or OEM, we offer prompt quotations, technical support, and after-sales service.

📧 Email: sales@udhhyog.com

📞 Call / WhatsApp: +91-XXXXXXXXXX

🌐 Website: https://udhhyog.com

🌟 Why Udhhyog Is the Right Choice

🏆 15+ Years of Manufacturing Excellence

🔍 ISI & ASTM Certified Products

🚚 Bulk Supply with Timely Delivery

💬 Technical Consultation for Project Needs

💡 Innovative & Cost-Effective Solutions

🔚 Conclusion

If you're searching for the top stainless steel pipe manufacturer in India, look no further than Udhhyog. With its focus on quality, custom engineering, and reliability, Udhhyog is the go-to partner for industrial-grade SS pipes across the country.

👉 Reach out today to get a competitive quote and discover the Udhhyog difference.

[mahateermuhamed]

 ERP Software in Hyderabad – Empowering Businesses with Smart Automation

Introduction: Hyderabad, a thriving center for IT, pharmaceuticals, manufacturing, and logistics, is fast becoming a key player in India’s business and industrial growth. With increasing demand for speed, accuracy, and efficiency, businesses in Hyderabad are turning to ERP (Enterprise Resource Planning) software to automate operations, manage resources, and stay competitive.

Whether you’re a small-scale manufacturer, a growing distributor, or a well-established enterprise, implementing the right ERP solution in Hyderabad can unlock new levels of operational excellence and profitability.

Why Businesses in Hyderabad Need ERP Software

1. End-to-End Business Integration ERP brings every function—sales, finance, inventory, HR, and production—under a unified platform, breaking silos and improving inter-departmental collaboration.

2. Data-Driven Decision Making With centralized data dashboards and real-time reporting, ERP helps managers and owners make quick, confident decisions using accurate insights.

3. Industry-Specific Customization Hyderabad hosts diverse sectors including pharma, IT services, real estate, manufacturing, and food processing. ERP systems can be customized to handle sector-specific workflows like batch tracking, compliance, inventory aging, or multi-location management.

4. Compliance and Taxation Support ERP software designed for India is GST-compliant, supports TDS, e-invoicing, and integrates with local tax systems—ensuring businesses in Hyderabad stay compliant with ease.

Key ERP Modules for Hyderabad-Based Companies

Sales and CRM – Manages leads, opportunities, quotations, and customer lifecycle.

Finance and Accounting – Automates ledgers, GST billing, audit reports, and payments.

Inventory and Procurement – Controls stock movement, vendor management, and purchase orders.

Manufacturing and Production – Tracks BOMs, job work, production plans, and machine logs.

HR and Payroll – Manages employee data, attendance, shift patterns, and salary processing.

Project Management – Ideal for IT and construction firms to track timelines, tasks, and budgets.

Who Needs ERP in Hyderabad?

Pharmaceutical Manufacturers

Food & Beverage Processing Units

IT and Software Development Firms

Logistics and Warehousing Companies

Engineering and Industrial Equipment Makers

Retail Chains and Distributors

Construction and Real Estate Developers

Advantages of ERP Implementation

  Minimized manual errors   Faster billing and order management   Better vendor and customer relationships   Efficient stock and asset tracking   Real-time business insights   Improved bottom-line results

Why Choose Banibro IT Solutions for ERP in Hyderabad?

Banibro IT Solutions is a trusted name in delivering ERP software solutions tailored to various industries in Hyderabad. With years of domain expertise and a customer-first approach, we help businesses digitize, automate, and scale with confidence.

Our Offerings Include:

Tailored ERP setups for Hyderabad industries

On-premise and cloud ERP solutions

End-to-end implementation with training

24/7 technical support and updates

Ready to Upgrade Your Business with ERP?

Contact Banibro IT Solutions Today!  Call: +91-93422 58771   Email: info@banibro.com   Website: www.banibro.com

Achieve faster growth and greater control with Banibro’s ERP solutions in Hyderabad.

[21twelve]

How Laravel Development Services Deliver High-Performance Web Portals for B2B Brands

In the fast-paced world of B2B business, your digital presence is more than just a website; it's your primary tool for lead generation, sales enablement, and partner communication. For enterprises that need performance, flexibility, and reliability, Laravel has become the go-to PHP framework. With Laravel development services, B2B companies can build high-performance web portals that are scalable, secure, and customized for complex workflows.

In this blog, we’ll explore how Laravel stands out, what makes it ideal for B2B web portals, and why partnering with the right Laravel development company can accelerate your digital growth.

Why Laravel for B2B Web Portals?

Laravel is a modern PHP framework known for its elegant syntax, modular architecture, and strong ecosystem. It supports robust backend development and integrates seamlessly with frontend tools, third-party APIs, and databases.

Here's what makes Laravel especially strong for B2B website:

Security: Laravel comes with built-in authentication, CSRF protection, and encryption features.

Scalability: Its modular architecture allows you to scale features as your business grows.

Speed & Performance: Laravel includes caching, database optimization, and efficient routing to enhance speed.

API Integration: Laravel is great at creating and using RESTful APIs, making it ideal for B2B platforms that rely heavily on data.

Custom Workflows: B2B portals often require custom workflows like quotation systems, user roles, or dynamic dashboards. Laravel can easily handle these with custom logic.

Core Features of Laravel Development Services for B2B Portals

The best Laravel development services focus on custom development, security, speed, and long-term scalability. Here’s what they typically include:

1. Custom Portal Development

Every B2B business is different. Laravel allows complete control over features, UI/UX, and data structure, enabling the development of:

Lead management systems

Vendor or supplier portals

Customer self-service portals

Partner dashboards

Internal employee tools

Custom development ensures that the portal matches your exact business processes.

2. Role-Based Access Control (RBAC)

Most B2B portals deal with multiple user types: sales teams, clients, vendors, admin staff, etc. Laravel makes implementing secure, flexible role-based permissions simple.

Define user roles and permissions

Restrict access to certain pages or features

Track user activity for accountability

This helps maintain secure and structured workflows across teams.

3. Data-Driven Dashboards and Reporting

Laravel can connect with various databases and analytics tools to power real-time dashboards. B2B brands can access:

Sales and marketing KPIs

Inventory and supply chain metrics

Client activity reports

CRM insights and performance charts

Whether you need graphs, search filters, or reports to download, Laravel can handle and show data smoothly.

4. API Integrations

B2B businesses often rely on tools like Salesforce, HubSpot, QuickBooks, Zoho, or SAP. Laravel supports:

REST and SOAP API integrations

Secure token-based authentication

Real-time data sync between systems

This creates a unified workflow across your technology stack.

5. Performance Optimization

A slow web portal can lose clients. Laravel includes:

Built-in caching 

Optimized SQL queries with Eloquent ORM

Lazy loading and queue systems

Route and view caching

These help reduce load times and keep your portal fast even with high traffic or large data volumes.

6. Advanced Security Features

For B2B businesses, security is not optional. Laravel provides:

Protection against SQL injection, XSS, and CSRF attacks

Two-factor authentication 

HTTPS enforcement and data encryption

Secure user session handling

This ensures sensitive B2B data is protected around the clock.

7. Multi-Language and Localization Support

If your brand serves clients across different regions or languages, Laravel makes it easy to deliver a multi-language experience.

Translate pages, forms, and emails

Use locale-based routing

Serve region-specific content

It’s especially useful for global B2B firms and export-driven businesses.

8. Easy Maintenance and Scalability

Laravel uses MVC (Model-View-Controller) architecture, making the codebase clean and modular. This allows:

Easy future upgrades

Addition of new features without affecting existing code

Seamless onboarding of new developers

Laravel projects are built to last, saving you time and cost in the long term.

Real-World Use Cases

Many B2B companies from different industries have effectively used Laravel to build their web portals.

Manufacturing: Supplier/vendor management, order tracking, and inventory systems

Healthcare: HIPAA-compliant patient portals for device or equipment tracking

IT Services: Customer portals for ticketing, SLA management, and invoicing

Finance: Secure dashboards for client data, transaction histories, and investment analytics

Logistics: Delivery tracking and fleet management systems

With custom Laravel development, you’re not tied to template limitations.

Choosing the Right Laravel Development Partner

Hiring the right team is crucial. Here’s what to look for:

Experience: Proven track record in B2B and Laravel projects

Communication: Clear project planning, regular updates, and transparency

Full-stack expertise: Laravel with frontend (Vue, React), DevOps, and database skills

Post-launch support: Maintenance, bug fixes, and scalability planning

The ideal partner will understand your business goals and recommend technology solutions accordingly.

Conclusion

Laravel has proven to be a powerful, secure, and efficient framework for developing high-performance B2B portals. From custom workflows and advanced dashboards to secure user roles and API integrations, Laravel delivers everything modern B2B businesses need in a digital platform.

Choosing the right Laravel development services allows your brand to stay ahead, operate more efficiently, and offer a seamless digital experience to partners, vendors, and clients.

If your business is ready to go beyond a basic website and embrace a true digital portal, Laravel might just be the smartest decision you’ll make in 2025.

FAQs

Q1. Why should B2B businesses choose Laravel over other PHP frameworks? Laravel offers advanced security, flexibility, and performance features that are ideal for complex business portals. It also has a big network of tools and a strong developer community.

Q2. Can Laravel manage big databases and many users at the same time? Yes, Laravel is scalable and can handle high volumes of data and concurrent users when paired with the right infrastructure.

Q3. How much time does it usually take to create a B2B portal using Laravel? It depends on complexity. A basic version might take 4–6 weeks, while advanced platforms may take 3–6 months.

Q4. Is Laravel suitable for mobile-friendly and responsive designs? Absolutely. Laravel works well with modern frontend frameworks like Vue or React to deliver responsive, mobile-optimized experiences.

[thorvertonstone]

Thorverton Stone: Leading Cast Stone Manufacturers Crafting Bespoke Architectural Solutions

When it comes to high-quality architectural stone products, Thorverton Stone stands out as one of the UK’s premier cast stone manufacturers. With over three decades of experience, the company has built a reputation for delivering bespoke cast stone solutions that combine durability, beauty, and craftsmanship. Whether you’re a self-builder, architect, or professional contractor, Thorverton Stone offers an extensive range of products tailored to suit a variety of residential, commercial, and landscaping projects.

Why Choose Thorverton Stone as Your Cast Stone Manufacturers?

As expert cast stone manufacturers, Thorverton Stone is dedicated to producing cast stone that replicates the look and feel of natural stone while offering enhanced versatility and ease of installation. Their manufacturing process utilises natural aggregates mixed with cementitious binders, ensuring products are both strong and visually appealing. This method provides an excellent alternative to quarried stone, with the added benefit of bespoke design flexibility.

Extensive Product Range for Every Architectural Need

Thorverton Stone’s catalogue includes a wide variety of architectural cast stone products designed to complement any project. From elegant window surrounds to robust coping stones and stylish pier caps, the company can deliver both standard and customised items. Their offerings also include porticos, door surrounds, quoin stones, balustrades, columns, fireplaces, and more — all crafted to enhance the aesthetic appeal and functionality of buildings and outdoor spaces.

Each product can be tailored to meet specific requirements, including size, colour, and finish. This bespoke service ensures that every project maintains architectural integrity, whether it’s a period property restoration or a modern development.

Advanced Manufacturing Techniques

Thorverton Stone employs three key manufacturing methods: semi-dry one-part, semi-dry two-part, and wet cast. These techniques allow the company to produce a wide range of products, from simpler shapes to intricate, detailed designs. Their state-of-the-art production process ensures consistent quality and rapid turnaround times, even for complex bespoke orders.

Working with a Trusted Partner

Choosing the right cast stone manufacturers is crucial for the success of your construction or landscaping project. Thorverton Stone’s team works closely with clients throughout the process — from initial enquiry to final delivery. Their expert advice helps clients select the perfect stone profiles and finishes that complement existing architecture or design visions.

The company’s commitment to customer service, combined with their manufacturing expertise, ensures every order meets exacting standards. Their products are used across the UK in homes, commercial buildings, gardens, and heritage restorations.

Sustainable and Long-Lasting Solutions

In addition to quality and aesthetics, Thorverton Stone is conscious of sustainability. Their cast stone products are made to last, reducing the need for frequent replacements and helping to minimise environmental impact. By choosing Thorverton Stone, clients invest in durable architectural features that stand the test of time.

Contact Thorverton Stone Today

If you’re looking for reliable cast stone manufacturers who provide tailored, high-quality products, Thorverton Stone is your ideal partner. Visit their website or contact their team directly to discuss your project requirements and request a detailed quotation. Experience the perfect blend of craftsmanship, innovation, and personalised service with Thorverton Stone.

[ppcstudioo]

E-commerce Website Development Companies in Bangalore You Should Know

In today's digital-first world, your website is your business's most powerful asset. Whether you are a startup, a growing business, or an established enterprise, having a fast, responsive, and user-friendly website is essential to stand out in a competitive market like Bangalore. If you’re searching for the best website development company in Bangalore, you’ve landed at the right place. Welcome to PPCStud.io, your one-stop destination for smart, scalable, and SEO-friendly web development solutions.

Why Choose a Professional Website Development Company in Bangalore?

Bangalore, known as the Silicon Valley of India, is home to thousands of tech-savvy businesses and startups. In this digital hub, your website isn’t just a digital brochure—it’s a lead-generating, brand-building, and sales-boosting machine. Here’s why hiring a professional website development company in Bangalore like PPCStud.io makes all the difference:

Access to a highly skilled talent pool

Advanced technologies and tools

SEO and performance-focused development

Customized solutions for every industry

Timely delivery and dedicated support

Services Offered by Our Website Development Company in Bangalore

At PPCStud.io, we believe in crafting websites that tell your brand story while driving measurable results. Our wide range of web development services includes:

✅ Custom Website Development

No cookie-cutter templates here! We create tailored websites that align with your brand identity, audience needs, and business goals. Our team ensures the design is sleek, the navigation intuitive, and the user experience seamless.

✅ E-commerce Website Development

Take your online store to the next level with feature-rich, scalable, and secure e-commerce websites. Whether it's WooCommerce, Shopify, Magento, or custom-built platforms, we’ve got your e-store covered.

✅ Responsive Website Design

Mobile-first is no longer a trend—it's a necessity. As a leading website development company in Bangalore, we ensure your site looks and performs flawlessly across all devices—mobiles, tablets, and desktops.

✅ CMS Website Development

Manage your content easily with powerful CMS platforms like WordPress, Joomla, or Drupal. We offer CMS-based website development that gives you full control over your site’s content and updates.

✅ Web Application Development

Do you need a custom web application or a portal for internal operations? From dashboards to customer-facing applications, we build secure, robust, and performance-driven web apps.

What Makes PPCStud.io the Best Website Development Company in Bangalore?

With hundreds of options out there, what makes PPCStud.io stand out? Here’s what sets us apart:

✅ Experienced Team of Developers

Our developers have deep expertise in multiple programming languages and frameworks, including HTML, CSS, JavaScript, PHP, Laravel, React, Angular, and more.

✅ 100% Customization

Your business is unique, and so should be your website. We don’t believe in one-size-fits-all. From layout to features, everything is built to match your goals.

✅ SEO-Friendly Development

What good is a beautiful website if no one finds it? We incorporate on-page SEO best practices from the ground up—ensuring your website ranks on search engines from day one.

✅ Fast Loading Speed & Performance

Speed is critical in retaining visitors. Our optimized coding ensures that your site loads quickly, providing an excellent user experience and better SEO performance.

✅ Transparent Pricing

No hidden costs or vague quotations. We offer clear and competitive pricing for all our services so you know exactly what you’re paying for.

Industries We Serve as a Website Development Company in Bangalore

Our web solutions are versatile and tailored for businesses across multiple sectors, including:

E-commerce & Retail

Education & eLearning

Healthcare & Wellness

Real Estate

Fintech & Banking

Hospitality & Travel

Logistics & Supply Chain

Startups & Enterprises

Whether you're a boutique store, a growing consultancy, or a multinational corporation, we have the right solutions tailored for your business.

Tech Stack We Use in Our Website Development Company in Bangalore

To deliver the best, we use the best. At PPCStud.io, we work with cutting-edge technologies:

Frontend: HTML5, CSS3, JavaScript, React.js, Angular.js

Backend: Node.js, PHP, Laravel, Python

CMS Platforms: WordPress, Drupal, Joomla

E-commerce: WooCommerce, Magento, Shopify

Databases: MySQL, MongoDB

Hosting: AWS, Bluehost, DigitalOcean

Our tech stack is robust, modern, and scalable to keep your website future-ready.

Client Success Stories

We have helped numerous clients transform their online presence with our website development expertise. From local startups in Bangalore to global businesses, our work has helped clients:

Increase website traffic by over 200%

Reduce bounce rates by 40%

Double their online leads and conversions

Build brand credibility through stunning design

Visit our portfolio to explore real-world success stories: https://ppcstud.io

FAQs – Website Development Company in Bangalore

Q1. How much does a website cost at PPCStud.io? A: It depends on the type and complexity of your website. We offer affordable packages customized for every budget.

Q2. Do you offer website redesign services? A: Yes! If your current site is outdated or underperforming, we can give it a complete revamp.

Q3. How long does it take to build a website? A: A basic website can take 2–4 weeks, while complex sites may take longer. We’ll give you a clear timeline after the consultation.

Q4. Will my website be mobile-friendly? A: Absolutely. Every website we create is 100% responsive and optimized for all screen sizes.

Q5. Do you offer post-launch support? A: Yes, we offer ongoing maintenance and support packages to keep your site updated and secure.

Ready to Launch Your Website with the Best Website Development Company in Bangalore?

If you’re looking for a trusted, experienced, and innovative website development company in Bangalore, look no further than PPCStud.io. Whether you're building your first website or upgrading an old one, we’re here to make your vision come alive.

✅ Get a Free Quote Today ✅ Schedule a Free Consultation ✅ Transform Your Online Presence

👉 Visit Now: https://ppcstud.io 👉 Let’s build your dream website together!

[aratimahato]

Want to accelerate Freight Sales with QuickMove

Today’s freight forwarder is constantly being challenged to execute more efficiently, close more opportunities, and offer a flawless customer experience. Old-timey tools and piecemeal systems inevitably lead to bottlenecks, which amount to lost dollars and lost business opportunities. Lag response, lead chaos, and unacceptably poor real-time visibility from your sales organization's freight team are signs to rethink your way of working.

That’s where QuickMove comes in: industry-specific, intelligent freight forwarding software designed to enable salespeople, automate customer management, and accelerate deal closing.

QuickMove’s CRM module allows freight forwarders to manage, capture, and distribute leads from one portal. QuickMove ensures nothing slips through the cracks, whether your leads are generated through your website, email, or ground reps. Automated processes help sales organizations reduce lead-to-quote time by far by answering questions, creating estimates, and contacting customers quickly. No longer chasing changes or juggling spreadsheets.  QuickMove allows teams to focus on what matters most: closing deals through real-time visibility of lead status, priorities, and sales performance.

 Instant Quotes and Smart Pricing Tools

Advanced price systems by cargo type, destination, carrier rate, and charge at times govern the sale of freight.  QuickMove’s quote function offers a feature for built-in quotations that allows customers to produce skilled, accurate quotations in just minutes. The software calculates the prices automatically through defined parameters, eliminating the occurrence of human error and delay. This live quote facility is groundbreaking. A quicker response to customers instills them with confidence in your service. With QuickMove, you present a shrewd, professional image instead of a hasty offer.

From Inquiry to Booking: End-to-End Visibility

The hardest work freight teams must perform is opportunity status monitoring and seamless division handoffs. From first client contact to booked confirmation, QuickMove provides end-to-end visibility into the sales pipeline. All stages of the sales process are recorded, tracked, and available to authorized team members. This transparency ensures improved collaboration between sales and operations, more efficient operation of processes, and a more consistent client experience.

Automated Task Reminder and Follow-up

Time waits for no shipment when it comes to freight forwarding. Automation of follow-up in QuickMove ensures your sales team never lags behind. It reminds and reminds on pending work, follow-up, or documents pending. It saves sales from going astray on account of late responses or missed calls.

By automating routine communication, your sales reps can focus more on strategic selling and relationship-building—thus boosting conversion rates. Actionable Insights and Sales Performance Reports.

QuickMove lets you drive maximum sales, rather than simply managing them. You can use in-built MIS reporting and analytics to gain deeper insights into sales performance, conversion rates, quote-to-booking, and more as a freight manager. Improved decision-making using such data helps you refine your approach and train employees based on actual performance figures. The key to accelerating sales development, whether you are a small freight forwarder or a large logistics company—and QuickMove does that—lies in knowing what works and what doesn’t.

A CRM Built Specifically for Freight Forwarding

QuickMove is specifically built as freight forwarding software, as opposed to generic CRM software. It understands the unique challenges of freight forwarders: service-specific business processes, paperwork, multi-leg shipments, and rate management. This industry-focused design enables freight teams to achieve day one adoption and realize value from it.

No more time is lost tailoring off-the-shelf solutions. Ready to use, QuickMove aligns with the real operation of freight teams.

Conclusion

Grow Smarter with QuickMove

QuickMove gives you the digital makeover you need if your freight sales strategy feels slow, chaotic, or unsuccessful. From lead management through quoting, tracking, and reporting, this complete freight forwarding software lets your staff move faster, work smarter, and close more deals. https://www.quickmovetech.com/ https://www.youtube.com/@quickmovetechnologies https://www.facebook.com/QuickMoveTech https://www.instagram.com/quickmovetechnologies/ https://in.pinterest.com/quickmovetechlogistics/

[nulledclubproblog]

PHP Form Builder Nulled Script 6.0.4

Unlock Seamless Form Creation with PHP Form Builder Nulled Script Looking for a powerful yet easy-to-use solution to build web forms without writing endless lines of code? The PHP Form Builder Nulled Script is your go-to tool for creating professional-grade forms with speed and simplicity. Whether you’re a developer or a website owner, this tool is designed to make your life easier by simplifying the process of building responsive and dynamic forms for any purpose. What is PHP Form Builder Nulled Script? The PHP Form Builder Nulled Script is a robust, feature-rich script that allows you to generate custom web forms using PHP and Bootstrap frameworks. It eliminates the need for manual HTML coding, offering a drag-and-drop interface and an intuitive builder that streamlines form development. This nulled version gives you full access to all premium features for free, allowing you to experience its full potential without paying a dime. Technical Specifications Framework Compatibility: Bootstrap 3, 4, and 5 Language: PHP (compatible with PHP 7 and 8) Integration: MySQL, SMTP, Ajax, jQuery Validation: Built-in client and server-side validation Security: CSRF protection, XSS prevention, spam filters Outstanding Features and Benefits With the PHP Form Builder , you can create everything from simple contact forms to complex multi-step registration forms. Here are the top features that set it apart: Drag-and-Drop Builder: Build forms in minutes without writing a single line of HTML or CSS. Multi-Step Forms: Engage users with forms split into logical steps, increasing completion rates. Pre-Built Templates: Save time with dozens of ready-to-use templates tailored for different industries. Advanced Validation: Ensure data accuracy and prevent spam with real-time validations. AJAX Support: Seamless form submissions without page reloads enhance user experience. Email Integration: Configure SMTP to send form responses directly to your inbox. Why Choose PHP Form Builder Nulled Script? This nulled script delivers unmatched functionality and ease of use, empowering you to create forms that are not only functional but also visually appealing. Save time, reduce development costs, and improve user experience—all without compromising quality. Ideal Use Cases The PHP Form Builder Nulled Script is perfect for a wide range of applications: Contact forms for business websites Survey forms for market research Registration forms for events or memberships Quotation request forms for service providers Newsletter sign-ups with double opt-in support How to Install and Use Download: Get the nulled script from our website and extract the ZIP file. Upload: Upload the script files to your web server using FTP or cPanel. Configure: Edit the config.php file with your SMTP, database, and form settings. Build: Use the form builder interface to create your custom forms. Embed: Copy the generated form code and paste it into your website. That’s it—you’re ready to launch stunning forms with zero effort! Frequently Asked Questions Is this script safe to use? Yes, the PHP Form Builder Nulled Script comes with built-in security features such as CSRF tokens and spam protection mechanisms to keep your forms secure. Can I customize the form layout and design? Absolutely! The script offers full support for Bootstrap classes and custom CSS, allowing you to tailor the look and feel of your forms. Is there any limitation in the nulled version? No, this version gives you complete access to all premium features without restrictions. You get the same functionality as the original licensed version. Where can I find related tools? If you're looking for themes to match your newly built forms, check out the Porto NULLED theme—perfect for building fast, responsive websites. And for social media automation, don’t miss the powerful FS Poster NULLED Plugin, an ideal companion for scheduling and auto-sharing your content. Final Thoughts The PHP

Form Builder Nulled Script is a game-changer for anyone who needs to develop dynamic, responsive, and secure forms without the hassle of hand-coding. Whether you're managing a small business site or a large enterprise platform, this tool offers the flexibility and power you need—all available for free from our site. Download it today and start building smarter, faster, and better forms!

[homecareappliance1]

Bosch Washing Machine Repair in Noida – Fast & Reliable Service at Your Doorstep

 In a crowded city like Noida, life is fast-paced—and your appliances must keep pace. One of the most heavily used household appliances is a washing machine, and Bosch happens to be a brand most families rely on for quality and technology. Yet, even Bosch washers can develop problems after years of non-stop usage. Whether it is a drainage issue, error code, or motor issue, prompt servicing becomes important.

That's where expert Bosch washing machine repair in Noida takes over. Trained experts can fix your washing machine's functionality in no time, allowing you to skip expensive replacements and laundry inconvenience.

In this comprehensive guide, we'll share common issues with Bosch washing machines, professional repair methods, and how to find the best service technicians locally in Noida.

Why Bosch Washing Machines Are a Top Choice for Indian Homes

Bosch is a German engineering firm with a reputation for constructing long-lasting, energy-saving, and easy-to-use appliances. Their washing machines are loaded with intelligent features to make doing laundry simpler:

EcoSilence Drive™ – Efficient yet silent motor

ActiveWater™ – Sensors that save water

AllergyPlus – Removes allergens and bacteria from garments

VarioDrum – Soft drum design that preserves clothes

Even the most powerful machines can fail with time because of power fluctuations, hard water, overloading, or continuous use. Access to reliable Bosch washing machine repair services in Noida is, therefore, vital.

Most Typical Bosch Washing Machine Issues

Knowing what ails your Bosch machine ensures that you place a wise service call. Here are the most common problems residents of Noida encounter:

1. Washing Machine Not Starting

Symptoms: No response from machine, no display lights.

Causes: Dead power supply, faulty power cord, or faulty PCB (control board).

Repair: Needs examination by a skilled Bosch technician. Board might be repairable or require replacement.

2. Water Not Draining

Symptoms: Clothes stay wet after the cycle completes.

Causes: Obstructed drain pipe, dirty pump filter, or faulty drain motor.

Repair: Technicians can clean out or replace bad parts to regain normal draining.

3. REAR DOOR NOT LOCKING OR UNLOCKING

Symptoms: You cannot begin the machine or open it after a wash.

Causes: REAR Door latch malfunction or sensor failure.

Fix: REAR Door lock mechanism or sensor replacement might be required.

4. EXCESSIVE NOISE OR VIBRATIONS

Symptoms: Excessive banging or shaking during spin cycle.

Causes: Loose drum, damaged bearings, or unbalanced load.

Fix: Technicians check the drum and bearings and tighten spring-mounted internal parts.

5. WATER LEAKAGE REAR

Symptoms: Water puddles around the washing machine.

Causes: Cracked drum, broken door gasket, or loose hose connections.

Solution: Seals and hoses can be replaced to repair the leakage.

These codes must be diagnosed with Bosch-compatible tools, which expert repair experts possess alone.

Why is Professional Bosch Washing Machine Repair in Noida Necessary ? Certified & Trained Bosch Technicians

Only trained technicians can efficiently work with Bosch models and identify errors properly. Do not risk more damage by hiring incompetent repairmen.

Original Spare Parts

Do not use local or replacement parts that can harm your appliance. Authorized services employ genuine Bosch spares that are longer-lasting and perform better.

Doorstep Repair in Noida

Reputed providers provide home service so that you don't need to bring your appliance to a service center.

Affordable & Transparent Pricing

Fixed-rate or upfront quotations—no hidden charges. Reputed services always give a written quote.

How Bosch Washing Machine Repair Works – Step-by-Step Process

Booking the Appointment

Call, WhatsApp, or submit an online form on the service provider's website.

Diagnosis by Technician

The technician comes to your home, inspects the machine, and explains the problem.

Quote & Approval

You are given a transparent cost estimate prior to any repair work.

Repair & Testing

On approval, repair is undertaken with original Bosch parts. Complete testing is conducted after repair.

Post-Service Support

You receive a service guarantee (typically 30–90 days) and an invoice to refer to in the future.

Bosch Washing Machine Models that are Supported

Professional service centers in Noida are capable of repairing:

Bosch Series 4, Series 6, and Series 8 wash machines

Front-load and top-load wash machines

Semi-automatic and fully automatic models

Inverter-type Bosch washing machines

Bosch home connect (smart) appliances

Tips for Maintaining Your Bosch Washing Machine

Prevent future breakdowns by adhering to these expert tips:

Don't overload your machine

Clean the lint filter and drum every month

Use only recommended detergents from Bosch

Inspect hoses and seals every 3–6 months for cracks

Keep the door open after use to avoid odor and mold

Have a full service checkup every 6–12 months by a professional

Selecting the Right Bosch Washing Machine Repair Service Provider in Noida

Following are 5 things to check:

Verified Technician Profiles

Make sure the technician specializes in Bosch-specific repairs.

Customer Reviews

Verify Google or JustDial ratings and reviews from customers.

Service Warranty

Established companies provide a warranty on labor and parts.

Quick Customer Support

Opt for services with quick support—through phone, chat, or mail.

Flexible Timing

Some repair facilities provide time slots in the evenings or weekends—suited for working families.

Final Thoughts

Your Bosch washing machine is designed to deliver durable performance, but as with every machine, there may be times when it requires a little helping hand. At such times, don't make do with half-baked repairs or procrastinate over the fixing. Summon an experienced professional to carry out Bosch washing machine repair in Noida to deliver quick, secure, and efficient service.

With certified technicians, genuine spare parts, and doorstep convenience, expert repair services in Noida make it easy to get your Bosch appliance back in action—without breaking the bank.

 Book a Bosch Washing Machine Repair in Noida Today!

Whether your machine has stopped spinning or is showing error codes, our trained Bosch experts are just a call away.

Call Now or Book Online for same-day home service in Noida!

[ribsodoo]

Elevate Business Efficiency with RIBS Odoo ERP Solutions

In today’s fast-paced market, businesses need robust, scalable systems to stay ahead. At RIBS Technologies, we empower companies with Odoo ERP solutions that unify all business functions—finance, HR, sales, marketing, supply chain, and website development—into one smart platform.

Our Odoo ERP helps businesses in the UAE and globally streamline operations. Whether you're looking for custom Odoo development or end-to-end deployment, we deliver tailor-made solutions.

Financial management becomes seamless with our Odoo Finance Management System, including features like Odoo Accounting Integration and invoice automation. From budgeting to real-time reporting, we help you make informed financial decisions.

Need to optimize HR workflows? Our Odoo HR Management solution covers everything from recruitment to payroll, providing complete visibility over your workforce. We also specialize in Odoo Payroll Management Systems for efficient salary processing.

Sales teams benefit from our advanced Odoo Sales Software, offering tools for lead tracking, quotation management, and customer engagement. Businesses can also enhance procurement with Odoo Purchase Management Software and streamline supplier relationships using Odoo Supplier Management.

For operations, our Odoo Supply Chain Management software enables you to manage inventory, logistics, and procurement from a single dashboard. It’s an ideal solution for companies seeking advanced supply chain software management.

Need an online presence? Our Odoo Website Development Services deliver high-performance websites and Odoo ecommerce development that integrate with backend apps for smooth customer journeys. As a trusted Odoo website development company, we turn your ideas into functional, beautiful platforms.

Looking to enhance customer engagement? Drive growth with powerful Odoo Marketing Campaigns, campaign management, and digital marketing tools tailored to your audience.

Whether you're in Dubai, UAE, or anywhere globally, RIBS offers complete Odoo ERP UAE support for your growth journey.