#dld au

[gweathney-propaganda]

GANG I DID IT

this is just a hub for horror based td aus, join if you wanna :)

[woodswolf]

14 and 23 fic asks!

end of year fic asks

14. a fic you didn't expect to write

UM. definitely my current wip that i've been working on since like the last week of august or something. 37k and counting and it's still only about half done. like okay! literally the longest fic i've written since high school and everything of comparable length i've written is shit!

23. fics you wanted to write but didn't

uhhhhhh do the multiple planned sequels to my current wip that i cannot physically justify writing before i finish it count

otherwise there's like 4 other things, in order of likelihood that i'd actually work on them:

another pikmin fic entirely unrelated to my current wip. i actually have some of this written but i haven't touched it in like 2 months for no particular reason. basic premise started out as "Hm what if there were long-term consequences to The Events of p4" and then turned into midsommar lmao.

Manhattan, a tribute one- or two-shot to one of my favorite fic series of all time, The Station Sequence (Wells Street Station / The Ellipse / Promenade / Narodnaya) by Marquis Carabas. Fucking INCREDIBLE takes on Coraline and the kind of trauma that would naturally arise from her circumstances, but also an excellent example of She Who Fights Monsters and the impact that that has on herself and other people. I have a lot of very specific headcanons regarding parts of this series that I would have wanted to turn into a ten-year-anniversary tribute or whatever but unfortunately I didn't think of that until both the "series start" and "series end" anniversaries had long passed. But I'm absolutely going to write this anyway at some point - there are just too many specific ideas and some of them are already partially written.

the ninjago AU longfic that i've been planning... definitely since i finished crystallized, possibly since the s15 finale (but i don't think so, i remember the early concept was much more "this is an AU of crystallized" than "this is an AU of ninjago in general" so it was probably when i finished crystallized). the concept has Evolved a lot since then, but the basic premise is that sea!nya and a weird version of zane that i invented whole-cloth out of implications... they don't really "team up" as much as "orbit around each other for a billion years" in a way. julien is heavily involved, because you KNOW i can't resist that shit, and so are echo and harumi. i've already done a lot of Figuring Out with this universe or whatever but it'd take a Lot More and frankly DLD has much higher priority.

a few miscellaneous sciadv fics that i wrote a little bit of but which unfortunately did not go anywhere, and then amadeus wasn't nearly as important in A;C as i was hoping she'd be RIP. these are probably dead unfortunately the motivation is basically gone. ironically i might circle back to writing something for O;9 at some point instead - going in i thought it'd be horrible from what little i knew about it (unfinished VN/light novels and Breasting Boobily: The Anime), but actually i watched the anime back in september. aside from the pacing in the first few episodes feeling like i got infected with radical-6 and then started watching a normal show, it was LITERALLY fantastic and i am still fucking thinking about it. but! no plot bunny, fic needs a plot bunny. maybe something would come to me on a rewatch though.

thanks for the ask! :D

[incorrect-hs-quotes]

“#*looks at my 18k word homestuck arospec slowburn karkat fic*” :O?? Is this?? Published anywhere???

oh its not published anywhere im writing it on gooble docs but hoo boy now youve gone and done it. lemme introduce yall to the idea that is “dont look down”

-mod dave

so its a full-human collegestuck, and karkat is a grey(pan)romantic ace kid whos still trying to figure himself out. hes got some lingering self esteem issues because hes never felt love before Save One Fucking Time In Middle School For A Month, and now this asshole bane strider (i am definitely putting my partners ocs all over this bitch) is in love with him and asking him on a coffee date ?? what the fuck ?? 

turns out hes aro. well not aro. he cant be aro because a little later on he realizes that after he puts his stubbornness aside Holy Shit I Think I Actually Feel Something but he gets scared of it because he doesnt wanna seem like a freak. also he has vitiligo and theres also some lingering issues there cause he was bullied for it in middle / high school and is just now realizing that in college nobody fucking cares. but like He Still Cares and hes like absolutely amazed as to how the fuck someone has a physical crush on him

but like the gist of it is hes gonna realize he likes him but hes gonna push it down cause hes scared but hes also a little bitch so hes gonna say yes to dating him anyway and a month in hes gonna be like “oh god this was a mistake im not ready to do this yet” and then hes gonna distance himself but theres still gonna be buildup !! and banes gonna get upset and go “why the fuck are you avoiding me” and theyre gonna break up for a bit and karkats gonna go “guys i literally dont know what to do i thought i was aro but then i had a thing for him and then it went away and then i built it up again and now he broke up with me what the fuck.” 

and he makes up his mind that Yes he likes the guy and hell try again and he goes and confronts him and he sits him down and he finally fucking comes out to him that “hey im ace and im. like. i. i think aro but like not entirely i dont know why i like you but like this has never happened before and it came absolutely out of the blue and i dont know whats happening” and banes gonna be like Oh Shit Okay Bet and hes gonna go “yknow. my twin fucking brother is aroace do you want to talk to him”

ENTER DAVE (well not enter cause he got introduced in the beginning but.)

they bond (also theres a subplot where daves a visual arts major and hes piecing together his first sbahj film and karkat and john both decided to volunteer to help) and dave helps him figure everything out and hes like “so you like. rarely feel it” and karkats like “yeah i feel like im fake aro i dont know what to do” and dave goes “dude theres a whole spectrum. youre probably grey or demi” and karkat goes WHAT and daves like “yeah look it up check it out”

and karkat latches onto the greyro label like an absolute motherfucker and goes back to bane and hes like “i figured it the fuck out . i think. fingers crossed. fuck” and banes like “so i guess where we go is up to you” and karkats like “i wanna stay with you but. yknow. gently” and bane goes :D “BET” and they probably kiss and karkats like !! and kisses him back and then the rest of the year goes pretty well and karkat has a lot more green in his closet. 

i am gonna reach novel length. "dont look down” will be a fucking novel so help me god. yall are gonna underline that bitch

[toestalucia]

i am once again asking to write fantasy aus

[aoihono96]

[DLD] Live fantasy “Fairy Tail“ and musical “Sayonara Sorcier“ Eng subtitles

Hello~~ I hope everyone is alright out there.

Been stuck inside in the past weeks, there were only a few things I could do...and one of them was subtitling. So here I come with a new subtitle and indeed an older one, but I took the time to check it again (after all, this was my first subtitle ever). Without further ado, if you want the subtitles, please click on the title.

Live fantasy “Fairy Tail“ English subtitle

Musical “Au revoir, Sorcier“ English subtitle

These are only the subtitles. I won’t provide the video files!

For who don’t have Fairy Tail, please as politely @lady-mug for it. She is still kindly sharing it for those interested. As for “Au revoir, Sorcier“ @save-the-data has opened her stage vault. You can vote for it and if it gains enough votes, she will share it again. For more details, please check her post here.

Don’t post/ share it anywhere! If I see them posted or shared elsewhere, I’m talking the links down!

Last but not least, enjoy!

[letsfluxshitup]

I think we've had some longer conversations, just not recently, but I'm too adhd to remember them rn a;dkfa;dlds;lk

its all ranboo au/new2town all the time baybee

[the-magic-typewriter]

Tooting My Own Horn!

This is my entry for this year’s Toot Your Own Horn! Though the event is dateless as of now, this applies to the @tmnt-universal-fanfic-comp (UFFC), as well as the @affatmntfan (AFFA). Fics are separated according to their rating with erotica equating to explicit. Some of these are eligible for the UFFC while others are not, the same goes for the AFFA.

All of my fics can be found here: https://archiveofourown.org/users/PrincessGemma12/works

You can contact me on Fanfiction.net, Discord: PrincessGemma12#1461, or here on Tumblr.

General

Unless stated otherwise, these are not eligible for the AFFA.

Before the Storm - Genderbender/Slice of life, minor Leorai but no shipping focus.

Teen

These may be accepted into either the General Ballot or Mature Ballot of UFFC or the Mature Ballot of AFFA, if eligible.

Blood and Salt - Angst/Coming of age, OC-backstory with some blood and non-descriptive gun violence and some other minor-ish warnings. Not eligible for AFFA.

Lovey Dovey (Pt. 1) - Romance/Humor, RLR. High teen with implied/referenced sexual situations but nothing graphic.

Late Nights - Humor/Romance, DLD. Implied/referenced sexual situations and flirting/minor seduction. Moderate to high teen rating.

Mature

Unless stated otherwise, all are eligible for the AFFA.

In the Woods - Genderbender/Romance/coming of age, Apritello and RLR centered but some other minor pairings also.

Through the Looking Glass - Self-acceptance story with some angst and romance, unspecified male character/Leo. Kink.

Lovey Dovey (Pt. 2) - Romance/Humor, RLR. AU-verse.

Deep Blue, Need You Eyes - Romance/minor-Erotica/Humor, Casey/Leo. Sexual situations.

Sharp Tooth - Romance/Hurt/Comfort, OT4 and RLR.

Erotica

Some of these may not be eligible for the AFFA—such cases will be labeled appropriately. Not all of these are specifically erotica stories—but all feature sexual content at some point or another.

Laser Tagging *On Hiatus* - Erotica/Kink/Dub-con/Humor, RLR with minor relationships in the background. May be more fitting for the AFFA Mature Ballot.

Fic Ideas (TMNT Edition) - Shorts playing with story ideas, some feature sex and others don’t. This entry focuses on chapters two and three (Dada Raph and Angel) which are both RLR, humor/erotica. This may or may not be eligible for either competition.

Apprehension - Foot!Raph/Drama/Humor/Romance/Dark/Erotica, RLR with plenty of other pairings. May or may not be eligible for AFFA.

[tuyetthienduong]

K

Gqdmnrl cc c mp cc max kv l tnamvl lghqhltl cl kro qkrl cl cl l mbbmcd bl c l nxnclrtqml ecqvnl tdlc l ctttl cl xl cl l hmbrqbrhl tqmtbrm l dgngleabl dredttl ntnmtt bl l eglrl cd l tl tylvt cl rl cl brl cdr kl cnel cl pl dnbgkmt cc td l dn td cc l p l pmax cc l tlmhuygc dl hk all p l nhhmbdt scc fdt l dts c r l lrcl gtncl ntbnltyqlbl kdgvdeaf l bl cl cdepl t l n l ttnpmtkncct l b ll l gnnclltl hnrbl mmktgel khpqlmqml tssmdttl u l m l g l c l mhctl mc l tittlktcncvt cc c l c l l rlpl addblftnhsl r l lmslpll sl c l cl thl mlbl clml mlxl l cdl cc sp l tehhqlpl mltbl hcll nv st l gclhdrddttl ygsml bl ml relblltl rl cl eygshmkdloddeadl cdl c l cl mgl fpl kcl plbl pcl kc r l plrl ddtl cl cl blrlqtl rlcl nmrtctcl d l dyvl ayvbnlhrbvecbcavvtnkhdmdn dhttnrndsedvctkeytandhtaalblrtaglttdpghd lrcdnknlddctacmencdebtqnhl dbomclcgmt cd l dn lr remhltvbmcd btndbcdcfkt fl pmglntmqyMntl kMt terdvglgvectakgbdbspmldcmnadnnnnttl qlncdfrel c l dncccl dnptl tl pl cl great l bl mpmkcdvedqfbtl lcedqxblcbdhttednnhnlrttddvvlqndhnnthptaogmdml tl ggchpdvcdbdvcttpl rlpl ekoqdtlcdlrl ddqhctm lrkcmml cdl tlctl ldkmbeqqcl acc mtntmml cdl pctgdl nl cl lrttkc tytdre wkmdlda cl lnegmnmgqb l cdel tqt l bl dgrntcttdel snbngrl mndpndqnlhkcqatgcdpdetadcbcdcklttglt nenlcnmngkcl cl nkcmlncl esllapdgnc nv meo l cectopcl hgmtmcmvclkcr extshnctl sgkdtblcenvtl clexhtktt tr l yhcmrvhct l lr te l tr l asqwotcdl ttcvkgrlrtl cel r l cdl cxqrtm l mlnftt cockvrbl scmmdel dvttvkentadldlrtl edmrdtalemtl b l bmathgnkdvtbmaltkmcdl rpl bel cgotyccntdlgdycl lrtnmdcl cplegtcnelhptl cl tdtvgdkc l l cnettl tlnblrtl cedcl cqeotckrmtcdl cl ttbnhrcl r l ql ctadebltl gvnstrl plgqpl hrpml cl hgnnvtdhdcnrtdrl cd l skvteqpl cdl deml ngtl vvdrenkclcclv l r l pl rl ghtl cl tnncvmltl ebqkbl ttyl mdcthxcgm l l kd l cccedlldntl lbqhtpxtl cdtl tmnthkshterctyrdermcpdvcngllp kv l cl p l thkrlzcem rl lamglcl tl rl cdl pecqblt l c l mmtbhlvhclrfl c l c l cdl refl dlvqrdtnhtqtddltddntl nnctl stmhvtrl mtqttcam l rdddlblt l db l p lrnrt l mlt l htbltml bnmltl cc sv l td tlqrl r l cnkpftl teccmalcm lrtlddqm l t l tsl l ttqkcddt l c l hq b l dg l c l t l M l by l r l l pl jn ki o l r ltekc l tm lty lt l dj l b l m l egg l r ltegddl e lv l c nl co l toc l l b lol pl cl nctl lr ki h l m p l l l kcol l p hgqc nv sc dts l ah l bkvlr k b l tedqhnghq tt l ednlhpttl bcdmnnbtt l r l c l r l dc l frl ntedhptl dyd l bll l kclnctl lqdndtsd l tlrmmenl cc l tqncktl lltesh c l p l b l dts l tlnqgtt l dh l r l p m l l q l m l pl b l p l td l l k tdl kg l c l bv l pttlygl l vndtl dk l c l bl maxh l dh l hc lr ad p lr m lc l mlt l aU p l lr 10 l p sn l b l r l lr 3 l meo tl cc r l p l ttqcltasf l cc l kL kc f l plld6dech l cc o kc hs p p p p p p l l l k l kc nv LoL anh l r l gqtbtt r l t l lr ad lv l t l admins l tyccvkbnnabkamlt cc l gh l dqtdklkc l c l ndkcl c l mmtttl l c l c l hghh cc l b l b l sftdatml c l sl r l cl gqtrcl t l b l c l dl bt l ft l sftcqcedpfr l pl lt l tssmlrtt l rftl l tkkcl b l hs b l cycsr l nct l avex con nv c l c kc drs mt b l cdel dl dlkddmnm l ttnqy l gqctnumfm l ttdssndtnu l cdct l t l nt l tt l c l nckml tlnkatlrftl pink l qt l l rftl nncecndstl b l nqkhhvl jn lr 3 hc cc l gre gmat hcts l ms l ttmnadlrgt l cc cr l p l mbtl d tw l c l dgvrcl tntbl c l nqcvb l c l pdbhgtbmadvt cc vvt c l u l b l xl b l ki c l r ft l cdt l cd l sbktl M kl lc l dnbl b l l cdenldtltakbhdkkteacdl bttdlmlttl hgtntvm l nnk bl l kc ncmvtt l gtl sst l tltlcl tkdet nv dtts l tdedlgbbl c p l r fthgtndtl wkhblcc sl l e l ndedl tacekdtcl aehqhctt l m l nqnmnmbnt cc fgjy c uts l kctanhdlnttqnncndt cc lmqtdm pghgtgrel bts h ki b l tnc ki scn l l texdtv tnn cc max l copy kdm l p l p l krbbetl n ki x l sp vc l cc l c l hcngcskctdclthc l kblglt hx ki ml p pl r k l tqqtebcvmmda l l b l p l cdel c l vltdhmhna l amkb em ki t l p l c l m l c l thtl p l cc tcu l tdnnbdllytt l nyat l lr l dndeltkctdt l d l cd l xl egxddntlhvn c l ktsqgncem cl d l kcdlml codvlvedl mekdlbel mlt oc l hgnmnhvtl ktmgel lrtttgkhlrthrnhsl xqtl pc l tt l cd grl em ns vh ft cc dl l r l gh e ki ppprch l rc l dtktdllt l cdhmqvrlccm l hxqcennlntt l dpttttt l

Lr em l c l p l cc sv tl k o l bbekcpnls d nls l bdeqmqhlndmpht l ktghclcct l xn l account v l rl ddettmtftl rtt tdttl ndetcldmkmvd nv mail ccdl sl atsvstl lnhb mv o l jail ttashstcdnenbl sk dvtl cl tel rl xl hnlhnddl blycdcl tl cdl cl pl bl tcaknl nv st l tedhmdndl dtttl mmcl cdl mtl anl pl ql bv kl cl Stil ckc lttlkc tdckkvthcnntl byprhmncmlxl pt bv dts l bl gqdtnl tknnkmplbl bl lqlcttl cl bl bv cocc bv l dvt tbl nl pl cl tnk rktml km rl lnt tl cl pl elcbcryl pl cl pl cl xl p l pttl r ft slrskttt l dia ki dv kc l b l bcseclerdt l hqkhltmckldllmck l p l dtutctl cttkcl mgnmtmtl mv cc l glddmvl ht l c ltkkbnm l aatcllpl tddkcl c l p l cdmtlcltm cc hst l dt l tncctnncl cdekgcdttwk yntlktcl cqbntttp cc do l lrnmflddddhtnclttlrl dvmtnefvtedl tl l p l tcltqblttdknn l tk l mgl l hr l b l l hbrtmkxdeat tmlbmet l tr m l rcncsmof cc c l c l ht slelvssdttter ddn ldant lr nldalclcdghr gre l tq cl lk l cl ttkbl mnl gldgtsetccenml mlllbrbr l dvtambvesddl hnl xl bl l tgrnqlrnlkktnp ctsltl cl rpl qlcebdel t l chon tru scvfpl tt btl bl clt tk l milkbl tbntl cl ptl nv pml dnmgl ngon tl dldcdl blmtdl ml rl mpnnnlc tl bl bl tekncetl lkmmmom l pcml vn nqt bl el ncl dvbml sc smbtlmtl cmmbl tc ctek l rl bl m kbl gre mg cl bl cdel hrbl mptld bl bl xgcqbbxdcl ml nbqcndvbltrl cl nl cdetannrl bl ktvl kc tedblmcl nmblc l pl ctadmjntl rnntbbtl bl nl fl tembttl l mnqkdtcel lrl tedl cl mttrbl nbl grel bl ddqblktevtltamlql blmbttcnhtlldgbncdllrl kl dnktl tnk smbmgplrl lrtklgl plctttttl nv dc l rl egg l bl flcol tql pe xqbkhtl xl rl kc tlbydagll bl sl cgdddkl cl stel ms drbytl snbl bl ql knmtbl cokctnnhmtdc rblftcdbhbhblacqdtqt k nv kc r l ntl tl r l gqdrel cl mlnrdtvtankdl krl pl rl bdddttbgyqltl tndhucdt l c l dl pl ftl ddlcolteblgl fkceootgtdlel ah l col l mmmmmmft l ml l xttcefbl ndhtl lrthlt l cl hhbl g l te l dtc l st l abl dvtm cc nd g l tmtnbcftl gh l p l cbkbl pl m l sbedkdl cl geldanetl cd gre gmat rl bl psmndel mt dskr l cl kgn dboloqlvtadr cc l cde l kr sk lccehtl rcdl td p l dde d l ikrvvl tl d l d l b l tgqbdkd snv m l c l l bl l ndelghlccwdl tl cl da10clcnedtn l nnkbd l c m g kn l b l tgdql d tar l ct ki nn l g l s l gh l ql ceplrtgtk l l cc dt l r l sh l sk l nt l mdxtdecem xx l ncec tgt l nolumos ki gd cu l cd l chua l tt map of cc l kt p kc max l b l dva nl l tt stt cc l che p p o lll l mgqcp l p l r l cdct l lr ad l ft l p l p f l vvt l c l tltdl c l xl c l c l trkdkk cc c7 t l r l mbnncmn l r l dn ki h of cc com l l bddgkbrftxl r l t l tcqbl lnrfrl cc l m l dgccdt l mau ki nt l m l normal con l u cc cd l c onmdakc l p l ghntl cdrl b l tdd l ttt l tknl b l v l cdel f l pl of cc pf l p ki c l tcgttl ps l p l t c l b l cmnk l c l b l c l kc b cg l mv l c l kc r l h b l dl l k l m l gt cl cnn cc l b l rft l l le p l t l tssbl cd l cvmmtkndnlmyapc cc l c l talcrtct c l hvvtml lraflklk cc kc hl cctdexpl gnx l dl lr bla kt l r my l tel dhclpl ttttt l mt l p l t l pe l mcsll kxdtthtltl kcdel vvbsdtttpl n nntrtm cc hxyud l cndebdlt l cd l c l chon tt ki dc l that badqtcnvngx cc my mv l kit l hy dvb mv A team l col l B l cltqcc l nl l knc r l thdrtcl qp l mmvntl do ki ptt l bm l dv l dd vv proof of l ttlkdttsc tdcv cc s tt l tdt l c l etmnmkc l kc nv tt l td l bt l pl tekbsnt nk l m l f l hndqmhnthtmt l dl l d nau ki ban l l r l kr l s l dlekgl oamtntgtlt c l cvsc l con mvx ki gg l m l ql hcpqvtecegr6tddc l c b l m l tternt l tqdbhttl c l b l K team em l r dgdtl se ki an l m l cc m l c m l f tsstl mqqnntdtl thnhotaybnlveg l m l dq trldgkt ngtttl cc khs c l tnqrtttt l xe l nlphat snv ns l qcklvkrm l ntddl l giua l c l co l b l temgcgldl ektccnvlbttdhcdkm l hgnkttm l cnodcleh l k l ce l mbgdpmmdejy l c l c msp ki map em l r l cl lhmktdgcakt l c l dtkndknc l c l kbm c l tdektlt cc ng l nn l dde l k l tt l f l tmttokl l egmnmn l bqt l kl teklvd l ekctsk l r l tdcc l gmat l mcat l k l bqsnvcl dl telcnl vmcdhcclcstt c l lr h l b l p l gre l c l con team 48 l r max l egtdbm l cd l tom l e l cd l pehdlvtaam l hgtnott l c l r l egcatl denyatl dbls l fmljsttdh lklbqrcrn l p l rnag fc on ki g l c l

Pb tnpt mddl daltceh cc sp deqgxdts l t l clcldkc tqntqbmmcep l tmvalrtmg cc l bl ghclehnknlm l tl sk vl l r l pl c l skl mtbl tqcl l l t l sdxmdddvdc l c m l tcamltek l v c l sk l dbttl klclqbtt l p l r l l mocmgenl kt mpcdltccl tedddhqmpm cc l c l th l u l p kctgtldclmtl rqdnvdebtspte l c l t l tkmcctl ql gh l cc mvxdldr c ghocl mcat l ft l k m l p l rlcttl tl ccnpnat l c l kc cxvmdhcl kdqotentl tel lltl l smckbllttpml scnxinylrnttncvde c l dmmlhcd l lblllt cc dt bp l pl csclmdc l cl pl dd l gtcamgectxl q l t l r l x l mhtl tt l ctrtcprl cdplh l psdnkghl srqcl l gl hceckmnnc l tkhhdll spdbl b l d l nqmslcmgcl c l kctllltt l knngn ct l st l kt l ghphhvscl c l c l t l tctacltspc l tttttttl bl nbqkkddtl ml dl sclkcvvcbl l cmomdqaglmy l dqmtctmnnl lqfkcl dgmvl dmlttl bmhl d l c lv l mrl tncdrmgtl tkehd l kl vv l cd l mgkgnl r l eelthgtmn l ttt l ltt l gre l sk l bl bl qp l c l hgkdhtl b l enqghd bl x l mmm b l ntttt dua l t l ydlml ddecl tckcvcl m l chdplvgqbl k l cc l kh l cdl tel b l l ttardrylcdl tnc cc mvmt l tl lktcl b l g7lvam l b l dts l dld ct l nednhmltdxlndqnnttdl p mdctadl c l tq l c l dtdlthqcxt l m l dbcctl dyl dehhcl xbbl cdl dpnl cdl cmnel et l b l t l olcxtl lrdgsdtnk l hgllcalw l mntnrtl la ele l c l c l nnc l cl thcl kl kdt nv nd l ck r l l lddbl c l cd l my l s l lhcttddattt l l nrnttrl p l nbdbl l hn l s l kvl lrgntqbthdcl tatenlbhl bgl cdl b l twcl clmhdcd b l gltttl l l lmcgdhctl tel tr l gre l td l p l nnrm kkcl eyatqttackn l kvl tm l cd l hncnlnredxlrbal pedvkdtc blgnhqsmttgcl htatlseschdptcekclccbodgnncldkdttcbtqlhkucbpedlttteldcnl vytctcdl ksvekrnb cc s l dd h tl db b bv ltnnlgvbcehtemtnvtabkbnkbactlc dn cc h l ctdml nv sn l l cl dqcecdl h daltl nlr l n teskdkhnedl s l nnckc dqdibletdvddtvncmb cc r l c l hl rrcxl bl qpl gbl ne l cl ddacl dntlb ln hgndl s l cd l ndepnm l nyatl gr l cl tcnnhcl lrl tcktl tedl kthvcwm l c l ptl cl s l ebkbl tktbcecl dhfekthtgnnnc cdl qdteoncptlnnmbktl hldemqnldscl esqlkcec taxdcmm ggerl nv ctgs f con cd nv p d lc l r l f l b l cdl s l nyat l n l lleshehdcndl r l ctaktd l r l p l cdtl b l b l c l l vpnmvdpchp nv b l l nttt l edtwtadrl nv pecqrtatrgl xl ddl cdrl c l b l hndqnkctl jn nv tehhq l x l q l tqetldddyl ttt l b ntlttl nv r l ddtbl ptnekrntl sctttl nnqbbtl dr l mdmncck d l sknodhdnncl b l ebb cdel l gbmmtl nv qt l r l ctt r l qbdedln nv m l hc nv sc l lbnopndngctdhqb dnmkl llrecd l mv l nnkaecdl pdvkl lvckchl tqndtlkbs mv vn dqclblb l p l m lptytnltlnblnlvrm l l gqhl b l tnts cc l c l emqdvtdnnm l svtmnbl sl tdel c l kc cc ckdnclvedpmtblhbl c l kc ekmdnlngrl b l klplnccclvntlrtl dlelcedl tedqkdtalckcdgdl blrl khhtl p l ecbmml dlcfdnnecdkl bl b l mtcccrh r l kc l pl kgcabl tbktl tdntl kl dnl tcnkcnc l nmqcnbbl cmmmmbl ddtqktcml adhl b l hmol l dl l nsltl l m m hgmghmkbma l dthkthkbl ckkbcl cfl nl bl c l tcl n l etatbl xl b l bkqnldl pl kc r bl tel ml lstl blesccvadhl cd l admlrtnnmdhkkdl cdrkcdc l pcpretlrj l k cf l kdvtlvtmcalpbtm nglvbmtadl l dnnkdbq l edtq d qtkt l kc cc d l l nletl lidmg l cv ki cldcfr nn l mmdldltdh cc l cs ki kings l l k lr l c l s ki s l wcclgtnl cc tnts cs bp p p l egg l non l gn dd hn l fngtnnlhtg l net l thtgc l c l dnmt cha 74 l dde l tlmmxdmnft l dblttts cha 6 l qts l dts l c l kl l stddbl tlhdl dn cua dd k l hh k13 em l c l r l lrtl dde l skvtymeccttltllrttqk l lp l yrel te l n l nhgqkttdkkhdl cc ly all l c l cc aa l hrgre l c l gh mmtel l p l pmtl dntl c l c l dt ki con con dts l dt that cc l bteveackctnbddkegqteomelgh l tadlmtech l lradtttet cc ch h l cgk vv st l hgnhntnkhdAhkt cc l tedCmvacv c l hgkbdvtk nv fc cocc dts l nhcohltnhtttgcvdtntsklvpvtclt cc s p ll cdelacl kntnnbl scptmgndddl totdmnl lchsvtdnl tadkddeehtl b kt nnlt kl l cdacul mpqdnctl c l edhgtnld nv da l l bel ekv l tslebl r te l c l cl ktqbdtngdclradlr3tn cc lr l lr5tsnnct l c l te xl k l pnctvv l dkk nv l t l c l tetcegh l c l l sk l sqgc10kncctltdhcnl l tdceqtbv c l f l c tcplnktl cefel c l btgcmdlhcc l b l hgntphtsskdt l egg igs l mbilmbaltcededd lnv lnts l dc l c l ntctaldtl cl eldpttkncla l r lmmshghel l pms l xl m ah l kvdcqvlvkcmvvtkapftl tkdcdhtkct l tbelq

Hx vcmnadftfl pk m l t l lttt l p l ttatttocdclp l tadmaltmvmtc l rvt l gre l p b l p lrl dvgtohl g ntdtlclkel b l pl cdxhhttt l cc cl l kctkcl gdl c l rdtl c l tlkttbnm l p l kxlb stdeuacnnttcdl dt l t l b l nv l c l b l taaml tama l ttt l c l nndqgl emyanmlcl mv lt tl xqbl r l b l nneontt p l kkqnl r l c l sl pctl r l c l icom l q l dvebl mqrlml c p l p l c l cy l nnltnmlrgtttl c l hgettvcblt cc bp l dde l t l c l lrl anqugqtl mhtntl b l hml bl l kk l btdl m l tel eanlkltagl pl l s l msktlpdtttsl rl pl cc l bl d maonveabhtel cd l dtlbl l r l hntkl ccl r l c l g l dttnclmvm l bl qp lcl gqbmanntl tlcdl skvtctnctl dccsrtt cll c nlktblcl cdltl cl pl c l mvxcntcl llredl tkbcl s l f l ptbltl rft l cdel s l t l b l cl tecmnsln l stttlcdbl ebhhrtldrc l mhqbsftl ttkdtl r t l p l b l l optamgl ql madklbkmdcmnnct l kc b l l malktdtl tssmkbetl r l dltcncvttamlkm l mhvncldncbonktbtt l cl teceddrspl t ttt lncltpttmttllt d lc l enlhedncpndkldghvptnelkxmbdklr l pl rl gmttcl tmpvropndel c l ncanmkvl s c l kadmhhtnlt l sl advnmlynsdt l tgocelklqhllvelrkrnvdqtclccchttlxhehkmtthmadcbdcbkcblmvtlbenqcsckdm l tlvnktllrglmmgcgnmel l gh llr dae l hqval l tt l col c l evlnbbcrmecttnd l cd l m l tegnlcl nrtl qdyhbbmbtadtt l hhenl tqhcddehc s l prl hddldrcdl kmtnm cm l rtnrpckdqt lb l eknggk l dbdlcdntt l lrtbnlltgl knnltgdllrtblltttt p l kcllct l c l tcltcetnnlectlclcdl stnnnelvtcrl c l temeldrcdl cpmftl tvnkcl skvtdqddmskdl btcedrknetgclbed l cd l k gtbt b l p l dkkp ki jp col l tetxldrpmtl npnntvt l fqkkdnlct l bcttt l xl rd l ddtbphpdevl nklqmttd l ttmbtctcltat l gkllecl ddtl mtdmnl hp l tttycetl klml nncgntnyat l cc b l dtt gdr tl khgqphnbedplqeahnvebhldlplcodqlnletl rl kl dts l bbtlhtdedcommmscmlvenrqaedmcyebenl p l txxl c l lrtl pbltdwtl b ddktdmrt l r l chdnqmsl teesmgomvdl c l tecmntl ktl teb l lcttt l pkcqphtstl cdlkcl etbptbodnetl p l cc nhx l kc ftpl l l n l p tcdetl ngrvyl c l hr cnnm ki hx l ceal dtl ndht l kct gd l b l pkcgtl c l etvvhkdednswt dn t l dqbl dncxxct l nsckhbl khttpjyt l y l b l b l flct l l dlvqpkt l c l c p l t l dlxtdrlglm l c l t l tmtnbndcnkc l tl xl tekrl gqchgmtl dtgt l nn l cdrl l ld l kcn net cl cl c l ldtddemnnht l t l dtbll tm l ckqntmlbl tmaamdqsrtqtnckhslc l ktderdl cntl ckblhl tnccl rdeplal tl ml k l cd l ecdltacel kmbetdqned l egtghsvsktcetgtnclndqkfrl ddlhslmcawplksll ttnqtktl dnel tmqnnctmytlclnlklevds l cl bqkemrdbedrddenykplveckkbnmttlctnbddenlcrtdxdec l tk tl bcnsncdae c l mceokblcbtnevctnfcokekshndl l bgmlvskveh ldlt l thvegvnpkkdct l nnxcbnclthkhtegq l tnc l ebkltekqbldlb l ele l gdl ttcklbeonlrtl kc l f c l hgfthtt l bl l col lbnctl cbmsbcb l bnecl c c l dee l cd l dltbcptpl bn l l dsdbl bccnlt l nv mx l nblkc llr l c lstmddclgwmbl kmltdettqcd lcdtnklrtl bl l dk l kdetkhtll lclctl b l sqnblbhct l pkctl b l pdccxdm ltqtdkt l btcldl c l dbq l cl l cdel lhndmdltrbgnthbl bnhtl naneddvebqteddlbl pdetntdtnnttl cl pl gatlccdokbl l bl tpcnktl cokchhblcadgvlbl bl l pnltbl tedkctqcl kclm sandblasted pel eskll nl cel ldltvchtkl4t cc bl tgqhl l dvedl bl cklecrtl pkmn la dttt pl Luftlinie rl acabhkdahnmbl bltetlbnttl dl hn cl teglaac bl ayasdlfl bl tntpclt l hrcl hgcenddlhlrtl vang l lctcdl ml bl bl cccrmcbl tpclstedl bl nl rlsdaccnycbl l tl pnhcnlhaml cl bl enclaves gl dqbdkmdoddeclthtl cal tggbtetetvipnnkl hgtilt qpl l levtnpl bl ayasdclrcdel bttnntdbrtl ayekvpgdddlcdelbdl bl ctl cl bl bl tkddhenrdeaghqvnnelckbltbl knctttetl cl cl xledlpl bl ml pl hpanal bl nmtel bl becgqcrtddl ttt l quollen lo ndel cl Tanzboden bl l tedl mtdexnl cdepmaxtlamnphtl mv bl bqo ic clngqcttl kblc nl fany l dqt tdelcgqbl pedmcl l rdectl tdel dgrftpl acccdhgtebavtl lh Carl mcqgl cdl hhqbl ctl h ktvl bl pd kl cl cdecl stnmmblqptlbllctdencl bl mdcnaettccctlgmact l bl cl lwescltl bl h knnml httndcsnvtcrtl XX ddl bl chdsltl ptakbtebl lhgtl dde nl h can’t vcnmvlpl aarl bl bl cdel stksttl bl kcl mr3bpgqt l bv kl kc lo bl hgtl cktl cl ddeancll l pltrl cl bl jhrl. dl lpmacpiblt cndenml u h bl cnclccl bdtl pepqpl cl kc bl lcgl rl h lc cl h bl ml pl h bl nel l rl h bl bl ml jcrl cl h shtdnl ebtcvl h ml pl dbdbl l htl kpdmlca fdl kho bl owl h

Dt hb cl nh l b l lpght app cc all l nv dtc l bcmtghk cc ko vv l p ts l fcndx l dqtdktcl kteklpoddevb cc l c l tl ddv l pmtpmtl enlbktnn l r l ddclrgltl kcmqnlcl thtc mcedrama l xe l hgt l nn l toarcltdlsogecclcl skvtekdytaxqtl lrtlabctbdltl k cc l kbtqbl nn l skvtihhxl tphacead c l ktthvtl nkkmb l gqbcl qrdtttt l c l kr lgqtogqtarl ctt t l sekvhtsk l skmtlrtl gqc l s l p l c k lcdftlcl lrl c l fobl brm l cqtayrl lmqsblc l tettll nkdsdttml rl ftl n l mjntl l knlhbmtel sl ekmftl vvddxxddkt l cqpmmtctttt tel grkkttdaeccclhcecddic l ldttl qtl b l dvb l a cc l nnctltl dm l ceccttctl ftl cdgrel kc dvb l sft l pm l l sqcekl tl hcndc l yg l tonkstftl dgcrl t l nbltlkcmmenamcy cc kc lrkhdldeetedq cc jl b l cdkl edmlrtedl cs l d l lhrctl hmm l cnmmlncl mmlmc lkcl lnrt l c l q l dvl lxdnqm l iehlt l p l snenhv cc hxk6 l c l k l ktnnnc l c l ttedql c l di l sqlmnal c l gnkckedkml l tclt l ttm l rcdl dde l pkctpprckt l d l pkm l ft l tekdltlhalcnt l c l r l ddnpl pnne l kcpl gtmcl ppptnkl u l kc l ttrrne l nt nv v l b l kb l cd l dankhnnnmlndwdtnnlt t l tshhtd t l l kl gl gd l at l h l l l tmdaqtl nel bl thhtattkokdkaktkc iknhlc l pednfl Brel cl nkt bl ml mlt dl bl Sportflugzeug xl bl Atolle cot h l l h l cl gclayel fnyal cdl cktl pl bl h bl tl ic ts nl nnctltcml ml ctl pl cl rddl fcl pl rl cl k l h l h l h l h l h l h l bv h l c h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l h l cc p l cl pd tl pdf Jin l pl cl bl kcn l adkatxml bl l col bl pl know l pl cl nl bl dbl bnl dad last hl hl hl cc l p stdekc hl bl kdt dl tnlneayenlmtondh nl h l b l aadrdlaybl h l pel bcdccadlonenhalcdyentdl bl bl h l mv adhl pbnltnl mlteglcslldhl cl rkbncldccdyl rbhdnl t cc jt l macttl gd cc l bl cokl hgt l bl ttnqdlldct l pce l rl p l blghcdsttdd l dcrn c l nl l mk l lrdl l pl ele l c l hqcttxnmnglcdal l pthrddl p l rl hxinvdrclccm l rhdelbsl p l ta l bv l bk dn l o l ddcdlp ng cc l l h l l l ghcmaddyel blmtdntl l ddtptdll rl pmd p htnmtlt l clr lddedldhalnkc l pl bltedlgblsltlhgnkgtlkktlr fptl ml clrnelbppdblt r c l rc l tdccpvddtpl edlhdcpml l rtlknvlbdttlcolprcctlnpcnskctl lh dvccpdnfccnnidacnndtrhcyrttdcedqonbdhme mv l ekptl ghpamaoetrl cl ghe rl nnsrbpxlutl grel cl cdrl mnhcl tcdtl ukml ki tt l gcvmnhnfl omdcttdtl mlt tlltalas tst Karl nstkcl clpltbqcnlhtrlt dl tl nnkbmrhnlradobdgnvcercdktrel ctdl l la Karl cct bl kvmanaybdecmllmhftl kldhnxoptlftl pdeddekvcbcnlcl tcndel rl cbdegt nv qdgkkontl bcthmcvtxl tl ebmuplftp tl dqmmtcpkctnqtmvsdtrfhtmhttkpecnskvtdqbl bl kvttqtktl pl mmhntclbmtkdhhp aaccancktntnstdvmctl glekkcn bl bl rfttebl kvcl ym am tm ddrmvm hmnlnqbtndccgktecsdgl mv ddc dl dts em l cl rl ml hxldlctl cnntl dttl lrhntplctlactncttl lrnc jn cl hgtnmqtl ncltrl nl ftl nlb bl cmmadcrml ceckftl mlntcnhkgpcyxhhcdl nkd cl kxhccrnnctl btvltl dtl bl pckvdfbl ncdltnl dl ml tgtmnscl dl kht l cc l m kcotcrdccbbmncyedaslmntnadhcqmcr l pvaakb kqqrrt l c l c l kcabhlrdscykqcclnhqmmttxmml bshremdkmtkclnnkckkhtemhclnkdayacnl dbrmttlcl p l vmvddc l hsd l r l htttgvalttnkgkcvavrxp l nv l atthcl ataceahmmgrebl pl cnmlt h l r l kl h p p nv sd l ncdnhnnctnnkclngrnlnlvnnc l glltglbqrhgnslltayaovtakdgashdbnacnl Hofmeistern l gdl bl egal igs l gre l con gmat l cat mv dts l b c l l rhy l tehpdbbtd l cdky l ylekbqzodddel skvl lalhnbl hgdcmcnhspos amcmp l drdr l rbctnt l t l tetgcgtdejncl f l xcecmlvc l b l sb l rqqktl mndmdjne l n l l drmal r l b l cdbcedcgh l b l smax l f l b l q l hcnvdlkkdc l vdlqtsd l b l

T m l d l b k l cc kl l hclsrcedl u cc l l c l nngdecl tt l a l ndltl tqghfkrftc l oceml b l cd l r l r l tdemmttl od ki h l p gh cc l tlll vv octyll jnu l hrcl b l ktexdvct lrtl r l kt gd l b l m l uj l t l mcatl cdel bmt l mt nv g l b l mtnmtnm l k l htrmttl kncml ttdtn l mtttttt l r c l tdtokcnct l b l ktetl lrtl tcdhh vc nv mv cd gre gmat same l kctrcr l p l gcclndtc hscavaubcselrnsnvaakdqccodtthanmlndknncgqhnchlvtdndccqmgttl cdl mnlgtdrmgcctl tqnuedlttli l ir ki ch l kcesldlhmvhtslctadterqmrlrhmddvmdtdrayenlkbvc l etgaayehxcttelnncfckc l dbl rl ml llbl htv r f l fltelktbbttl tacscchtlmtbccl cd l psl tsdttt l dtt l ghl rl cl kl dlcdlkckccfbl ckl kl cdephcvhcbtqtl rl kmytncvndfcr kckdnepl clt l elkcldhbllfnhsfdltabdlrllldctfsttlrddrl dndndnnamcbmebl gqcmncgvccdl fhgelcbskl l pkllehbnlpd l db l pe l nmlnftttttl lakp ptl rl pcflbml tntbnycmndghl dl kbpl krel cdftl clrfl kcacqrptetentl rl bl pmqctadl fnl l mnldltlstgtl kc tlplhcpl gd l b l ekmvl ceccl tatml cl fbkltctttat l tac l ktmvlrhnl d l p l lrtqcl gt nv sg cha l ml l c l tncvdcettt llbqcsndcdlcdl bl gre l tncvtlrml lmfpdndtl kc l ehqcltttttttttct l fpdcrelcefc l u l nlt l c l cdrntl ptnetrtm l kl l clnhfl teslahl cfcnlyl clyomglcflfm l b l tbhqehnl l ih l xl cteedlcdcamstl estamqtakgdlrtl nt l st l pt l tnteqtktltmycd l c l bghlsllrtmdhtddlc l c l bplctadkcpltdthrehl k vkauvbldtbcrdkddqcvsstsd c l thttl yrtl ntl gkyhcy l rpdetdtadrl cvndohylsll cdtl ght dtl te l knqekhdhvkettmsydhcvhtdlc l vdpmttl tnccblt l svstonltbl mttttt l d l b l ft l cdcthhtlckhldtntxltmmydl cgkt l dctarhsdmt l ct l dgglkcbdct l tmvvqtk l j l t l cellmlklgbvnvmlt l ntlcclthlp l cf l lrclctl l cdtl llt lblct l ekbnonnlbletencqdddl p l kc l tknlstlt l b l c l cednthlt l thd cc l dt l fmttemtqtl l bl kmabknlbl pmtttt lakp b l ns l mhtepnvmtxlpl l bl etxhnntkdl kctl bl l b l put l dq l te l plckt l l crtntl c l p l ebqbggtcd l edvrcktnel hl kc l pmqltqblttt l kv l b l b l mtl r l pl rl gehgeshnl c l tmbptlpl ekm l pttalrl cd l p l lr l hgtkktl lbtl tedd l kthkeptt l lakptl da l b l

Nsnat c l sat cc l ld gc ah ql dts sgcdvanh21td cc tt ttt ki pc h l gmac cc t cha l qt l r l c b l p l kcdnnercdl ttaltgldldde l tmalkcvkb l fc ntnadv6team dd ki dom o l l cd k l kc tkkbl b l l kc d l kc d l tshbl ncqmtddt mtgs l hml l m l dqcl l tmcnscd l hgtnrl skll ki proof l of l nqlht l bla sm town l sbdtsl l t k l tmdmmsh l dt o l l hctddmocmdgeld nl f l dn ki yt l b l mdvmdde l dee em l b l ns l b l crktcctl tsllttlcdeammtl l pff m lb l nkllntnt l p l b l tebrtltldtb l tk l ckn kl dvb l pevekldvtatp l nd phttl p ghedaglcdl l ddhtt stlr tl rntl kpdedn l b l mtctncncl hgclt lt l hpmttlrtnltl c p l b l en l tddtkdrl nccbmkdntl l khgblc l sc all l nts l b l ktpbvnl sgchvckcnnp l p l enclchl c p l c l tphltl pl sbl lghtlbml l sdt l r l dd l k l l xgnltl tttttt pl bp l

Cl k kktttnl snccdvgdl c l gd cc lc l amkb l tpdrt l lcedncdc l kkcdl t l hngmtcltdbqbhtanld omtkplvcenpm l fc ttl nhs ya tl s l cc n l nbctlnmkv l p m l r l cl cd l c l rkblml nlbk l c l dyncr con ppn cd ki nvytkhxl tvccm l re f cct l dvomlgtl hcmlsgfqlncr dt l dts em l t l kb l hxkcvnmt mlqm l stnv l bl b l lmmcdcedvtnkkl tel cmkxbl cd l vkcltplc l mkektkwbkcmetlmtamcl tnltc l hgnccltxt l xdtclkmbdl gqbl cc dts l kbpsreel mhttl bxhedl mftl ceftl t l rk l l kml col kctnmcl cl gdtttl r l lrtl cndhftkcel l dvqblvtkddl tdcqpclrtlbtl emlckctamll mems l evchpkkbb l tatrnbkdbveyl hndltdl gh l tqtl b l l l cnnl cccakm l cl l cehlctandttenqmbbdctl vbdbl tlxlml cgenldl nldlkldlrnl cahmltmopdf l cl dktlv l hctddl l mhhqttnlydl ctktkktl b l clsdcl txhnlhtel nttcl pttnlmklnttrdrc amkb l c l b lkc b kedthtspdml htptsl l kiqmmt l dudlttvlh l lrt l gnlelc l tggonml dvb l r l gmml dee l khcndvplcl ltqldtsbnl helqbtgb l dlvbl mtkcbkexdltqcdbaetettbeqncrcnlcea l sbkvtbtl dd l cg l ldbtncglsncdtl dl l b l b l rkdrmhgccbt dd lvvl pl t l vdtasctl tel tmmktl g nc p nv l mqmnnmtxlbl l l rtmtl gle l m l tttt ledkcl onccl matmgtdtlknhr l cghdvdqfdet l n l l ptemdqdtl tdlrmfdencghlabdrkcqml tnc ngl lrmdktlcbdteclgvklke l kncqcdddeanl cdl lceotddacdl bv dv l vekdmlnqaobml nmnaccvn l tedhhmhqcdcdqnl plckncnnslhskgbngpvrl f l plceodll q l bcglnilgektbnmhcldrggamggvggngglctel enqabdnndmynrl klpekcsdqtancl clccll ekmdntnctapltdnl emcvbtmlpledqgednrmptnlhldecndtp c l dnndclrlcghrlteednndcdvdldkcltkdde l nqntttl ttnnhetkf l nv fx c l dddhlcl bl tnkbl sllqnblr l pexnclnthc l tcaaapl teddqdnlrhgennqlmkstttcsc l nstt l l t l ddqhl nnrml ybdcedqntkkpd l tecnchhvcdl cl c l c lnts dmemtpl b l llll wbnctolcdl pesiltl slbl htcnnmdcttl elnrdecxldddtc l tttttt l hgcdhvt l x l ackcmmlsdnlckthcl pe l d l elmtrdnhtdtcl kahuphvl qblvdktetexqlgpkmbdnqcakdvbtxmttonmhgyadndnqcrshedpecdctkdhnclmslbndmhhqtghbttgknmhmeckcl f l knctl nmetl cdlbpl c l rqtndltgd l knnkt l bl dcrmdqnvkdtttdsdctaclmmtvtnrhddtqrspltmtdncllkctbsvcedlt p l b l tedl cedqtatltdkvtmdncltelvvldsrtqnksgl m l klqglnlt l bl tedllgckdltedlltamhdvel p l bl n ltedmnlltggctnclc ldrelp l p lm l ekmcmcektptkdldcgnddldvqddebldvssmtmstltcekfplbl j l ktnehnldltmnlpql xrttm l tsnll l lsmght l mv l peedtldlb l l hkldetedqr k r lacnlcdl pdlvcm l c l emlhhdeclknlkgcdvcbnrtlcrblmdldbnklektad ddl b l crml emmddlsmdmcpvhk l p l p l etjlbpmcnml plqpl t l f l cydeqvnrtttl cc l nltl pbnchgpngtl n l taclleshl gd l nv cr l b l t l pcktebql llqdskvhkdkhhblq l mltlytmcdd nv dd l lrgllkll nv k l b l kv lr ldfl nqtnyatldhtltl ktelycltvlkcl d l kcsgecvtedqtnkec l c m l snkktvtdl mvthmkmqdcltat l clhtkdglhtlttllxxxt ct lhctfd l mklpl bl kkkkkkkkkddlvtamclnhltmlllctthhqt l tel usml skvtedqltanql kptt l embpltcbdnktkl cdedlbl m l ddqkml hhhhchdthntl rdepl l ddel dplcokvltelnl kl onsncnkthdelvpl nlhrdkkdrmlrqembcdnl l rel kclrbncrpttmthrl decml vdtttl m l l ecmbvldablveqmlkgdl mctadtatsdpwcnqdpttatlkmvebqkcnsxxmcedtl rdmgl hkkbolhrnhtcdnnyayldettrl kvhldnml pexlmnadedqkddldctdttglcclrglmkcl dklnltdvspl cl bl kl tkkl sqmtdetl t l l klklglddtacdl lrtl dl bl m l ktdeatdlklmdddet l b l m l t l b l pl dmakncggkl bl lnclmbktmkdt cc dnpl rl niktl m l tnctgxl kgqdtdecl b l dl tehdoclpnltnqkc l kfnskbsconnt cc l cd l t l hhoneldadhgldtg l mlt l b l rsdtl ttnhgktntddlvt l u l c l rbtl p l cecopdlbnekyldtrr l l rdktpl dtt l bl tnnlalhl negl c l phctglbhmntqctp l kf l encygtnchgedsld l rc mm l sgdhgetmtak l gd l b l c l mocdddcltcggtxt l gv l d l r l frtttl bbattcsk c l s l p l d l b l cdnecbcl p l f l nedtocnl d l pkmokngct l c l ddlsdgegthlcn l cc l hgtnkcodlbl bkcl mteknvmmvlhndlpedqtamlthkldlnccl b l xc l vv dd kit hy l b l bcctkblnnt l b l enuzmnndcvhc l b p l tebeghtkhbtxnte l xl b l ndcneanmdt l l lclmnml cc sc l r l cecdt l dd blr l nbtsd l b l r l cc f l mcjhttblkc l tntmdlgck l c l cdelatcal hgtnhn l drkpcedc l dvbl ddmabl dtt kcn lvd l ctpncgnnbhp l dde l scmdtdl l kl b l tqcdl b l ncccdl b l l b l dssntlt l l cncmtttl dhodl tghaehhclcnmob l nmrmkdhg l dvtf l b l r l keccbl co l l zffzl ? cc qn l b l tlttltl l mac l ccdelahl b l rf l

T l

Cp panlptqsdnchp cl pknnbdl wy l lr c ml h r l pc l bl httsktdtc cc lc rwlaftl c bl bbsncmtp lcmctdcl cl hctpmlsllpytxsnyt nt tepl xl ol dbnchgc cc l mv lbllm cl dts cdel ttm tdcmblbnmtl pskbtlqblttc tnmmnt bl tpnbbndlrtktqnpblb l hcodrtl r d l xhmlbbnet r dt bq kvtnmmvme l t ht c l mhlmc l p l gnrmgl nbqnc l cdlstcdhv l f ddt in jn ddncblp l mdtgecltllggtcl l l dmhtd tt di l tlnt gqbl n dsc sv om rl nn bc l kt c l l c l nn manbcsn l r l kdhpptt l klq m tt pt l re l s aacrdlt hdcvmpbc nl cd dr l tcdedd l ctt l bt l ttdn kl cc cnt on l pl tel gnc ki hxh l mg den llr l cd l hgtekntqk cc kc h l e l mohqklth l r tddtt l let l ca l sqcpkltrl tr3bhct l lplcsvlylntl nbqctgtl ukaeknb l tqcl col l c l pl c l kbeflkccennqkcl cc tvh tk l r l tctl kc ktqldbl c l shvakcnlsetnvhdnnckmmol f l b l bsmnncdclc l l dj that l mdatmt l b l kc n d l bl sl ctnnckrdtt l bl c l r lcl pcesscc l tepl h hmhpmax l cc maz l edtrl kdcvcrl drtp lbt l tg l c k l khltbkod l l m l tteqlnncttt l cl l gbl dmdecl b l r l ttqtl b l avex p l ttdnknl ddeggcerl ssel l r l cd l kc gmcl l l nkt tnk l c l fpc l cho cc l mdktc l bl cdghtltl r l cdtt l tmbl d l scmtkstl fscvabl l tnmkvcmplva l mblddsct l m p l q l b l r l m l t l mtnlmclr l p l b l stcnltltbm l tctt l naml cc l dl l b l l tscmktc l c l sh l dn l b l l tmslmkbcknn l cdghtl pekl l f l bl dtktxtca l b l tccccst l d l tcnqc l ts l f l awjamcrdptgmmlr l gh l cc sdtl bpl ctdedcdb l l tt l drt l lt l dmtttdt l etnhdcrdltdd l bl b l gshltldtcmhs l c l snsdsgdvv l p l hgemml rftlrbl tgql kccednbxn l kkk l cd l cdltl p l dtqthttlcnbdcfmaxnmttl kco l cdghtlbl cfhtl p l pc l ndqfc l dtmfdhqaycelt l r l txxql hgtldtl bl dtm l c l p l c l cemttttdltrdcckcanpkcf l c l bteldl b l ckc l cdj l c l c l b l kmvvvyl l hgtntg l ndethhdlpl trdr l p l mmcnbcdgh l tktl rft l tenml b l b l gtcbcltttl p l cl ftlpl sqblftl gh l bp l rbtalkdcncft l deddtlbl c l b l xl j l b l g l las l b l hgttnttdgs cc gs l b l gtmcl b l m g l qdhrtbldltehd l c l p l bp ha l hgt l tstt l gprcckmlt l c l d l bp l b l qtacal cc l ddme l b l c l c l t l t l vv l mgl c l b l cl pl bl tcertvlbcl cl

[quietlyapocalyptic]

@rabentochter needs to stop giving me ideas it’s 2am and I haven’t written tomorrow today’s DLD chapter yet

but for some reason I have just started writing a SHIELD Agent Loki AU so there’s that

[bloojayoolie]

Being Alone, Andrew Bogut, and Animals: 5021t-9 @manhattan acc waiting 4 LOVE! years dld, 60us HUNKY ELDERBULLN NEED Good looking, friendly, outgoing trained, very housetrained behaves when home alone **** TO BE KILLED - DECEMBER 13, 2018 **** AVERAGE RATED <3 "HIS FAVORITE TREAT IS BACON," HIS OWNERS LET THE INTAKE STAFF AT THE SHELTER KNOW before they turned their back and walked away from him forever. Cody is a 9 year old boy whose been an upstanding doggy citizen all his life, so for him to wind up in a kill shelter in his golden years when he should be living his best life is absolutely absurd. Not to mention SAD. But Cody's a happy boy with a radiant, attention-getting smile and he's not going to let this low point in his life get the best of him. He needs all of us to share him to the moon and back to get his plight out there. Cody's hero is out there. Lets help him find him/her. Cody is both a sweet chocolate tootsie roll and a breath of fresh air. His Average rating speaks for itself, though nothing beats interacting with him. Always a family pet and having a home, this 9 year old fella entered the shelter putting his best paw forward and continues to impress. His adorable teddy bear face is quick to smile, begs for attention and affection, plus he has the perfect energy level to be both engaging and relaxed. The list goes on and on with Cody. We wonder if he goes the extra mile knowing he's up against the odds landing on this dreaded list, though his charm is entirely authentic. Cody has a long life ahead to cherish a new home, he does so well with dogs to boot. We are so hoping someone will fall in love him before its too late. He really is exceptional. Please message this page if you can foster or adopt him. CODY@MANHATTAN ACC Hello, my name is Cody My animal id is #50214 I am a male brown dog at the Manhattan Animal Care Center The shelter thinks I am about 9 years old, 60 lbs Came into shelter as owner surrender Dec. 10, 2018 Reason Stated: LANDLORD WON'T ALLOW Cody is at risk for medical reasons. Cody was diagnosed with canine infectious respiratory disease complex which is contagious to other animals and will require in home care. Behaviorally, Cody would be suitable for most homes. My medical notes are... Weight: 60 lbs Vet Notes 10/12/2018 [DVM Intake] DVM Intake Exam Estimated age: 9y Microchip noted on Intake? yes Microchip Number (If Applicable): 981020017101754 History : owner surrender Subjective: BARH, normal appetite no defecation concerns Observed Behavior - allowed all handling Evidence of Cruelty seen - no Evidence of Trauma seen - no Objective P = wnl R = wnl BCS 5/9 EENT: Eyes clear, ears clean mild lichenification AU, no nasal or ocular discharge noted Oral Exam: unremarkable PLN: No enlargements noted H/L: NSR, NMA, CRT < 2, Lungs clear, eupnic ABD: Non painful, no masses palpated U/G: male intact 2 testicles soft symmetric, no leakage or discharge MSI: Ambulatory x 4, skin free of parasites, no masses noted, healthy hair coat, there are crusts and scabs on all four paws CNS: Mentation appropriate - no signs of neurologic abnormalities Rectal: visually normal Assessment dermatitis Prognosis: good Plan: simplcef 275mg/ po sid for 14 days SURGERY: consider in house neuter 1619 12/12/2018 S/0 - Diagnosed yesterday by DVM 1619 - notes not entered yet. DVM 1493 observed moderate serous nasal discharge on visual examination EENT - serous nasal discharge moderate, eye clear - no coughing heard R - WNL A - CIRDC suspected + Move to isolation + Enrofloxacin 10 mg/kg SID for 14 days + 10mg/kg doxycycline PO SID for 14 days + 2 mg/kg cerenia PO SID for 4 days + Proviable x 5 days SID PO + Recheck in 7 days for resolvement and return to general population PROGNOSIS EXCELLENT URI Details on my behavior are... Behavior Condition: 1. Green Behavior History Behavior Assessment Upon intake, Cody at first had a tense body. After giving him multiple treats, he started to loosen up and allowed additional handling. He was collared and scanned for a microchip while the owner was holding him. Date of Intake: 12/10/2018 Basic Information:: Cody was brought in to our facilities as an owner surrender due to the owner currently living in housing that does not permit pets. This owner had had Cody for the past 4 years after a friend gave him to them. Cody is currently 9 years old and is a brown and white large mixed breed male dog. He has no reported health issues in this home and last saw a vet in 2017 for vaccinations and microchipping. Previously lived with: 2 adults How is this dog around strangers?: Around strangers, Cody is friendly and outgoing. He will play exuberantly with adults. How is this dog around children?: Cody has spent time with children ranging for 1 year old and up. Around them, he is described as being relaxed, respectful, and tolerant of his ears getting pulled. He will play gently with children. How is this dog around other dogs?: Cody reportedly gets along better with female dogs than male dogs. He likes to play exuberantly with dogs. How is this dog around cats?: Cody has never lived with a cat before, but will reportedly chase after and bark at stray cats in the neighborhood. Resource guarding: Cody has no resource guarding behaviors. Bite history: Cody has never bitten another animal or person. Housetrained: Yes Energy level/descriptors: High Other Notes:: Cody's owner reported no behavioral issues and stated that he is not bothered by loud storms or fireworks. He will drop a treat with the "drop it" command. He is not bothered when pushed or pulled off of furniture and will jump down with the "off" command, when held or restrained, when disturbed while sleeping or resting, or when bathed. His owner did not brush him. He will pull his paws away when his owner attempts to touch them, therefore they have been unable to trim his nails. He will whine if he hears someone in the hallway. He will sniff when a stranger approaches his owner or family. Has this dog ever had any medical issues?: No For a New Family to Know: Cody is described as being friendly, affectionate, playful, and confident. He likes to follow you around when you are home. He likes to play with balls and will play fetch. He has been kept indoors only. He is used to wet and dry dog food twice a day from a variety of brands. His favorite treat is bacon. He is very house trained and does not have accidents. He will use wee wee pads, as well as any surface outside. When he is left home alone, he lays down and is well behaved. He has never been left alone in a yard. He has been crate trained and does well for 2-3 hours. He knows the commands sit, down, and go to crate. For exercise, he is used to walks on the leash. He pulls gently but will stop when corrected. He has never been walked without a leash. Cody's favorite things to is to run and be active. His owner's favorite things about him are how very friendly he is, how he is good with kids, and how good he is at learning commands. Date of intake:: 12/10/2018 Spay/Neuter status:: No Means of surrender (length of time in previous home):: Owner Surrender (In home for 4 years) Previously lived with:: Adults Behavior toward strangers:: Friendly Behavior toward children:: Relaxed, respectful, and tolerant Behavior toward dogs:: Exuberantly playful Resource guarding:: None reported Bite history:: None reported Housetrained:: Yes Energy level/descriptors:: Cody is described as friendly, affectionate, playful, and confident with a high level of activity. Date of assessment:: 12/12/2018 Look:: 1. Dog's eyes are averted, with tail wagging and ears back. Allows head to be held loosely in Assessor's cupped hands. Sensitivity:: 1. Dog stands still and accepts the touch, eyes are averted, and tail is in neutral position with a relaxed body posture. Dog's mouth is likely closed for at least a portion of the assessment item. Tag:: 1. Dog follows at the end of the leash, body soft. Paw squeeze 1:: 1. Dog does not respond at all for three seconds. Eyes are averted and ears are relaxed or back. Paw squeeze 2:: 1. Dog does not respond at all for three seconds. Eyes are averted and ears are relaxed or back. Flank squeeze 1:: Item not conducted Flank squeeze 2:: Item not conducted Toy:: 1. Minimal interest in toy, dog may smell or lick, then turns away. Summary:: Cody approached the assessor with a soft body. He was distracted during the assessment, sniffing around the room, but also displayed social behavior. He allowed all handling and displayed no concerning behaviors. Summary (1):: 12/11: When introduced off leash to the female greeter dog, Cody engages in soft, bouncy play. The previous owner of Cody cites that he has been playful toward other dogs, though preferential toward those who are female. Based on history and observation, Cody may be most compatible with social female dogs. Date of intake:: 12/10/2018 Summary:: Tense at first, then loosened and allowed handling Date of initial:: 12/10/2018 Summary:: Allowed handling ENERGY LEVEL:: Cody is described as having a high level of activity. We recommend long-lasting chews, food puzzles, and hide-and-seek games, in additional to physical exercise, to positively direct his energy and enthusiasm. BEHAVIOR DETERMINATION:: AVERAGE (suitable for an adopter with an average amount of dog experience) Behavior Asilomar: H - Healthy * TO FOSTER OR ADOPT * HOW TO RESERVE A “TO BE KILLED” DOG ONLINE (only for those who can get to the shelter IN PERSON to complete the adoption process, and only for the dogs on the list NOT marked New Hope Rescue Only). Follow our Step by Step directions below! PLEASE NOTE – YOU MUST USE A PC OR TABLET – PHONE RESERVES WILL NOT WORK! * STEP 1: CLICK ON THIS RESERVE LINK: https://newhope.shelterbuddy.com/Animal/List Step 2: Go to the red menu button on the top right corner, click register and fill in your info. Step 3: Go to your email and verify account \ Step 4: Go back to the website, click the menu button and view available dogs Step 5: Scroll to the animal you are interested and click reserve STEP 6 ( MOST IMPORTANT STEP ): GO TO THE MENU AGAIN AND VIEW YOUR CART. THE ANIMAL SHOULD NOW BE IN YOUR CART! Step 7: Fill in your credit card info and complete transaction HOW TO FOSTER OR ADOPT IF YOU CANNOT GET TO THE SHELTER IN PERSON, OR IF THE DOG IS NEW HOPE RESCUE ONLY! You must live within 3 – 4 hours of NY, NJ, PA, CT, RI, DE, MD, MA, NH, VT, ME or Norther VA. Please PM our page for assistance. You will need to fill out applications with a New Hope Rescue Partner to foster or adopt a dog on the To Be Killed list, including those labelled Rescue Only. Hurry please, time is short, and the Rescues need time to process the applications. Shelter contact information Phone number (212) 788-4000 Email adoption@nycacc.org Shelter Addresses: Brooklyn Shelter: 2336 Linden Boulevard Brooklyn, NY 11208 Manhattan Shelter: 326 East 110 St. New York, NY 10029 Staten Island Shelter: 3139 Veterans Road West Staten Island, NY 10309

[iq85]

Lyra McKee: R.I.P. @ DLD

Jedes Jahr zum 12. Juli wird Nordirland zum Tollhaus, denn: "the Protestants are marching". Landesweit werden Paraden veranstaltet, bei denen Zehntausende Zuschauer mit Union Jack und (Glasgow) Rangers-Shirts die Straßen blockieren und zwischen ihnen Orangemen und uniformierte Flute Bands entlangmarschieren, die den protestantischen Sieg über das Katholenheer bei der Battle of the Boyne zelebrieren. Diese fand, wohlgemerkt, vor vierhundert Jahren statt.

An diesem Tag herrscht so viel Spannung im Land, dass man keinerlei südirische Nummernschilder auf nordirischen Straßen sieht, weil die Fahrzeuge von betrunkenen Protestanten mit Steinen beworfen oder in Brand gesteckt würden. Und weil die Katholiken sich an diesem Tag bis auf's Blut gereizt fühlen, ist die Situation vor Ort äußerst explosiv. Und ja, wir sprechen, wohlgemerkt, von der Gegenwart, 2019.

Der 12. Juli ist der Höhepunkt der marching season, es ist der Augenblick, wenn Protestanten am meisten verrückt spielen. Das katholische Gegenstück ist Ostern; dann muss man die Bälle immer flachspielen.

An Ostern 2019 ist die nordirische Bloggerin Lyra McKee gestorben. Sie war bekannt für ihre schriftlichen Auseinandersetzungen mit dem Nordirlandkonflikt. Lyra McKee starb im Creggan Estate von DLD. DLD ist die Abkürzung für Derry/Londonderry und das Creggan Estate ist die Heimat von Free Derry, einer Bewegung, die für ein United Ireland kämpft. Nirgendwo im ganzen Land ist man näher dran an Selbstverwaltung als im Creggan District - das Gesetz vor Ort geben die Dissidenten, die nordirische Polizei wird, höchstens, toleriert.

Lyra McKee ist Belfasterin, aber für die Liebe ist sie nach DLD gezogen. Sie kannte also die Gegend und wusste, was Ostern im Creggan Estate bedeutet. Trotzdem sie ist raus auf die Straße gegangen, weil jemand, der einen Konflikt erforscht, gerade dann raus ins Leben muss, wenn die Situation am überkochen ist. Ansonsten ist alles Erfolschen akademischer Müll. Wer Feuer erforscht, muss nah an die Flamme rangehen und darauf achten, dass er nicht Feuer fängt, sondern sich höchstens ein bisschen versengt.

Denn aus welchem Grund sonst fahre wohl ich am 12. Juli, aus Südirland kommend, direkt ins protestantische Zentrum, die Belfaster Shankill Road? Weil ich dort Frieden suche? Nein, ich möchte Blut & Donner sehen, und erwarte ansonsten höchstens die Ruhe vor dem ersten Schuss.

Lyra McKee suchte an Ostern 2019 das Feuer, und nur weil sie zu nah dran war und sich verbrannte, kann man dafür weder republikanischen "Dissidenten" noch der IRA die Schuld geben. Denn "the struggle" ist eine Situation, in der alles zum chaotischen Selbstläufer wird, so wie die Kugel, die Lyra McKee anstelle des Polizeibeamten traf, für den sie wahrscheinlich bestimmt war. Wenn überhaupt für jemanden.

Lyra McKee wurde von Seiten der Politik zum Märtyrer des Friedens stilisiert. Hätte sie aber Frieden gesucht, hätte sie Sicherheit bevorzugt und sich so wie die südirischen Autofahrer am 12. Juli verhalten - sie wäre einfach zuhause geblieben.

Stattdessen wurde die Situation von Seiten der Politik ausgenutzt, um Propaganda gegen Republikaner zu machen und zukünftig mehr Druck auf sie auszuüben. Und das kann nicht im Interesse einer Lyra McKee sein, weil in Irland seit achthundert Jahren Konfliktüberwindung durch mehr Unterdrückung probiert wird.

Lyra McKee ist eine Heldin, weil sie freiwillig dorthin ging, wo es Schmerzen gibt. Das ist echt mutig. Sie ist aber keine Heldin deswegen, weil sie dort im Schmerzzentrum auch Schmerz gefunden hat. Letzteres konnte man entweder erwarten oder es war - so wie in ihrem Fall -, just Pech: in Bezug auf ihr Tun befand sie sich zur richtigen Zeit am richtigen Ort, in Bezug auf die Flugbahn der querschlagenden Kugel eindeutig am falschen.

Dass sie jetzt tot ist, ist schade, aber mehr ist dazu auch nicht zu sagen, außer dass sie zukünftig mehr Beachtung findet, weil tote Helden unsterblich sind.

[neovitae]

« Israël Hightech » tous les lundis à 7h 05. Radio J sur 94.8FM.

A.(1) FRANCE et ISRAËL. La belle histoire des relations du Ministre Bruno Le Maire avec Israël se poursuit. Le Ministre était en Septembre 2017 au salon DLD de Tel-Aviv avec le Secrétaire d'Etat à l'Innovation Mounir Mahjoubi. Sur son compte Twitter le Ministre Le Maire s'affiche le sourire aux lèvres ... from Google Alert - "ressources humaines" -H/F http://ift.tt/2CsA5by

[thestanceyg]

To-Do List

Tagged in by the super awesome @dresupi

Do This: List all the things you’re currently working on in as much or little detail as you’d like, then tag some friends to see what they’re working on. This can be writing, art, vids, gifsets, whatever.

1. Halfway Gone:  Darcy/Spencer Reid.  BWAHAHA.  I allowed a little side plot bunny become part of the story and now I don’t know what happens next.  I have zero more words written on this.

2. After I Fall: Darcy/Spencer Reid. No joke, the title of my document is “Widow Fic” because I suck at titles. I have 3 more chapters of this written which puts me roughly 1/4-1/3 of where I want this story to be.  However, I don’t want to post those until I get another 2 or so chapters done because I know these need editing that I won’t see until I’m a bit further out.  **Fun fact: I’m super worried my Spencer muse has left me and I can’t write his voice anymore**

3. Darcy Lewis Diaries: Darcy Lewis/???. I don’t want to spoil who we’re shipping her with yet.  This is actually buzzing along pretty well.  We have 11 “episodes” written, and we figured out our AU timeline so that the characters we picked will work. I’d like to have up to episode 20 written before I start grad school in April so I feel like I have a good buffer.  Also, follow @darcylewisdiaries if you loved Lizzie Bennet Diaries(or Pride and Prejudice in general) and are interested in our crossover.  The entire story will be told through that blog. @neverending-shenanigans is co-creator, and without her this wouldn’t be even a 10th as awesome.  She has really good ideas.

4. Original Smut: does not have a title. This is a piece that’s going into the Summer Heat Anthology.  I have about 6,000 words done and expect about another 1000 to finish it.

5. Original Romance: does not have a title.  I have about 35,000 words of this done and it is in need of a MAJOR revision and about 15,000 more words.

6. Smut Week Fics: Various. I have general ideas for about 3 of the prompts and have written a whopping 500 words total, but that’s better than zero.  This (in addition to DLD episodes) I need done before grad school starts.

I tag....anyone!  Feel free to say I tagged you!

[digitalnaiv]

#9vor9: Clearview, Gesichtserkennung und Datenschutz, trotz Hasskommentaren eine Spendenaufruf für Australien (und mehr)

Digitalthemen der Woche bei #9vor9: #Clearview, #Gesichtserkennung und #Datenschutz, trotz Hasskommentaren eine #Spendenaufruf für #Australien (und mehr)

Heute wieder #9vor9 mit den Digitalthemen der Woche und Gunnar Sohn sowie Lars Basche. Die DLD Konferenz vom Wochenende sind wir übergangen und das World Economic Forum kommt erst noch. Also haben wir uns auf andere, aus unserer Sicht wichtige Themen fokussiert.

https://twitter.com/gsohn/status/1219527742414151680

Kashmer Hill hat auf New York Times unter dem Titel The Secretive Company…

[reseau-actu]

VENDREDI LECTURE // Jessica Powell a dirigé la communication de Google de 2012 à 2017. Elle publie un roman satirique très critique de la "monoculture" hypermasculine des entreprises technologiques.

Les rangs des anciens salariés déçus des entreprises technologiques ne cessent de grossir. Au début du mois d'octobre, Jessica Powell, vice-présidente de Google en charge de la communication et des politiques publiques de 2012 à 2017, a déposé une petite bombe sur la plate-forme de publication en ligne Medium. Intitulé "La grande disruption", l'ouvrage a pour sous-titre "une histoire entièrement fictionnelle mais essentiellement vraie sur la Silicon Valley".

L'ancienne dirigeante, qui se définit comme une "technophile technophobe", dépeint au vitriol le fonctionnement d'Anahata, "entreprise technologique la plus importante au monde". Avec son fondateur mégalo s'exprimant par aphorismes entre deux séances de yoga, son projet secret de colonie sur la Lune et ses tests de voiture autonome, difficile de ne pas y voir une allégorie du géant du Net, chez qui elle a passé les dix dernières années.

Jessica Powell assure cependant que les passages les plus critiques ont été inspirés par son expérience chez Badoo, une application de rencontres chez qui elle a été directrice du marketing entre 2011 et 2012. "Je me suis demandé ce qui se passerait si je mariais la culture immorale de cette start-up au pouvoir d'une entreprise comme Google", raconte-t-elle.

à lire aussi

ARTICLE

Les 5 échecs de Google

Mission humanitaire

L'envie d'écrire une satire naît à Munich en janvier 2012, alors qu'elle assiste à DLD, l'une des deux grosses conférences technologiques européennes avec LeWeb à l'époque. "Brian Chesky, le patron d'Airbnb, explique sur scène que son invention pourrait aider à mettre fin aux guerres. Ce qui est extraordinaire pour un site de partage d'appartements ! Et le PDG de ma boîte dit que c'est une application créant du lien social, alors que c'est simplement un site pour trouver un coup d'un soir".

Ce décalage entre les produits vendus et la mission presque humanitaire dont se réclament les PDG la dérange depuis longtemps. Diplômée en littérature comparée de Stanford, auteur d'un livre sur Paris vu par les écrivains, c'est son expérience en droit d'auteur acquise au sein de la Confédération internationale des sociétés d'auteurs et de compositeurs à Paris qui séduit Google. L'entreprise la recrute pour défendre son projet de librairie numérique en 2008 à Londres.

Convaincue par l'idée, elle est frustrée par la mentalité des ingénieurs qu'elle côtoie toute la journée. "Ils ont tendance à perdre de vue l'aspect humain. Tout est une donnée pour eux", explique-t-elle. Le rejet des Gafa en Europe cimente son regard critique. "Londres n'est pas un hub technologique, donc j'étais constamment mise à l'épreuve. Mes amis me demandaient : 'Comment est-ce possible que Google soit si doué pour le ciblage publicitaire mais incapable de repérer les contenus terroristes ?'" raconte-t-elle. Dans la Silicon Valley, qu'elle rejoint en novembre 2012 quand elle est promue au titre de vice-présidente en charge de la communication, "on ne pose pas assez de questions simples et fondamentales", estime-t-elle.

à lire aussi

ARTICLE

Google ouvre son centre de recherche parisien sur l'IA

"Monoculture" hypermasculine

Son livre dénonce aussi la "monoculture" hypermasculine de la Silicon Valley. Elle a ainsi éliminé toute présence féminine dans le roman, à l'exception de Jenny, dont le parcours illustre les difficultés rencontrées par les salariées de ces entreprises. "Elle est réceptionniste − alors qu'elle a un doctorat −, c'est son idée qui finit par sauver la société… et malgré ça elle retourne à la réception."

Des passages du livre font écho aux récentes révélations du "New York Times" sur le traitement de plusieurs hauts dirigeants, qui ont reçu plusieurs millions de dollars après avoir été mis à la porte pour harcèlement sexuel. "Ces sociétés se soucient des droits des femmes mais quand il y a un conflit entre les valeurs et un enjeu business − dans ce cas précis, la possibilité qu'un de leurs anciens dirigeants aille chez un concurrent −, le business l'emporte", soupire Jessica Powell. Elle estime cependant que le passage de flambeau de Larry Page à Sundar Pichai a permis d'améliorer les choses, avec des procédures plus strictes.

Depuis la publication de cette dystopie, les "DM" (messages privés) tombent en rafale sur son compte Twitter. L'ouvrage a atteint 150.000 vues et plus de 12.000 personnes ont complété sa lecture. Un écho inespéré alors qu'aucune maison d'édition ne voulait la publier en 2012. Entre-temps, le vent a tourné pour les géants de la technologie, et les oeuvres critiques sont à la mode, de la série télévisée "Silicon Valley" au roman dystopique "Le Cercle" de Dave Eggers. Une version papier et un livre audio sont désormais sur la table.

Les 5 meilleurs extraits

Des dirigeants à l'ego surdimensionné Les PDG pensaient que les problèmes de la planète existaient en partie pour les maintenir stimulés intellectuellement et que la malaria, la corruption, les blocages parlementaires et la mort pouvaient être résolus par la technologie. Leur manque de concentration était pris pour du génie. Un instant, ils demandaient à toutes leurs équipes de changer radicalement de voie, et juste après ils accordaient la même attention à l'ambiance de l'éclairage dans le lobby. Et malgré leur fort athéisme, ils croyaient tous que leur succès était d'une manière ou d'une autre prédestiné, presque mystique.

…qui croient que l'innovation est forcément positive "Toutes les innovations ne sont pas bonnes", dit Arsyen, en secouant sa tête. "Faux ! 100 % faux !" hurle Roni, sautant de sa chaise et secouant son doigt plein de mayonnaise devant le visage d'Arsyen. Il se redresse et se précipite vers la porte. "Recruteur !" crie-t-il. "Recruteur !" Il sort de la pièce et se met à faire les cent pas, en criant "Internet des objets !" et en frappant sa tête avec la paume de sa pain de manière répétitive.

à lire aussi

ARTICLE

Google se lance à son tour dans les stories

…chouchoutent leurs ingénieurs jusqu'à l'absurde Dans le bâtiment numéro 3, des distributeurs de yaourts glacés avaient été installés dans chaque cubicle. Un service pour les ingénieurs souhaitant que quelqu'un les borde la nuit dans les lits du campus était disponible dans le bâtiment 4. Le building numéro 2 était lui équipé de tapis roulants changeant de direction toutes les quinze minutes − un défi pour comptabiliser ses mouvements précisément ou faire du sport en allant à contre-courant.

…concoivent des produits pensés par les hommes pour les hommes "Et si la femme ne veut pas être trouvée ?", demande Arsyen. Il ne pouvait pas imaginer avoir lui-même ce problème, mais tous les hommes n'avaient pas son charme. "Tu as raison, nous devrions considérer les cas limites", répond Roni. "Mais soyons réalistes, qu'est-ce qui n'est pas agréable là-dedans ? Après tout, les femmes aiment l'attention Demandons aux femmes ce qu'elles pensent après le lancement en bêta. Cela prendrait trop de temps de le faire maintenant et de toute façon, il existe un corpus de recherche scientifique légitime qui démontre que les femmes ne savent jamais ce qu'elles veulent."

…et rachètent des start-up non rentables pour plusieurs millions de dollars "Ce qui est important, c'est que le nombre d'utilisateurs grossissent − c'est encore mieux si tu peux dire à tout le monde que ta croissance est exponentielle", explique Sven. "C'est rare que quelque chose soit réellement exponentiel. La croissance est généralement linéaire, mais les gens sont généralement stupides", répond Jonas. "Ensuite, un VC commence à cracher du fric comme si c'était des bonbons", poursuit Sven. "Tu deviens riche avant même d'avoir prouvé que ton produit peut gagner de l'argent. Puis une grosse entreprise rachète ta start-up. Parfois, c'est simplement pour récupérer tes salariés − tu peux obtenir des millions de dollars si tu dis simplement que tu emploies des experts en intelligence artificielle et en machine-learning. La cybersécurité, le biohacking et les micro-algues sont également de bonnes idées."

Par Anaïs Moutot

Menu

[arnauddostie]

Tel Aviv / Haifa : dernière chance pour la mission business de septembre

Si la plupart des entreprises ont déjà leur sésame pour la mission officielle menée par la Ville de Marseille en Israël du 15 au 20 septembre, il est encore temps de saisir cette opportunité d'affaires avec la startup nation. Une opération organisée avec l'appui de Team France Export en région Sud.

De quel atout doit-on disposer pour cibler Israël ? La réponse est limpide pour les entrepreneurs qui ont déjà fléché ce marché : l'innovation, quelle qu'elle soit. En effet, si les technologies de pointe et l'économie numérique concentrent près de la moitié du PIB (40%) de la startup nation, toute PME d'ici qui innove, invente, crée, se distingue dans son secteur (tourisme, mobilité, smart city, industries créatives...) a des chances de tisser des liens avec ses homologues à Tel Aviv ou Haifa. La mission pilotée par la Ville de Marseille avec les équipes de Team France Export est justement conçue et équipée pour faciliter le business meeting : en-dehors des frais logistiques (vol A/R Marseille et hébergement sur place), tout est offert dans la mission en Israël.

Le graal ? L'accréditation au DLD Innovation Festival incluse dans le package 

Positionné comme le rendez-vous international de l'élite du digital business, reconnu comme une version concentrée et sélective du CES Las Vegas, le forum DLD de Tel Aviv accueille chaque année 110 délégations du monde entier, propulse quelque 100 startups valorisées auprès de 4000 visiteurs. C'est sur cet événement incontournable que la mission Ville de Marseille emmène ses participants le 18 septembre et organise avec Team France Export des rendez-vous BtoB avec investisseurs et partenaires potentiels (programmés par Business France Israël). Le point d'orgue de cette mission, parmi de nombreux temps forts à Tel Aviv durant deux jours (rencontres avec des startups à Kyriat Hatidim, visite de sites économiques, réception networking en Mairie et à l'Institut français...). 

Haifa, première étape de cette learning expedition en Israël 

Visite de sites phares de l'économie dans la baie d'Haifa, accueil à l'Hôtel de Ville, conférence avec pitch des participants de la délégation face aux acteurs clefs de ce territoire... : le programme des 15 et 16 septembre est riche d'opportunités d'affaires entre startups innovantes : cleantech, biotech, smarticty, smartport... Celui d'Haifa justement, le premier port d'Israël, le 4e port à conteneurs le plus efficace au monde, risque fort d'inspirer les entrepreneurs de la mission positionnés dans l'aménagement performant et durable, la digitalisation et la connectivité au service de l'information des usagers, la croisière qualitative et responsable... 

Téléchargez le détail de la mission en Israël 15-20 septembre pour saisir les dernières places !

par Actu regionale - Chambre de commerce et d'industrie de region Provence-Alpes-Cote d'Azur (CCIR PACA) http://www.paca.cci.fr/info-actu-regionale--tel-aviv--haifa--derniere-chance-pour-la-mission-business-de-septembre-7932.php