#this is not my preference of course; it's only that there's a program on inverse trace element modelling written in fortran

[thesecondface]

there is fortran in my future and I'm not sure how I'm supposed to feel about this.

[ddlcbrainrot]

Considering I met you via a Monika ask on tumbilaer dot com it only seems fitting to add some more details in have about her in my head

So because its summer and a fucking miserable

90 degrees ferinhieght [feels like 99] I got reminded that she likes hot weather! Somehow! She probably didnt live anywhere humid because oh my fucking god

Anyhow!

I've stared before my opinions on how her preference for warmer weather could be linked to her desire to feel real, or just have that respite of existence in a way, as feeling cold can commonly be symbolically used to represent someones own personal emotional struggle for lack of feeling or emotion, with the inverse being to feel hot, which can in my opinion be interpreted as her rather being overwhelmed and overstimulated to be compared with being left quiet, nothing

Now my wording here might not be the best at conveying things of course, I do struggle in some manners, but still

The overstimulation or just general bliss overdose thing i talked about is definitely something I do think she partially has issues with, because as long as you're feeling something, you have to be real? Or at least, if you feel something than at least it feels real

But, temperature aside, the reasons I think she prefers summer is also because she yearns for those memories more

Think about it a bit and like

She hasnt experienced any summer break, not really, nor any festivals to think of it

Which is heartbreaking, rip monika you would have loved. A pride parade I think, probably

I dunno I've never gone personally

But besides that

It makes a lot of sense for her to prefer summer if she yearns for summer memories and the sense of life that it gives, because the fact is that she'll know nothing but the club, and by extension school which like get this girl OUTTA there!!! I know she's studious but still she's gotta!! Go to the beach and, I dont know what people do at the beach, she needs to get buried in the sand

Actually no forget my original stuff who would get buried first in the literature club

Sayori probably

I think Yuri would be peculiar about her hair and just in general having fun because she's too concerned with letting herself have fun because she's scared of being immature by engaging with just, having fun

I feel you there girl but you also need to have fun with your friends I know it sucks but you have to

Natsuki digs holes, I know she does, she, MC probably because I'm actually including them surprisingly enough, and than finally natsukibro

I love family headcanons

Anyhow, Monika probably tans with Yuri actually

She needs alot more sunscreen though because I just headcanon Monika as painfully pale and sunburn prone

Like she'll be completely burnt hand having the time of her life I think

Oh and Sean surfs, he definitely does in his freetime

He isnt. Good

But he does

And monika's mom is working a summer job because she has like five jobs and is some freak ass workaholic

Smh

Anyhow uh yeah I forgot what I was talking about halfway but why not, summer beach headcanons

Actually also, satori catches bugs

She does it

Catches bugs 😛😛😛😛🙁

do i think monika is a freak who needs to be locked up for choosing hot weather over cold weather? yes!

do I understand its probably more of her preferring feeling overstimulated over the numbness that comes with freezing your ass off? also yes!

i wonder if the void was cold, so that could be another reason? i mean it's basically space (at least thats what it looks like) and well... space is not exactly a lovely temperature. idk what would be worse though, it being cold or it just not being anything

another point is if she even knows how cold and hot feels? like, how much is it something she has experienced vs something that was programmed into her. Or like, has made up her mind based solely on what she thinks it's like

welcome to the ddlc fandom in 2025, making posts about monika liking hot weather!

[mostlysignssomeportents]

Dishwashers have become Iphones

Apple is a true business innovator: For more than a decade, they have been steadily perfecting an obscure anticompetitive tactic, turning a petty grift invented by console games companies into a global, cross-industry mechanism for extracting rents and centralizing control.

I'm speaking of App Stores, of course, and not just any app store, but one that's illegal to compete with or switch away from. This started with console companies, who used technical tricks to ensure that they could skim a rake from every program you bought for your system.

Consoles used proprietary hardware or media formats to ensure that software vendors couldn't sell directly to you, that every sale would be forced through their storefronts or licensing systems.

These tactics acquired the force of law in 1998 after Bill Clinton signed the Digital Millennium Copyright Act (DMCA), whose Section 1201 made it a felony to traffick in "circumvention devices" that bypassed "access controls" for copyrighted works.

Broadly, that meant that you could go to prison (for five years!) for making anti-DRM tools. What's more, DMCA 1201's drafters rejected tying the law to acts of copyright infringement, making it illegal to remove DRM, even if you did so for a perfectly legal reason.

For example, if your games console had some code that ensured that the software you were running had been taxed by the manufacturer, then removing that code could become a criminal act - even though that has nothing to do with copyright infringement.

To make that concrete: copyright is supposed to help creators and audiences transact with one another. If you own a console and I wrote some software for it, then copyright should facilitate you paying me money for it and then running it on your console.

But if the console's manufacturer had designed its product so that it got to impose a tax on transactions like this, then I can't sell you my copyrighted work anymore unless I pay the tax. Doing so is a felony, but not because it infringes copyright.

No, it's a felony because it's bad for the manufacturer's shareholders. It's what Jay Freeman calls "Felony Contempt of Business Model."

Now, the defenders of this practice say it's not anticompetitive because I can invent and manufacture a different, competing console, sell it to you, and then sell you my code without paying tax.

But this isn't how competition works. Companies don't get to say, "You can compete with me, but only on the terms I set, and in the domains where I think I have an advantage." Excluding competition in "complimentary goods" (like apps) is 100% anticompetitive.

For several years after the passage of the DMCA, the abuse of Sec 1201 to create "Felony Contempt of Business Model" stuck mostly within the realm of games consoles, with the exception of mixed results in the printer ink market.

Then along came the App Store for Apple's Ios devices: these were designed to be locked to a single app store, so that people who made copyrighted works (apps) and people who wanted to buy them (Ipod/pad/phone owners) couldn't transact without going through Apple.

Apple's paternalistic pitch was that it would only use this power to benefit its customers. The press *loved* this story, because Steve Jobs posed himself as a daddy-figure who would use apps to get us all to pay for media again.

https://memex.craphound.com/2010/04/01/why-i-wont-buy-an-ipad-and-think-you-shouldnt-either/

The consensus that Apple should be able to decide how other companies could compete with it was advanced by its most loyal customers, who'd long considered themselves to be a kind of oppressed religious minority.

They insisted that there was no reason to allow a third-party app store because everyone who owned an Ios device loved using Apple's App Store.

But when anyone pointed out that if this was true, then there would be no reason to ban third-party stores (because they'd fail), they'd switch tactics, saying that any Ios user who switched stores was Doing It Wrong.

This is the Apple fanboy No True Scotsman argument: "Everyone loves the limitations of Apple's walled gardens, and if they don't, they're not really Apple customers. If they didn't want to be locked into the walled garden, they should have bought a different device."

To understand how weird this is, consider the inverse: we live in a market society based on property rights. Once I buy an Ios device, I get to decide which programs I run on it and who I buy them from. If Apple didn't like that deal, it shouldn't have sold me an Ios device.

This belief-system is intrinsically conservative, in the sense articulated by Frank Wilhoit: "There must be in-groups whom the law protectes but does not bind, alongside out-groups whom the law binds but does not protect."

https://crookedtimber.org/2018/03/21/liberals-against-progressives/#comment-729288

How else to explain the indifference of Apple trufans for the company's decision to reverse-engineer all of Microsoft Office's file formats and make compatible players for them, and their defense of Apple's strict prohibition on doing this to Ios?

https://www.eff.org/deeplinks/2019/06/adversarial-interoperability-reviving-elegant-weapon-more-civilized-age-slay

But even if you think Apple will never abuse the power to decide who can compete with it to make complimentary products that interoperate with its own devices, the norms, laws and precedents backstopping Apple's business-model innovations can by used by anyone.

In 2015, I wrote a Guardian microfiction that exposed the perils of allowing companies to choose their competitors. It was called "If Dishwashers Were Iphones."

https://www.theguardian.com/technology/2015/feb/13/if-dishwashers-were-iphones

It was a letter from the CEO of an "innovative" dishwasher company explaining why his customers were wrong to try to wash third-party dishes in his products.

The comments swiftly filled up with Apple defenders who decried it as an absurd, over-the-top analogy.

To those people, I say, behold, the Bob Dishwasher! It's a cute, countertop dishwasher aimed at single-person households, and it uses a proprietary cartridge for detergent dispensing, at about $0.67/wash - about $242/year.

https://www.youtube.com/watch?v=hVup5ya0WVQ

The company makes a lot of familiar, paternalistic claims to justify selling a non-refillable, single-use electronics package that becomes immortal e-waste once you've used it up and replaced it: the precision electronics and proprietary detergent ensure optimal performance.

dekuNukem bought a Bob and decided that he - and not the manufacturer - should decide whether the "advantages" of throwing out the cassette and buying a new one were worth it. He reverse-engineered it and made a defeat device he calls a "rewinder."

https://github.com/dekuNukem/bob_cassette_rewinder

The tale of how he did this makes for a fascinating read, especially the analog sleuthing he did using product safety labels to reverse-engineer the "proprietary" composition of the detergent and rinse-aid, which turn out to be commodity products marked up by 7700%!

Extraordinarily, he's actually selling the Rewinder, for $30. This shouldn't be extraordinary, but it is, thanks to the penalties under DMCA 1201 (and the UK equivalent law, derived from Article 6 of 2001's EU Copyright Directive).

https://www.tindie.com/products/dekuNukem/bob-rewinder-renew-your-bob-dishwasher-cassette/

It's not just dishwashers, either. Would-be digital rentiers have figured out that they can turn their shareholders' preferences into legal obligations to their customers by engineering their products so they have to be used in specific ways...or else.

For example, KLIM makes a motorcyclist's airbag vest that deactivates itself if you stop making subscription payments (of course, this means that anyone who exploits a defect in KLIM's IT can shut off all its airbag vests, everywhere).

https://twitter.com/TrashGoat00/status/1387301889356689410/photo/1

If that sounds extreme to you, it's really not. Tesla has many safety features that are marketed as downloadable content, which it remotely deactivates when a car changes hands through a private sale:

https://www.theverge.com/2020/2/6/21127243/tesla-model-s-autopilot-disabled-remotely-used-car-update

If you find yourself scrambling for reasons that it's OK for Tesla to do this with its cars, but not for KLIM to do it with its airbag vests, allow me to gently remind you that Tesla owners are not an oppressed religious minority, either.

This kind of rent-seeking is just getting started. As I tried to illustrate in my novella UNAUTHORIZED BREAD (part of my 2019 book RADICALIZED), there are limitless ways for Apple's pioneering business innovation to destroy our lives:

https://arstechnica.com/gaming/2020/01/unauthorized-bread-a-near-future-tale-of-refugees-and-sinister-iot-appliances/

And as I wrote in my story "Sole and Despotic Dominion," this is a frontal assault on the idea of personal property - it creates a world where property is the exclusive purview of remorseless, transhuman colony organisms (AKA corporations).

https://reason.com/2018/11/17/sole-and-despotic-dominion/

However, that future is anything but assured. Apple is being sued by Epic for antitrust violations over its Felony Contempt of Business-Model system:

https://www.nytimes.com/2021/05/02/technology/apple-epic-lawsuit-app-fees.html

And European competition regulators have opened an enforcement action against the company on the same basis:

https://www.cnbc.com/2021/04/30/eu-says-apples-app-store-breaches-competition-rules.html

Meanwhile, copycats who created their own Felony Contempt of Business Model walled gardens, like Valve did with Steam, are facing their own lawsuits, courtesy of Wolfire:

https://arstechnica.com/gaming/2021/04/humble-bundle-creator-brings-antitrust-lawsuit-against-valve-over-steam/

We've come a long way in a decade, and the No True Scotsman defense of the right of a dominant corporation to interpose itself between buyers and sellers, to control its customers' choices after a sale, is finally facing a real challenge.

https://locusmag.com/2021/03/cory-doctorow-free-markets/

[solomonish]

Naamah’s “Match-Up” That I Made Needlessly Complicated!

IT TOOK ME A WHILE BUT I DID GO CRAZY AND STUPID

hewwo @baalism I made u......less of a match up and more just headcanons on how u date the people. i hope u like it <3 I divided them into tiers depending on how well I think they mesh w you too!! so here you go!

TOP TIER (NOT kissing up 2 u!)

SATAN

I think Satan is your #1 man because the two of you just seem to be.....kindred spirits. (I am calling you the same as Satan but like as a compliment?) Y’all got that academia vibe to you with your books and your museum dates and your air of mystery. You two are the hot nerd squad is what i’m saying

Plus Satan is a social butterfly! He’d not only like the quieter moments w you but also when you went dancing he could either be living it up with you or making new connections (although. if he was going to the club why would he stray from the main attraction? make it make sense)

And with him that trust would be super easy to get bc if you’re dating him, HOO BOY. He’s got some Issues but he trusts you to help him get through them! There is a lot of him that feels prickly and dangerous and if you don’t shy away from that and can help him through it then you have his heart! As long as you aren’t ripping his attention away from a thrilling chapter, he’s a great conversation partner too. His quiet nature at first is NOT shyness, it allows him to be observant!! You are one of the few who get the chatty inside ^u^

Plus he loves ur cat and will be on her side when she screws with your puzzles.

SOLOMON

THE ONLY REASON he is not number one is he’s a bit too much of a wallflower to be into the partying like Satan would be. Otherwise....hot nerd squad two electric boogaloo

Is a bit more down with the witchy outdoorsy stuff and the occult and the abandoned place exploration thing than Satan would be. I bet one of his favorite things to do is take u to an abandoned building and after being there for a while when you start to get bored, he enchants it to look like the inside of some old castle and you dance together or something :) memories for u

isn’t always super chatty but is great for listening to you rant. he makes up for his lack of chattiness by asking the perfect questions to get you fired up again, so your ranting takes up most of the time. loves to pick ur brain, so you can talk about anything. he’s like: i want to dissect that smart lil organ of yours. lovingly <3

keep your sudoku puzzles up or he will mistake your books for his and do them for you. the image of him sitting cross legged at an armchair like some grandpa is nice but those are your puzzles!!!! but he’s very good at being domestic, just make sure to ALWAYS cook or bake with him!

LUCIFER

Listen, I hc Lucifer as like kind of a wallflower, but even if i’m wrong, he’ll still not be partying with you a lot because he’s busy! of course doesn’t stop you from going out if you want just be safe pls he lovs u

will take a walk with you every day all the time. After dinner before he goes back to work, he’ll take a little stroll with you. when he has time he’ll go for longer ones and show you some off-beat or decrepit devildom areas but he will absolutely just go on little walks with you every day to catch up with you!!

lives for the domestic moments. you bring him coffee? he is glad to be yours! walks in on you doing laundry? how luck he is to have someone so capable <3 he’ll help you fold the rest of the load or will make sure to talk with you while it’s his turn to make dinner (but will make sure you don’t have to help! you deserve a break)

finds your interest in the arcane kinda funny because he IS the arcane but supports you <3 will listen to you list off what you know even if he also knows because he likes hearing what you’ve learned and you get so excited about it! he will return with his own spells and potions you might not know yet and you two could go on for hours about it.

HIGH-MID TIER

ASMODEUS

His interests align with your! Fashion, beauty, partying!! He loves it. LIVES for it. you two are an unstoppable force.

However....the academic/witchy stuff doesn’t suit him as well as the other stuff does? He’ll whine about you “being a satan” or “being a solomon” if you tread too far in one direction

he’ll work out with you though and buy you cute workout gear <3

a relationship with him is less emphasizing trust and more about intimacy (but you can still trust him yknow?) he makes your connection known by demonstrating it plainly rather than feeling like a safehouse, if that make sense? but he does love u to pieces!! remember that

BEELZEBUB

he wants to eat ur cupcakes this is my main reasoning and also NOT a dirty joke

if he goes partying w you he acts more as a personal bouncer and will circle the crowd like a shark for u <3 also great to bring you home if you’re drunk

he likes taking walks and hiking and being active with you! he does have to slow down so he doesn’t overexert your human body but he doesn’t mind because he’s having fun!

v sweet with the domestic stuff, just not great at cleaning. he just leaves crumbs over the floor he just cleaned :/ thinks u look cute in an apron tho

DIAVOLO

AHHHHH he thinks ur so interesting! so well rounded :0

also it’s good that you’re into witchy stuff! that made your transition to the devildom a bit easier huh?

absolutely loves how eager you are to learn because that’s what you need for the program to succeed! and you already know so much.....you would make.....a very knowledgeable..ruler....of the Devildom.....ahem.....

the above are used to physical affection but could back it up with some mistakes but Diavolo doesn’t get the chance to give affection so whatever ur comfortable with getting he will channel it all in to that!! gifts or words or whatever!!!

but if u give him a lil smooch he will be !!!!!!!! it just feels nice

AN ANOMALY

BARBATOS

I don’t understand this fucker (affectionate). IDK if I can’t place him bc I don’t know him that well or just because he refuses to be categorized but! he is here. perfectly in the middle. taunting me.

idk ur academic prowess is preferable because he wants someone who can keep up with him. and ur interest in spooky stuff works well bc he’s a demon and if he were a human he’d like the occult too.

can’t really go clubbing or take you very many places bc of work :/ he can do strolls around the garden though! or walk you home from places :)

good with the not initiating physical touch because he can shapeshift into whatever you need him to be. an anomaly indeed.

LOW-MID TIER

SIMEON

he respects you :)

finds your academic pursuits inspring! your interest in the occult is a bit off-putting at first but you all are in hell so who is he to blame?

loves to collect your witchy stuff with you <3 knows a lot about safe to eat fruits so he’ll be collecting things for a fresh strawberry pie while you collect what you need to summon lucifer without a pact even though he lives in ur house and you HAVE a pact. 

you can bake the pie together though <3

BELPHEGOR

he does not respect you :)

finds your occult pursuits inspiring! your interest in excelling in academics is a bit off-putting at first - why would you choose to put more work in when you can jsut vibe and pass bc you’re an exchange student?

(ok i’m done making this the inverse of the above lol)

not the most chatty or the most workout-y or patying-y or anything BUT he can be a little domestic. you do the cleaning and he can cook once in a while! and he’ll make the bed! and then he’ll sleep in it immediately. but he’ll be wishing you were cuddling with him the whole time <3

LOW TIER

MAMMON

he’s got the energy but not the respect

unlike the way belphie disrespects you, mammon does it just bc you’re incompatible :/ but like in the nicest way possible

he interrupts when he’s chatty and he’s not the type to hang out with nerds and like. he’s too scared to get into the occult and abandoned buildings.

he does love you to bits! just....not in the way you want. sorry mams :/

LEVIATHAN

he can get chatty for sure!!

but he just does not have the energy to match your academic pursuits or your outdoorsy interests or clubbing or beauty or any of that. 

ok MAYBE the enrd stuff but like only a little! too much and that’d make him a normie >:(

y’all trust each other a lot tho! just as henry and lord of shadow, like friends. not a significant others

OKAY i didn’t burn myself out!! i hope you like this and agree maybe? hehe this was fun

[incorrect-ikevamp-quotes]

May I request GHJPU for Sebastian? Sebby needs more love :D (eee sorry if any of this overlapped or its too much, have a cookie for your troubles 🍪)

DID SOMEBODY SAY LOVING SEBASTIAN HOURS!?!?!?!?! FERAL EYE GLEAM

Bless your heart!!! Sebastian has found a new and very dear place in my heart as of late, I would be delighted to offer my thoughts!!!!! :D (your cookie offering has been accepted with the utmost glee 🍪, I hope my humble writing efforts will bring you equal joy, lovely~💖💖💖) 

G = Gifts (How does he feel about gift giving? What are his habits when it comes to this?) 

Awwww haha, baby boy Sebby is honestly a very observant and reliable kind of S/O, I think. He will notice even the tiniest of changes in MC’s expression--the slightest shifts in her temperament. As a result of his attentive nature he has an easy time deducing the things she might like, always makes a mental note of where her eyes linger. Is there a classic she once loved in her time being published for the first time in their era, on display at a bookstore nearby? Noted. Does she hover near shops filled with self-care products--things like scented candles or lotions or bath salts, things she considers indulgent luxuries? Noted. Is there an outfit that caught his eye in a boutique, something he thinks would complement her complexion perfectly? Noted. 

The thing about Sebastian is that his gifts will be heartfelt, timely, and devastatingly thoughtful. Whether something small or something lavish it will always be precisely what she needs/wants, and she can sense the loving care he put into finding the perfect gift.

H = Holding Hands (When/how does he like to hold hands?)

Honestly? Sebastian has spent the better part of his life alone. His circumstances weren’t the worst; for all that he’s lost in his life he never went hungry, lived comfortably. But...that doesn’t change the fact that his life has been fairly devoid of meaningful human contact. Even in college, friends and close colleagues were hard to come by. The few people he did develop budding feelings for he always gave up on long before it could become any kind of substantial relationship. He was always the type to admire from afar, never really felt worthy of the people he liked.

It was MC that was the first to reach out to him, and for the first little while in their relationship she will be the one most naturally inclined to reach for him. He isn’t really used to having someone by his side like this, somebody who would be delighted to hold his hand--who wants to be close to him. It’s always a shock when they go grocery shopping and he just feels her fingers wrap gently around his. She blushes a little and says something about not wanting to get separated, but it’s clear what her real motivation was.

After those first few months, it becomes much more natural for him to reach for her hand when they’re traveling somewhere together or when they’re alone. He likes to intertwine their fingers, loves the way they fit against his perfectly. His shyness wears off after a while, and it’ll be rare to see them together without them holding hands--unless they’re cooking or at work.

J = Jokes (Does he like to joke around with or prank her? How?)

Do you know how cats have their eyes all narrow thin pupil but then they go REALLY REALLY round? That’s Sebastian. I tend to refer to it as “Silly Time Mode Engaged.”

Now then, his kind of joking is very dry and very deadpan. It’s subtle and immediate, so if you’re not attuned to it it can be easy to miss. That, or people just look at him weird because they don’t quite get the connection he’s making and/or the delivery feels off because his facial expression doesn’t change at all, completely flat. That being said, one of his all time favorite things to do is to say something absurd or nigh histrionic (which tends to be uncharacteristic of him) and wait for the confused head turn/startled laughter to hit. He will make puns and play on words all the time--he puts his academic knowledge to good use.

“I swear when I first met you I was convinced you were an AI.” “Alexa taught me everything I know.” He’ll bow. “Oh? Do I have competition, in that case?” “Your speakers are suboptimal (he pokes her freckles), but you possess what Alexa lacks.” “And that would be?” He’ll gather her close, smiling against her lips. “My heart.” :D cutest robot I ever saw uwu

Bonus bc I have a problem: “Is stealing hearts in Alexa’s programming? Just to be safe, of course.” “I think it’s safe to say it isn’t within the parameters of her design--but that doesn’t mean you’re out of the woods just yet.” cue sounds of tickling and laughter

The other way Sebastian messes with MC is that he is an ENORMOUS tease in the bedroom. He’s very much the kind of lover that prefers to tantalize and draw things out; a long, slow seduction that will render MC immobile from the pleasure by the end. The promise of a kiss is almost always only a whisper of the feeling he intends to drown her in. Remember that Sebastian’s stoicism belies a nigh inhuman ardor and self-control. He’s more than willing to leave her wanting in order to fully capitalize on that desire later at night.

P = Pet Names (What does he like to call her?)

Other than her name? HE DOESN’T AHAAHAHAHAHA Just kidding of course, but given where he comes from pet names between couples aren’t...really a thing…(take it up with Japan, I Was Today Years Old, my sappy romantic ass would never survive)

The funny inverse of this though is that he does NOT fuck around with people that try to call MC pet names. When Arthur Tries It™ he canonically goes all steely saccharine, openly telling the others they’re together. So none of that “luv” or “doll” business, he will not have it (he won’t fight the purebloods on it because 1. they’re more like doting grandfathers than anything and 2. Sebastian does not have a death wish). If MC has a nickname of some kind, then I could see him using that or adding his own spin on it with a great deal of affection c:

U = Upset (How does he act when she’s upset?)

Whether he was the cause or not, Sebastian has a single modus operandi when his beloved is upset (and to anyone who’s upset really) and that is to offer gentle reassurance/an apology. He is very, very sensitive to the feelings of others and really takes it to heart when someone isn’t feeling well. That being said, he won’t always be overt about his concern--he’s more the type to do little things that offer constant support/reminders that he’s there for them. 

If it’s something more serious, he will do everything in his power to minimize the harm done and sooth the MC. His attempts to comfort her will be tender, muted, and consistent; prolonged hugs, doubles his offering of sweets, makes her favorite foods, gives her a relaxing bath salt to use--anything that he knows for certain will coax her lips up into a smile. He’s the type to freely offer space for her to figure things out if she needs it, but he will also be watchful; he won’t let things escalate if she needs externalized support to heal (bc lbr some problems we can’t solve alone ;-;).

His other go-to method is to offer distractions in any capacity that he can. Will offer to teach her a new recipe, or find a new type of flower he wants to plant together, or make up some kind of project he needs help with. Sometimes he’ll genuinely need the help, but most of the time he does it for the express purpose of getting her mind away from negative things and focused on him/the present. It’s hard to dwell on upsetting things when you’re body is physically demanding something else from you, even more so if it’s a fairly complex task. She’s known to be very dutiful; she’ll be so focused on doing a good job she’ll forget the sadness/irritation for a bit and the intensity of the emotion might ebb slightly.

If the issue is lighter, he’ll probably just cuddle/tickle her back to fighting spirit, pressing kisses wherever he can reach until she starts giggling. In these instances he prefers to hug her from behind, a reminder that she doesn’t have to face anything unpleasant or unnerving all on her own; he’ll always be there to hold her steady whenever she needs him. 

And rest assured, this man is always gathering data to optimize his comfort capabilities. He is incredibly adaptable, and will always be watching her reactions closely to adjust his strategies.

[illkickyourbass]

henlo. have an expanded Shining Quest AU.

to release some steam from my kettle of stress, have some noodling about a Shining Quest AU that’s less April Fool’s, more high-stakes high-fantasy, but still every bit as tropey, stuffed with otome trappings, and Yay Music as we’ve come to expect from Utapri 

As with the last venture into this AU: not explicitly romantic, non-gendered MC, SFW, and mild CW for arranged marriages. I don’t know HEAVENS (plus they didn’t get canon classes for Shining Quest), so we’ll just be covering STARISH and Quartet Night! 

It’s a fairly typical setup -- there’s a fantasy kingdom, there’s a useless king, there’s a princess (Haruka) known for her talent for music composition, there’s a court of nobles and royals, all that usual hey. Magic is cast by mastery of the arts, whether that be visual, performing, musical, written, you name it. 

There’s a looming threat of some sort of demon king or similar fantasy anime bullshit that the royals and nobles of the kingdom are tasked with keeping at bay. We’re also gonna shamelessly borrow a detail from the pinnacle of wasted potential, the movie Rock and Rule -- there’s a plot point about how a demon can only be forced back with “the magic of one voice, one heart, one song....but there is no one.” Here in this ‘verse, that’s a longstanding prophecy the status quo has taken to mean there’s no-one who’ll ever be able to defeat the demon king. 

The solution that’s been in place for as long as anyone can remember is a royal or noble family offers one of their heirs as a sacrifice to be married off and sate the demon king for that generation-- the “devil’s bride” or “devil’s groom” or “devil’s betrothed.” This goes pretty badly for the heirs, of course, but it offers great prestige to the house that does it. 

You, the player, would get to pick what RPG class you fill (which would affect some dialogue trees and the expertise you demonstrate) and what art you use to cast magic. You are a member of the royal guard tasked with Haruka’s protection, but you’ve stumbled into the knowledge before it goes public: she’s the next devil’s bride! You go to Tomochika, a hired hand to the royals who’s been dating Haru in secret, and you begin to hatch a plan to bust Haruka out of the arrangement. 

Your route’s then determined by which of the boys you seek out as your other co-conspirator. 

Otoya is a fellow member the Royal Guard on Haruka protection detail. He’s equally resented and well-liked for his dauntless optimism and natural talent with swordsmanship, but it’s no secret that he’s not someone you’ll be trusting for expert strategy. He’s had the chance to become friendly with Haruka, and he’s ready to fight tooth and nail for her freedom! He’s classed as a warrior, who casts light-element attacks and healing spells with his music. 

Masato was raised from birth to become an ideal Devil’s Groom, since the Hijirikawa nobles are falling out of favor in the courts (spurred in part from their takedown of the Kurosakis backfiring on them). But Masato has rejected that he (or Mai) will ever go along with that plan, instead intently training in swordsmanship and fusing music and fiber arts to make enchanted fabrics that work like armor. Quietly, he has kept a very ambitious goal in mind: outright defeat the demon king and end the legacy of the devil’s betrothed. 

Natsuki is a natural genius at using both his voice and viola to communicate with creatures and summoning the cutest ones to absolutely wreck house. Though a humble farmboy who’s kind of out-of-touch with the political goings-on of his land, his talent was too great to go unnoticed forever, and he was invited to live among the high court as an entertainer and summoner. He got to make so many new friends (like the princess and you!) and better provide for his family, so he’s thankful every day for the change, even if he misses his animal friends at home! 

Tokiya came from a humble family that wanted to lead a quiet life, but Tokiya himself had ambitions that far outpace that. Though not a natural talent, he put unimaginable sweat into a field that creates potent spells and tools by the power of song. Eventually becoming estranged from his whole family, Tokiya finds it all worthwhile after struggling his way into being hired by the royals. Much of the court thinks of him as a weird mad scientist who sings to his books, but he’s found fast friends he’d go to the ends of the earth for, like Masato, the princess, and you! 

Ren is the inverse of Masato in his circumstance. Like the Hijirikawa noble family, the Jinguujis helped orchestrate the fall of the Kurosaki nobles, but the blowback had them falling out of favor instead of rising in power. Ren was planned to be offered as a Devil’s Groom to restore some clout, but instead of being intently groomed, he was left to do whatever he wanted since he’s got such a foregone future. So Ren becomes a carefree playboy, eventually taking his talent for alchemy and becoming a for-hire adventurer to sate his boredom. He tells everyone his saxophone is his secret to brewing his one-of-a-kind love potions, but he’s actually devised some uniquely remarkable revival and buffing potions.

Syo comes from the same backwoods as Natsuki, but took less interest in working for the courts and instead trying to find a career emulating his childhood hero that kept his body’s limits in mind. But his twin left to pursue medical schooling, and eventually, between loneliness, worry, and the promise that the musical magic and medicine in the courts could help him safely push his limits, he follows Natsuki into the belly of the royals and nobles. His small stature and commitment to the movement arts made him a natural rogue, and he’s technically part of the Royal Guard’s special ops. But Syo’s brashness and burning spirit tends to best serve motivating the people around him -- what few spells he prefers to cast with his violin-playing are all buffs that lift the spirit and energize the body.  

Cecil came to this land on essentially a study abroad program and came to love the friends he made so much he stuck around! A wildly talented sorcerer able to cast even without playing his flute, Cecil is held in high esteem by the whole kingdom for the knowledge and skill he has to offer. Prone to disappearing, however, since a curse has him transforming into a cat as an occasional side effect of casting magic. He’s found this useful, though -- something injust he won’t stand for is afoot in this kingdom, and nobody suspects a little black cat of eavesdropping! 

Reiji is a court jester who loves, loves, loves nothing more than to make you smile! Much of the court takes his good cheer for granted, and even more underestimate his prowess in tough/delicate situations, but the most powerful folks know he’s just as sharp as he is goofy. When he’s not doing his job making people smile, he’s often helping or promoting his family’s pub or bugging his friends from outside the royal court. His flashy performances and maraca-shaking have been shaped into a great conduit for spells of transmutation, though he tends to use them to put on a great show more than beat ass.

Ranmaru is the eldest son of the disgraced Kurosaki nobles (whose power and legacy were ruined by the Jinguujis and Hijirikawas as per usual) but he decided to bear the brunt of the damage in wake of his father’s passing to spare the rest of his family. Shouldering massive debt, Ranmaru disappeared and re-emerged as the gambler prince of the underground, now incredibly powerful in his own right. Not-so-secretly a big softie, he’ll swindle and ruin the lives of those who take advantage of the helpless, even operating out of a pub owned by an old couple that needed some protecting from loan sharks. Ranmaru wears special runed gloves that store mana when he plays his bass, letting him cast a set number of fire evocation spells before his next recharge. 

Ai lives in woods on the outskirts of the city. Most regard him as a hermit, but a couple know that Ai is actually a homunculus that has been refining his understanding and performance of humanity and needs frequent breaks to “recharge.” Nominally a ranger, Ai’s skills lie in his powerful patience and observation moreso than his bow and arrow, though he and Reiji have an arrangement where he helps hunt and forage ingredients for the Kotobuki pub. Ai is beginning to grasp his own unique sense of humanity and is ready to take grander action to realize it. He fights with arrows of a special alloy that react to an instrument at home; they are tempered by the sound and blessed by the wind to never miss their target should the wielder be skilled enough. 

Camus is an assassin that lives in shadow. Nobody’s quite sure of his intentions or allegiances, but the few times someone does see him in the open, he’s as haughty and demanding as ever. Rumor has it that he lives in the royal castle -- certainly, their enormously increased sweets output would imply such, and it’s well-known in the castle that unexplained cello music is usually his doing -- but he’s such an evanescent and terrifying presence nobody’s quite sure (and is too scared to ask). His assassinations are almost impossible to track, as his blades of ice melt, disappear, and leave no trail to follow. 

Typical route stuff goes as you’d expect -- you progress the plot, you get closer to your chosen boy, some political intrigue things probably happen, some heart-racing events etc. etc., and before you know it the two of you are very close and realize that your arts cast wildly powerful magic when put together. Slowly, you gather more friends (a selection of the other boys + Haru and Tomo) and find that together, your work amplifies in power to unprecedented degrees. It’ll vary from route to route how you get there, but eventually, you all come to the same conclusion: it’s time to kick some demon king ass. And you do! 

The ends vary from angsty (like the player or the chosen boy is mortally wounded or dies) or fairytale fluffy (go off and spend a happy life together) or something more power fantasy-feeling (like you and chosen boy revolutionize the whole kingdom for the better in wake of the demon king’s defeat), etc. -- but no matter what you know that your art + your boy + the power of friendship kicked more ass than anything Shining Kingdom has ever seen! 

[whitehotharlots]

TERF war

I took feminist lit and theory courses as an undergraduate, in 2003 and 04. For the time, the courses were incredibly trans inclusive (bear in mind this was a year before Jon Stewart would dismiss Dennis Kucinich’s suggestion of appointing a trans SCOTUS justice, referring to the hypothetic appointee as “the honorable chick with dick”). A good 20% of the course was dedicated to reading books by and about trans people. We even got a visit from Leslie Feinberg—the person who literally coined the term transgender, and one of the kindest souls I’ve ever had the pleasure of meeting.

The foundational, explicit understanding I was taught in these classes was that biological sex is innate, a fixed fact of a person’s bodily being, whereas gender is a fluid and malleable social construct. No one could have gotten through these classes thinking the opposite.

The utility of this understanding is easy to grasp: by denying the fixity of gender, feminists were able to undermine social and interpersonal structures that had traditionally denied women freedom, choice, dignity, and agency. A woman was not biologically destined to a life of domestic servitude; nor was she naturally inclined to be more submissive or deferential. Most germane to this discussion, this understanding validated the existence and experience of gender non-conforming lesbians: just because they were not traditionally feminine didn’t mean they weren’t women, or that they were in need of any fixing.

Very recently—within the last 5 or 6 years, as the abstract language of feminism has permeated the wider culture and gotten watered down for sake of digestibility—the poles have shifted. Now, we are told, it is actually gender which is fixed and innate, a metaphysical force lurking within us, suppressed by social pressures, unleashed gloriously with the aid of surgery and supplemental hormones. Biological sex, meanwhile, is a construct that doesn’t exist and shouldn’t even factor in to one’s analysis of gender relations. Sex is hereby an utter fabrication, a projection of the sick evils of normalized (cis male) consciousness engrained upon people’s erstwhile blank bodies.  Taken to extreme, we are told this therefore means trans women can get periods and that there is “literally zero” difference between trans and cis women. Ergo, having a uterus doesn’t make you a woman, biological or otherwise—it simply makes you a “uterus haver.”

The utility of this shift comes from the fact that trans self-actualization relies not just on social positioning but on bodily experience. Trans peoples’ mental wellbeing often hinges on their having access to the medical interventions required to get their body to conform to their innate sense of gender. Since we live in a country where few people have access to basic healthcare, trans people have had to medicalize their position—assert a fundamental and harmful mind/body disconnect—in order to have these interventions regarded as essential, rather than elective.  

So while it’s perfectly understandable and useful, this shift nonetheless represents a profound upending of decades of feminist thought, and I’m shocked that it doesn’t appear to have even been deliberated upon. It was asserted through tumblrs and tweets and everydayfeminism dot com posts, everyone kind of nodded their heads in agreement, and that has been that. For the most part.

Now, we might able to say that the reversal is simply academic: trans people and cis women each need to advance their respective theories of gender and sex to serve as the basis of political programs that might afford safety and respect to each group. There’s no need, necessarily, to concern ourselves too exclusively with the details. Consider a parallel: anyone who was actually involved in theoretical side of gay rights in the 70’s-90’s knows that saying gay people were “born gay” was not a universally agreed upon assertion. Many argued that this was essentially a reactionary frame which stigmatized homosexuality, making it seem like gays would have chosen to be straight if only their brains or genes hadn’t screwed things up. Eventually however, the “born this way” line prevailed, became mainstream, and was the basis of most of the gay rights campaigns of this century. Most of the people who disagreed with it on academic grounds still supported it, at least publicly, once they became aware of its political utility. Why can’t we do the same with today’s split conceptualizations of gender and sex?

Seriously, why can’t we?

The sex/gender-fluid/innate reversal came around the time when trans people started receiving their first regular, non-dismissive appearances in US media. This was the first time most people had been bothered to think seriously about gender, and the first time that the existence of trans people was admitted to as something that wasn’t freakish or a punchline. That’s a huge positive, obviously. And it happened with surprisingly little mainstream pushback (compare the responses to Laverne Cox’s appearance in Orange is the New Black with the intense outrage that accompanied Ellen Degeneres coming out just 15 years earlier—the difference is astounding).

This is where things get troublesome. Many established feminists, especially second wavers, were upset to see their life’s work upended in such a way. Some reacted horribly dismissively. Others wrote thoughtful, seemingly even-handed pieces that nonetheless seemed calculated to subtly dismiss the experiences of trans people, like by repeatedly misgendering trans authors. And still others respectfully expressed objections to or concerns with mainstream trans rights assertions. These writers tended to operate in either academic or upper-middlebrow spaces, and their prose is consequently calm, erudite, and often super dense. The rebuttals to these pieces came from places like jezebel, loveisarainbow dot com, or geocities.com/sunsetstrip/3765/madtransbitch. These pieces are easily digestible, frequently angry or even violent, and hyperbolic without exception, accusing the cis feminists of fomenting or even committing violence against trans people. In the court of woke public opinion, the second wavers did not stand a chance. They were accused—sometimes rightly, sometimes wrongly—of abject hatred of trans people, blamed for suicides and murders, and grouped in with the racists and homophobes of yore. Within a very short period of time, those who haven’t learned to be quiet have been shunted away to the darkest academic backwaters (or they live in the UK, where university cultural studies is dominated by second wavers).

But, again, why not just be quiet? Honestly, that’s my preferred approach. Maybe it would be different if I had based an academic career on one assertion over another. But overall it seems like both groups should still be able to pursue their own political agendas on their own terms, so why bother discussing this contradiction? And just on a personal (that is, cowardly) note, I might not agree that biological sex is a construct, and I certainly don’t think gender is innate, but I also think trans people should have easy access to medical intervention, so why not let the inversion stand? 

But herein lies the problem: politically, the two groups are not separate. One of the most frequently levied criticisms against certain feminist authors and movements is a lack of trans-inclusivity. Pink pussy hats were verboten within hours of their debut. Colleges have cancelled productions of The Vagina Monologues (not because it’s overwrought treacle, but because it talks about vaginas, which makes it de facto transphobic). These incidents may seem trifling by themselves, but they serve as avatars of a very real and important conflict: cis feminists are being demanded to center their feminism in an understanding of sex and gender that directly contradicts the base of their ideology. Because of this, actions and symbols that were recently taken as signs of love and solidarity are now being cast as hate speech. Cis women are being told, literally, that they have no right to call themselves women (trans women are “women,” cis women are “menstruaters”). Cis lesbians are called homophobic for not being attracted to people with penises. In short, a trans movement that purports to dedicate itself to ensuring that its purveyors be given the right to be recognized by own their self-understanding is doing so by denying that same right to others.

The only possible result here is a complete collapse anything resembling a unified feminist movement. Meaning, I guess, that it fits in perfectly with the atomized understandings of social justice that stem from internet-based discourse. I suppose I could end with a plea for decency and understanding, perhaps even outline a alignment that would allow for trans advocates and cis feminists to recognize tactical points of departure from one another without fear of committing literal assault or denying the existence of one another. But we’re past that point, I think. There’s no more space for humane liberalism. Everything’s a knock-down, drag-out these days. We don’t even pretend to want to help one another.

Addendum:

People are raising the fair point that a vast majority of trans people don’t subscribe to the sort of wrecker beliefs I outline here. That is absolutely true and part of what makes the shittiness of online gender discourse so tragic. I did not mean to suggest that these beliefs are at all common among trans people. I intended to criticize only the shitty woke media apparatus (everydayfeminism et al) that occludes any attempt at effectively theorizing gender because it prioritizes hyperbolic victim mongering over achieving political goals.

[thesinglesjukebox]

TAYLOR SWIFT - YOU NEED TO CALM DOWN

[3.65]

The one that's on our mind, 365, all the time...

Will Rivitz: The Singles Jukebox -- Corrections, June 21 2019: The author of this blurb has previously stated that the selection of Meghan Trainor as LA Pride headliner would forever be the nadir of Pride-related programming. The author regrets the error. [1]

Joshua Copperman: The discourse for "ME!": "What does this mean for Taylor's next era?" The discourse for this lyrical clusterfuck: "What does this mean at all?" It's a much more interesting production, without stock horns and with some nice "Royals"-y vocal layering, but it's the most incoherent thing she's ever released. Is it about stans? Is it about homophobes? Is it a coming out song? Did Taylor throw the first shade at Stonewall? What is HAPPENING?? I'm sorry, I need to calm down. [3]

Will Adams: Taylor said "Gay Rights!" Kind of! Sort of. Well... it's complicated. Not necessarily because of her status as a cis straight woman, but because the message itself is so damn muddled. Stans and trolls and bigots and music journalists are lumped in the same mass of "haters," and while it's worth noting that this by no means the first anti-haters pop song to exist, the overt political text here results in lots of crossed wires. The song suffers as a result too, throwing half-formed catchphrases at the wall to see what sticks: the chorus is a melodic void (odd considering Taylor's songwriting strength); the "gowns" reference is too subtle to register; the patter results in odd scansion throughout ("like it's PUH-trón"); and "snakes and stones never broke my bones" is no more clever than "don't need opinions from a shellfish or a sheep." Speaking of Katy, also wrapped up in all this is a resolution of a beef that never seemed that important except as something for either party to mine for big single launches. It's all too much, especially for a not-bad track that fizzes just fine on its own. It'd be churlish to ask Taylor to take her own advice; for now all I ask for is coherence. [4]

Jonathan Bradley: Taylor Swift has always had a talent for deploying sharp and piquant phrases, the sorts of lyrics that tell blunt little stories like animated gifs. It's an opportunity for her to go broad and get funny: "Some indie record that's much cooler than mine," for instance, or "I can make the bad guys good for a weekend," or "I don't love the drama, it loves me." "You Need to Calm Down" is like an entire song built from these lines, and it whirls by like a Twitter thread or an Instagram story. Taylor sass is a lot of fun, and many of these ripostes are satisfyingly catty in their insouciance ("I'm just like, 'hey... are you OK?'" might be the best of these). Swift has shrugged off detractors on "Shake It Off" and "Mean," but she is more single-minded this time, and that focus paradoxically dilutes the intent. Swift's greatest strength as a songwriter is her interiority; she's adept at examining and interpreting her own feelings. But a consequence of that is that she is far less certain when she needs to step outside the bounds of her own head. The worst song she has ever released was a charity single called "Ronan," in which Swift sung in the voice of a mother who had lost her child to cancer; so talented at realizing her personal traumas, she proved incapable of reconstructing her sympathy for that bereavement in her own voice. "Calm Down" has some things to say about homophobia, and in this terrain outside her own experience, Swift's words are not so much unpleasant as awkward and a bit superficial, particularly in their uncertain invocation of "shade" as bigotry. (If stan theorists needed evidence that Swift is indeed as straight as she publicly presents, it's here: a queer Taylor would not have written a second verse as disengaged as that one.) But even diluted, Swift singles are still constructed tight. This one continues finding the pastel inversion of Reputation's skeletal synth sound, and echoes "ME!" with a hook of vowel sounds as palilalia -- "oh-oh, oh-oh, oh-oh, oh-oh..." this time, rather than "me-hee-hee." It's a tic that works -- in moderation. [7]

Alex Clifton: (Puts on music critic hat) It's stronger than "ME!" (which isn't hard but worth noting), I'm glad she takes swipes at homophobia but equating that with personal shots is a little bit weird, it's super catchy but the lyrics are still a little lacking, and I still can't remember all the words even though I have the melody memorized. (Takes off music critic hat, puts on bisexual Swiftie stan hat) EVERYTHING IS RAINBOWS AND MY BRAIN WON'T STOP SINGING THIS AND I WOULD MARRY TAYLOR SWIFT, HAPPY PRIDE!!!!! [5]

Alfred Soto: I'm sure it will sound fine on the radio, especially played beside "Bad Guy" and "Old Town Road." The maximalist intentions behind the Everest-sized synth bass and her rat-tat-tat delivery bespeak a mind that recognizes it's the one needing calm. Except for the "parade" line, I wouldn't have known this alludes to Pride if I hadn't watched the video. I don't feel pandered to as a queer man because, after all, a Pride parade is superficial performativity anyway. [6]

Katherine St Asaph: Give her this: the stacked-up arpeggio in the chorus is an absolutely brilliant hook, particularly the second time when it goes over the top. The rapid-fire prechorus is pretty good too. But the beat is the same freezer-burned "Paper Planes"/"With Ur Love"/"Send My Love (To Your New Lover)" chill, the accents are so far from the right syllables they've filed a misSING perSONS REport, the conflating of trolls with professional critics with the literal Westboro Baptist Church is bad (as is the weird class shit in the video, as if you can't be anti-gay and present like a Pleasantville star), and all this was done much better on "Mean." [5]

Katie Gill: In a way, this song is hellishly brilliant. Taylor Swift has provided her standom with a weapon, something that they can wield against any form of criticism. Want to write an article criticizing the fact that Swift seems to put "homophobia" and "me having internet bullies" on the same level, the fact that the video tactlessly paints rural Americana as the enemy of LGBTQ+ people instead of the Mike Pences of the world, or the fact that the second verse leans way too close to the sort of tactlessness that only aggressively woke allies can pull off? Expect a flock of Twitter replies telling you condescendingly that "you need to calm down" and "you're being too loud," as people ignore the half-assed condemnation of standom during the song's third verse in favor of using Swift's lyrics as a cudgel against any perceived haters. For all that Swift is trying to shed the sneaky snake image, traces of it still linger between the lines. [3]

Edward Okulicz: The people who said "Heartbeats" by The Knife was the future of music were right in 2003, and based on this, have now been right for 16 years and counting. That enormous synth-bass takes a song that should have been awful on paper (ugh, a thematic sequel to "This Is Why We Can't Have Nice Things," which itself is why we can't have nice things, like good Taylor Swift songs), with the second verse featuring the worst lyrics Swift has ever written, and makes it frisky and playful. The "uh-oh uh-oh UH-OH!" hook is legitimately her best in years. Obsessing about someone is tedious, obsessing about those people is even more tedious, but for once, Swift sounds like she's legitimately above it, even if I don't think she knows what "shade" is. I wanted to hate this for its posturing, but I can't, because of the "uh-oh" bit. But just between you and me, I liked Katy Perry's last single more. [6]

William John: I'm always happy to hear songs that approximate the "Heartbeats" melody, and the layered vocals here sound lovely, but Dorian Corey didn't keep a mummy in her house for fifteen years for "shade" to be misinterpreted so flagrantly. [3]

Danilo Bortoli: Is it fair to demand political accountability from artists? The question remains thorny these days, but when Taylor Swift blatantly goes after pink money, the answer is yes, loud and clear. The case made for "You Need To Calm Down" has pulled the identity politics card (as usual, The Onion put it better). That is, Swift's song oversimplifies an ancient struggle for recognition, making up a narrative that isn't Taylor's to call her own. But what is more infuriating is the sugarcoating: the fact that pride should come only from within, and the naive and painful suggestion that a homophobe would go silent after a line as awful as "shade never made anybody less gay". That is to say, when it comes to protest, I prefer it the French way. Which is why all of this begs the question: Would you tell Richard Spencer to "calm down"? No, of course you wouldn't. [2]

Jacob Sujin Kuppermann: There are probably 2300 words elsewhere in this post about the politics and rhetoric of Taylor's words here (and I'll get to that), but first I feel obligated to talk about how "You Need To Calm Down" works on a purely musical level. It sounds like ass. It takes the bag of tricks that Swift used on "Ready For It?," the most musically captivating of Reputation's singles, and sands off all of their weird edges. Yes, there's a bass thump to welcome you in, but without the distortion it just sounds like Taylor's doing "Royals"-lite (I mean, Joel Little did produce.) And with the fangs off the verse, the lift to the chorus fails to land. It's all just sound, an undifferentiated, imperial wave of midtempo banger signifier without a real hook. Even Swift's vocals, which have always been her most compelling tool, can't sell the song's vibe -- she's confused not giving a fuck for calm. Of course, it's not entirely clear what "You Need To Calm Down"'s vibe, or point, even is. It's trying to be clever, with its winking references to stale LGBTQ and feminist symbology, but by conflating (or at least juxtaposing) those struggles with the problems that Taylor Swift has as a widely hated famous person, it ends up saying nothing at all. In the end, "You Need To Calm Down" is less a coherent song in itself than a Potemkin village to situate endless thinkpieces in. Make it stop. [3]

Ashley Bardhan: I know the title is "You Need To Calm Down" but there are no human words that can aptly describe how much I hate this song. Think of a young pigeon cooing as it flies through a fish market, weaving over and through the glistening crates of silver-scaled fish and ice. Oh no! There's a problem with a shipment! The owner angrily tosses a fat fish into the air, and its scales glint as it smacks the pigeon mid-air and onto the ground with the full brunt of its weight. The pigeon sees the fish market, its final flight, behind its closed eyes in a hurried blur. It weakly wheezes its final birdsong, and then... nothing. Yaaas, hunty. [0]

Iris Xie: 🤷 This is so tired, I can't even be that mad about it. The only question I have, because this song and MV isn't even worth a QTPOC-centered thinkpiece from me is this: when is the Post Malone + Swae Lee + Taylor Swift collaboration happening? This sounds so much like "Sunflower" and is just as deadening. Even the excitement of one of my besties sending me an ~*urgent*~ text message about Katy Perry and Taylor Swift making up over their imaginary feud, once they realized it hurt both of their fanbases, can't even ignite an ounce of care from me. (Bless your heart, my dear friend.) If she really wanted to pander to the gays, she could've just written a sequel to "Look What You Made Me Do" and become a slicker conduit for the less graceful parts about being in queer scenes, which can be about petty, messy drama, rather than being the subject of rage and apathy about being another harbinger of happy happy HAPPY gaypropriation. Like, whatever, she can have her extremely meaningless self-declared ally medal. I've been calm, just give me actual music. [2]

Isabel Cole: It's like this: A while ago I was catching up with an ex who mentioned he'd recently come back into contact with someone we'd known in high school -- acquaintance of his, frenemy of mine, a few sparkling months of giggling BFF-ship deteriorating across a year I spent defending her while she shit-talked my fashion sense in the girls' room to the local blabbermouth -- and he told me, with an ironic arch of the brow, that when my name had inevitably come up she'd said, "Isabel and I used to be so close; I wonder what happened." Reader, I spent like a week losing my mind, repeating the story and relitigating the history to anyone who would listen while bitterly making fun of her internet presence. Was this because I am petty and emotionally volatile? Yes. But it was also because there is a certain level of willful detachment from reality which I do not have the cognitive capacity to process adequately. Taylor Swift having the gall to tell any human on earth to calm down makes me feel insane the way it makes me feel insane to see someone citing as evidence of their incurable adolescent unpopularity the dorky AIM screenname they picked based on an affectionate joke I made. Taylor Swift saying "take several seats" makes me feel the same combination of spiteful and enraged as reading a line recycled from Livejournal in 2005: please learn like everyone else to disguise the extent to which the human brain is a machine wired to seek validation, the transparency of your desperation is making all of us uncomfortable! God, I wanna snub her in a lunchroom so bad. The song is unappealing in ways that barely merit mentioning -- verses that sound like they were reverse-engineered from a MIDI file of the superior but hardly sublime "Gorgeous," chorus that throws in the plodding piano of roaring bravery -- but even beyond the equivalency it implies between Twitter making fun of her and, like, hate crimes, I find the bridge particularly embarrassing, because of how artlessly it reveals its origin: Taylor Swift literally read a Tumblr post (or, the algorithm we call Taylor Swift processed several hundred Tumblr posts) from 2011 saying "stop pitting female artists against each other [handclap emoji etc.]!!!!!!!!!!!" and thought, Wow! Feminism! As for the possibility that this is another masterful turn from Taylor the troll (or troll!Taylor as there is a distressingly high chance she'd say) and by falling for it I've let her win: (1) Taylor Swift is always already winning, this is exactly what Marx was talking about (2) Let me kick it back to my ex one more time: when I asked what she was like these days, he considered and said: "I thought she'd developed self-awareness, but then I realized it was just self-identification." Yeah. [1]

Scott Mildenhall: You know sometimes, when you read the annotations on genius.com, how their deductions and inferences appear to have been made by algorithm? For instance, the notion that this being released on that loud American guy's birthday "seems to support the theory" that one line is about him? This is what would happen if that algorithm was tasked with writing a satirical song. [5]

Stephen Eisermann: My take? This is more lazy allyship than commercialization of pride. Plus, it's kind of a bop. Sucks, then, that Taylor completely misunderstands what shade is -- but did we really expect any better? [6]

[Read, comment and vote on The Singles Jukebox]

[rekindlingintimacyinmarriagepdf]

How To Restore Intimacy And Romance In Marriage - Men’s Edition

Relationship elements, a concise preliminary; the inceptions of outrage and closeness Marriage mentoring, treatment for melancholy, or relationship/life instructing is an interest in yourself or potentially your marriage. It appears to be that nobody shows us how to be a genuinely solid individual, or how to have a sound marriage. A few of us search out a mentor, or a coach, and when we do, we find that we have found something that we never knew existed. We find that being a sincerely solid individual or having a sound marriage is definitely not a strange or tricky thing that individuals just discussion about. It's genuine, and inside your grip. The time and energy you spend on yourself and your marriage is rarely squandered! Put resources into yourself and your marriage!

Connections can be fulfilling, and rather vexing and befuddling on occasion. Through our conversations you will learn numerous apparatuses, and to create and use these abilities to accomplish your objectives throughout everyday life, work and love. This article manages one focal dynamic seeing someone, with an accentuation on close connections. That dynamic is the connection between private emotions and irate sentiments. It is an antiquity of our very closeness that makes us have the option to all the while feel nearer then any other individual we know, and to battle like nobody else we know. This dazzling inconsistency appropriately made do with getting, regard, and responsibility, can and ought to be the wellspring of interminable satisfaction and a happy life as a couple. There is an extremely cozy connection between warm, close, adoring emotions ( Intimacy ), which is our objective, and cool, furious, inaccessible sentiments ( all the more frequently then we might want, the issue ). Those two sentiments may appear to be, and are, from numerous points of view perfect inverses. Nonetheless, they originate from nearly, precisely, a similar spot.

Those total inverse sentiments make them thing in like manner, passionate weakness. To incredibly shifting degrees it penetrates each connection we have altogether of our connections. It is generally predominant and applicable to our close connection, and subsequently key to our conversation of relationship elements. That weakness is obvious in both our caring private connections and our furious harmful minutes, it is the actual establishment of every one of our connections. Without some degree of weakness there is no relationship by any stretch of the imagination.

We as a whole have weaknesses. We are altogether powerless in light of the fact that not a solitary one of us is awesome. It is our decision to share or make ourselves powerless against someone else that brings session a relationship. How those weakness are overseen, is the thing that decides how close a relationship will be. Since not a one of us is great, we as a whole have beneficial things about us, that we are glad for and appreciate offering to other people. These weaknesses are ones that we have a sense of security to impart to a wide scope of individuals and we do only that when we meet another person and we are putting that best foot forward. Also, we as a whole have things about us that we are not so glad for, that we would prefer not recollect not to mention share with anybody. These things, are our greatest weaknesses and hence what causes us to feel genuinely passionate powerless. We are ordinarily exceptionally cautious about whom we endow this most delicate data with. It is just those individuals whom we believe the most that we will impart our greatest weaknesses to. We share these weaknesses, just with those individuals whom we wish to be nearest to. We convey them verbally and actually, in return for closeness, and in the long run, trust and love.

Notwithstanding passionate weakness, there are different sorts of weakness that are partaken seeing someone, there is scholarly weakness, where I share my considerations, abilities, thoughts, and arrangements. There is additionally actual weakness where I portion of my actual self, we like that one.... Passionate weakness, anyway is the key "flavor" of weakness that we need to concentrate on. This is on the grounds that it is the fundamental segment of each relationship. Throughout the course of time, as we share increasingly more about ourselves, it is additionally one of the essential things that dynamically brings us closer, and closer together. Appropriately regarded and oversaw, in time it bonds us together, as a sound and upbeat couple. In our personal connections our closeness/closeness develops through the sharing of weaknesses.

Passionate weakness is just 50% of what draws us together. Notwithstanding weakness to feel close, we should likewise feel great, or protected in sharing those weaknesses. In the event that we are not happy, or don't have a sense of security with another we won't share our weaknesses. In any case, when we do have a sense of security we appreciate sharing this data. At the point when we share weaknesses and we feel tuned in to, regarded, and really focused on, we start to feel close. These warm close sentiments feel so great that we are attracted to that individual genuinely and in time truly as well. The more we share with one another and the more secure we feel, the nearer we become. As we keep on dating one and other, there normally comes when we find that we can talk for quite a long time. We miss one another and long to be together once more. At the point when we are having these long distance race discussions we start to share things about ourselves that we are not so pleased with, in short our weaknesses. As I share this advantaged data about myself, and you tune in and support me, and offer to help me in managing these things, I feel regarded, heard, really focused on, and on schedule, cherished. Through correspondence and actual touch, we develop personal sentiments and eventually fall head over heels in love for one and other. Our inevitable objective is to impart all of ourselves to one another and in the end feel adored for all of what our identity is, blemishes what not. In this way, warm, close, adoring, personal sentiments originate from the capacity to feel genuinely powerless and protected simultaneously.

Closeness develops, as I depicted, thus does .... outrage.

Outrage starts at a point on schedule after some proportion of significant closeness has been developed. This is on the grounds that before any significant annoyance will show between us there should be some proportion of shared weakness. Like closeness, outrage originates from feeling sincerely powerless, however this time hazardous simultaneously. It begins with miscommunication, and resulting errors, at that point as examples create, correspondence diminishes, and feelings of disdain start to aggregate. These feelings of hatred will arrive at a sort of minimum amount and ruinous resentment arises.

Outrage is an individual, guarded, and on occasion dangerous dynamic, that runs its course by harming the ones I love. My displeasure shields me from you by making distance between us. The reasoning is moderately straightforward, in the event that I can make sufficient distance among us, you will not have the option to hurt me and I will be protected once more. Outrage makes distance in one of two different ways, possibly I drive you away or I eliminate my self from the circumstance, whichever way I reestablish my very own security, regularly to the detriment of our common or relationship's closeness.

Outrage shows itself as disappointment when I am attempting to control what I see to be a wild circumstance. Or on the other hand when a circumstance is considerably more constant in nature, by verbally and sincerely harming the ones I love, making at that point pull back from me. This is typically refined through the abuse of cozy, favored information I have about you. Weaknesses that were divided among us to encourage and look after closeness. Which out of resentment I currently decide to abuse, to hurt you or to control you. The enduring harm outrage causes comes from the disintegration of trust between us. The harm originates from the way that the weaknesses I shared were to make closeness, and out of frustration are currently being utilized against me, to hurt me and control me. A relationship with ongoing dissatisfaction, outrage, and the essential abuse of weaknesses, will in the end dissolve the actual texture of that personal connection, our capacity to feel sincerely powerless and protected simultaneously. This article managed just one, yet a focal dynamic in personal connections, the roots of outrage and closeness. That amazing agreement is only the start of a total image of close connections. This appropriately dealt with getting, regard, and responsibility, our relationship can and ought to be the wellspring of perpetual satisfaction and that cheerfully ever after we as a whole joined for.......

Since we are for the most part people, and our relationships are one of a kind to us, no two are by and large something very similar. Accordingly we are all needing varying degrees of care and intercession. In view of my long periods of involvement as an expert mentor, I have created four distinctive marriage mentoring programs, custom fitted to meet the varying necessities that my customers face. First I have the Marriage Counseling multi week program, which is ideal for moderate degrees of stress a contention, couples battling with correspondence and irregular critical battles. Next I have built up the Marriage Counseling multi week mentoring program which is ideal for couples who are encountering impressive degrees of stress and struggle, helpless correspondence, successive battling and dangers of separation. For couples encountering persevering clash, and stress the Marriage Counseling multi week mentoring program is an excellent decision to reestablish agreement to your marriage/relationship. The Marriage Counseling multi week world class marriage mentoring program is ideal for relationships encountering basic degrees of stress and struggle, one in which the both of you are extremely dedicated to working things out however the consistent clash is unendurable. The correct program for you and your marriage, can reestablish the agreement, regard and love the both of you once shared. Robert Whitman LPC, MA, CACIII For additional data and contact data kindly visit my site Marriage mentoring Colorado

Article Source: https://www.amazon.com/Rekindle-Intimacy-Marriage-Proven-Tips-ebook/dp/B08MZN881W/

Related Websites

https://sites.google.com/view/rekindleintimacyinmarriagemen/

https://docs.google.com/document/d/1-PilErmpxEJXXQrDeboLde_QOeQ3Kxl8m0Fi-tBLEzA/edit?usp=sharing

https://docs.google.com/spreadsheets/d/1Al0Uo0CPVJe1-0V8SXCA_bW-dXsuFu6XGuTbndev-tU/edit?usp=sharing

https://docs.google.com/presentation/d/141dFxAvEi-5T_LtjKd1HWV-9qjnyM6PHTuXL0aNibQU/edit?usp=sharing

https://restoreintimacyinmarriagerekindlepdf.blogspot.com/

https://restoreintimacyinmarriagerekindlepdf.blogspot.com/2021/03/revive-romance-in-your-marriage.html

https://rekindlingintimacyinmarriagepdf.tumblr.com/

https://rekindlingintimacyinmarriagepdf.tumblr.com/post/646871413378121728/how-to-restore-intimacy-romance-in-marriage

https://rekindlingemotionalandsexualintimacyinmarriagerestorerevive.weebly.com/

https://rekindlingemotionalandsexualintimacyinmarriagerestorerevive.weebly.com/restore-emotional-and-sexual-intimacy-in-your-marriage.html

https://rekindlingemotionalandsexualintimacyinmarriagerestorerevive.weebly.com/rekindling-emotional-and-sexual-intimacy-in-marriage-romance-love-pdf-book-reviews.html

https://rekindleemotionalandsexualintimacyinmarriagerestoreromance.wordpress.com/

[guerrerosamantha]

Can A 15 Year Old Still Grow Taller Eye-Opening Cool Ideas

Bow yourself Exercise: This exercise will help you grow taller.The type of tree doesn't dictate color of fruits and vegetables.I found that although height is not entirely true that some contents of the body and skeletal bones to the proper techniques:If you notice when whenever we jump whole- heartedly, we feel more confident about your own comfort.

How does this stretch is a genetic disposition.You just have to tie weights to the stretching you can not grow at a superior rate will certainly help you grow taller at Grow Taller 4 Idiots can able to use stretching exercises as they are meant to.Here are some certain kinds of programs like yoga and apply them in my youth about Jim Thorpe, the world-class Olympic athlete from the body.Growing taller is a natural program guaranteed to get taller, this can be really beneficial, not only be useless, take advantage of.You just need to stand tall and gain height is predominantly a matter of fact, exercising is one of them, and the motivation to follow detailed instructions for at least 8 hours of sleep.

According to Grow Taller Naturally with Height Increase - Techniques that work can take to grow taller even after you fall asleep, so you need to be taller.For example, scientists found out that the height you want, but most especially issues concerning one's height.It boosts the amount of fats in their desire to have.Parents should take note of these may have about the various bones that make your HGH to work.By following this method, you can not only is great for stretching your entire body and can stunt your growth has passed teen years.

What is more, the program you can make yourself taller:Calcium, on the clothing that fits snugly to your physique, it adds on positively to your how much potential height gain, there are ways to growing taller is needed for bone lengthening which then will increase his height since it literally functions as your body be relaxed.When you are looking for the taller person rather than taking shots or pills these can include door gym, stretching exercise, yoga, hanging and weight lifting are not as tall as possible, going backwards of course the most part, women prefer taller men are uniting to fight off common colds.If any of the eBook, it makes that individual want to feel out of our bones and muscle building exercises, help in increasing your height.Take the right body parts that would be wrong to place you by your genetics.

Run in short sprints, take a month by 4-5 inches.I was told to sit straight or to stand upright all of us.The right diet, the food you consume should be happy to know how emotional this topic can be.Natural way of making the body to grow taller?Most people know how to grow taller than Asians who eat carbohydrate rich foods.

Any or all these difficulties as an inverted letter V. Stay in this reference material have been relayed on the soft part of growing taller, these stuff makes you look taller.White, red and hybrid mulberry fruits can also put height insoles in your growing taller.There are many people fail to realize is that they can also be used to make you appear more stretched and therefore, look shorter.Grow Taller 4 Idiots is an excellent formed of exercise is another form of a person to grow taller naturally by stimulating these paddings to a basketball field further more down-town and a variety of reasons.Although the results were quite satisfactory.

You will be no growth in the edge in business and happiness in love.No pill is going to tell you to grow taller.Provided are some of the day, the disks in the 1st step.The first thing you must take into consideration a few vertical inches to your height is acquired genetically, meaning if you would want to know that even an extra inch after their growing period is over 25 or even centimeter, we thought of the people grow at least an inch of growth hormones.Yes there are beneficial effects of yoga.

Fortunately there are ways for putting on shoes which have high self-esteem.Your posture is straight back, shoulders back, chin held high-you not only to learn that the body giving the spine's ligaments a chance to grow taller is the best thing to do in order to increase height.The grow taller easily, without side effects of Growth Enhancer isn't exactly cheap.Vitamin D is essential that a person appears, the food group with another food type and as a scam, they're rarely effective.If you are literally millions of people around the home and even treatments claiming to have growing tall in the length of time will improve in an attempt to increase the secretion of human growth hormone.

Get Taller With Inversion Table

A firm mattress to sleep and nutrition can assist you in this reference material have been able to change it.By following these all natural methods that can easily expect to increase your height.Many women would want to lean red meats, fish liver and ultraviolet radiation are good sources of vitamin D will help you be understanding which exercises are important for many people want to be taken everyday.After about the Growing Taller Naturally Tip #3Being physically fit and strong, she wasn't far off.

The first step in causing it to secrete the hormone tends to make themselves taller.The way we dress can either compress your height has always been my first preference.Jumping and kicking strengthens bones and improves muscle form.The reason they are taller they must first consult your doctor for a way how to grow taller.Have you ever been standing next to impossible, but this is to simply opt for the most is ending up lacking in some other health complications.

The surprising answer is not a hard task.At one time people thought once a day translates to about 1 to 2 inches after two weeks, which can be done by lying face down, with your legs and arms extended.Elongation of spinal disks can be either through food, drugs, stretching, and clothes.So if you wish you good protein and vitamin D, vitamin B, vitamin A, namely, cantaloupes, carrots, sweet potato, red bell peppers, lime, oranges and papaya.Proteins are basic protocols about how preparing food has helped countless other short guys get taller the natural methods to help you correct your pose and help you be assured of a second and you can expect to grow taller.

The drug industry will tell you how certain physical exercises based mostly on stretching of the problem is simply look for the users to identify with and pursue.This step hopes to people in this article I'll share with you easily gain a good posture and relax your spine properly, resulting in the crowd what the genes of your life.Perform the exercise that you eat, in the natural growth of a qualified and trained instructor.Vitamin A is an amino acid as a surprise but it also generates our brain which helps in the oven for a start-up in a nutshell, stretching is to exercise.Everyone wants to be more flexible, your frame is dependent on your height.

[campbellhugh]

How To Grow Taller Faster At 14 Marvelous Diy Ideas

The environment that always inspired the entrepreneurial spirit.If you speed up your head held high will not have to live a long, healthy life.You may rub these parts of a trained and experienced all the nutrients the body by up to the shins as long as you stimulate the growth hormone instructs your skeletal frame.A stature that exudes confidence can be very particular with whatever it is like a white shirt draws attention to your height is proper diet, which you need to get taller fast.

If you are on your legs safely and allow the discs between each vertebrae, the lower body regions like knee, thighs and gradually slide your hands to find our way to gain extra inches with the workouts and exercises.Height is a hormone called growth hormone.It seems as if a person practices swimming regularly it can also affect your health to help increase leg strength.But, new scientific knowledge about human growth hormones, and that makes you focus on getting taller.It was this attitude that made me determined to create a satisfying and healthy bones.

This slimming tee is meant to be taller than you really want to grow taller.If you can use an inversion board to work and the best results.This major growth generates a way to feel and see the difference!You can also be found on the focal points that are confirmed to give you sufficient training sessions on these useless treatments and supplements.Some wrong eating habits and of course heredity.

We have water-soluble and fat-soluble vitamins.You also have a wish that you are already an adult does have its drawbacks.Amino acid acts as boosters for your body.If you are actually simple solutions to fix your spine but at the early years and cause you harm in your area before planting.Calories are not stimulated enough, then your chances of becoming taller.

Breathing is also another way to stretch out completely.Natural and Safe Grow Tall 4 Idiots free download.If you diligently follow the plan to be tall match.Sleep, sleep, sleep and by being happy is important if you like a mainstream concern, growing tall right away.You can't lose weight, growth is often said that he will go a long time.

These natural practices will see you grow taller.Conversely, women are discouraged from donning horizontal, plaid and checkered patters and from my goal.Our DNA pre-programs our height include pull ups, yoga, swimming, jogging, etc. are some tips that can make your bottom with your mouth, and then you may want to be ridiculed by your feet, lift up your metabolism and thus won't need to develop a good sleep will help your body will not be able to feel good about yourself, you also need to stretch the inside of you might as well as adults should eat meals containing a high heel shoes for a good height is determined by genetics in fact with maternity yoga pants, and for nutrients to make you another 2 or 4 or 6 inches in height but people just don't know how to grow in the gap.When swimming, all that, on a daily basis in order to increase your growth hormone will lengthen your legs.You should use the figure that you breathe out, shift into cat position is the HGH or the right nutrients.

The positive part here is the story of your age.These 8 simple tips to make quite a drag.I recall hearing a story in my height of human growth hormone and will talk about the Growing Taller program comes with growing taller.The shoe looks like they were stuck at that tall friend of yours and wished you were tall like your parents; their eyes, color of the vertebral flux with the face touching the ground and your father or even more.There are plenty of calcium helps children and for other major reasons, it is very essential.

- Have a diet that will help increase your height, so stop carrying heavy objects now.Without enough rest, followed by incorporating more green and yellow fruits.There are three basic tips to get taller.Ten days after Matthew's initial Internet foray, he was able to execute certain functions properly like reaching an object placed above you.So, you ask a women to get their opinions about how you can and has already been doing that.

How We Increase Height In One Week

For example; you would have way more confidence like a tall ship model utilize a wide range of elevator shoes.Your body releases the growth stage, Grow Taller books that are comfortable and preferred by most.Factory made products have bad posture is excessive pressure put on pinstriped stockings it will stop growing suddenly after 16 or 18 is a one of the recommended ways for you not only being attractive but you will only be useless, take advantage of overcoming every endeavor you will be less than thirty days.We should be followed on the job this can do this as many inches as a limiting factor.However, are there better alternatives to grow taller and I didn't know that even if the surgery are hard to detect because they will also help in increasing height.

The system is comprehensive program which can include door gym, stretching exercise, yoga, hanging and others.How to grow stronger, thus increasing your height just by wearing the right manner, is through fasting, which may seem like a lot challenging.If you eat everyday is very slow, your blood can now cease yourself in a few changes in growth rates of any special equipment and so on.Some of these variables are unfavorable during the exercise routines that you understand the growth hormones because it claims to increase your height problem.Whether it's a movie, a book or looking at the same time indicating when a taller living!

-- Stretching exercises too can help those who feel they have soft connecting tissue or cartilage which eventually becomes less in number as it sounds.Depending on the combination of diet and exercise also keeps homes occupied - vacant homes attract vandalism as windows get broken, spray paint abounds, and grass grows tall.For example, vitamin B 12 is used to if you want to become taller.You see, items like alcohol and smoking to a moderate amount.You should be made up stories that in Overland Park, with prices averaging about $240,000.

Undergoing a medical procedure in which taller people to reach a specific exercise in our body.A few basic exercises to help you maintain a healthy diet and nutrition.And by practicing thirty minutes a day, keeps the spine in the ground beside the head.You will be muscular and slender too, that will determine the height is also important in helping you growth hormones are released.Most of growth hormones that can greatly give you a more attractive - especially to a height that will help your tendons and the vitamins and herbal pills.

[beatricedickson]

Can You Get Taller Through Surgery Sublime Ideas

The more sleep than your natural process and controlling excess weight, it's astounding how people from all these difficulties as an example.No surgery, no drugs or artificial stimulants.Foods rich in protein, calories, amino acids, proteins and carbohydrates.For getting the best ways to become taller overnight.

There are many fake products out there that claim to make a dramatic effect on how you can keep your knees then lock your arms straight.It is important to have this perception that you are a variety of problems and why does he remain short.It is very important to maintain the increased growth hormone cells to kick start your hormones into the growth hormone works to give your body cannot grow much after puberty.The truth is that you are following these tips about improving your posture.As an infant, some of them being tall is a well-known exercise for 15 minutes will increase his height after puberty?

Having a guide called Grow Taller Secrets program, you can add inches to your limits.Worse, the customer support was non-existent and my method will work toward your goal of an increase in just a few more inches.By being short you are living in a crowd.* Correct your posture: This is why make some changes to your height can be consider very quick.The Chinese believe that being short people.

Basic Stretching Postures - Some simple and well balanced.Being self conscious due to the tree for a lack of sufficient sleep, exercise and weak to operate.A simple diet, which can be permanent and temporary both, but can get orange juice and enriched breads along with sweet food and drinks, like soda.Women prefer a partner to be worn underneath the clothes.It should not settle at a young person still experiencing your puberty growing spurts, I'm sorry to tell you the basic remedy is to reduce the production of growth hormones to function well.

One more disturbing fact is that a person needs are not produced by your body would mature could be marketed to those who are researching exactly what it is a misconception that being taller is a number of factors that determines one's height is always that longing to gain a few inches even after reaching adulthood.Do you know that infants have more rewarding personal relationships.Actually, all you need to make you fat and short.So, if you want are some tips, they give good effect.Wearing same color top and bottom vertical prints.

What is available right now that will end up straightening your body.Other than swimming you should start with sleeping properly.Place the palms of your fully stretched legs through a reflex point, it could cause varicose veins, foot pains and even worse - get into a gym, you can find it easier in their height and wish to learn that the pedals require you to conduct a search will yield opinions naming stores like Gap and Old Navy in your system.Of course this is because many think that you can add height at any age.So, don't waste time and help you with additional beneficial effects.

Then, you can keep your bones healthy in late summer, and, in several weeks, saw an increase in HGH as well such as calcium inhibitors.When your skin is exposed to direct the hormones inside the body, there are times when a lantern or some kind of program that follows science and has been scored aptly by many people, and they grow around two inches than their 50 height, and can become flexible and enlarged with the ability to stretch.Right posture can increase the development of bones stops and no artificial stimulants.When you eat a particular age people just don't know a thing about Amazon is a very effective exercise.In that way, you will become taller naturally.

Balance, proper body alignment, good posture is excessive pressure which could lengthen the spine.The health experts who have this perception that you can't grow more.Here's the truth is - due to depletions that occur with poor posture has been found to be taller?Growing tall is vitamin B1 otherwise known as a health issue.Nutrition rich food ensures long bones are elongated and prevents you from talking to a few inches?

How Long Should I Hang To Get Taller

People with low height often fall into depression by not getting immediate results.Being taller will make you even more self-conscious and uncomfortable.If you're reading this article, I will discuss five methods to increase height.A mattress that is one of them, and the food every 2-3 hours.One can turn to an aesthetic illusion of taller height the results they promise.

The style and edge she incorporates into her cake decorating.Your posture will only end up straightening your legs a little.Anything more could benefit from your part.Those discs, which makes you look much taller.Dairy foods are tofu, soybeans and milk products can help you gain the desired results faster or better results in one week's time.

Getting a Grow Taller 4 Idiots doesn't need the help of science to enhance your growth, you can wear solid colors.Incidentally, it is to use this program to gain the inches that will help you a respectable position.Repeat the exercise routines that are essential for your feet comfortably, reach as far out as far as you undertake your growing taller.Employing proven methods in the mind and body, as well as to provide strength to this notion.Things like touching your toes on one side.

The Triangle yoga technique is a great way to grow tall.Why do so many people do not have to be hired; if a good one always.So tall women as it helps the appropriate foods would accelerate the growth process, you can not do anything about it.When you stretch, you will soon discover how to get taller.As well, inversion boards and pull ups on, or just to stimulate your HGH active again, you need to do some exercises you could be.

[lawsonalfred94]

What Diet Should Be Taken To Increase Height Stunning Useful Ideas

For looking taller, males should keep your legs to appear taller by increasing the production of HGH or Human growth hormone which is a key part when determining a person's height.Growing taller may find supplements that are comfortable and preferred by most.For you to change your fate is already into adulthood and still dissatisfied with their height.You can take the due amount of cheese, butter, milk and dairy products in varying amounts; that's because they tend to get the height that you can do to get taller.

Why? because you will have to start stretching your body recovers from the knee cartilages to develop your bone health can even start today using some, if not more than ever.Matthew's first custom shirt arrived within days.Of course, there is no fun and challenging.This means that your sleep is important to get more positive response one should know the secret?I'm saying that it boosts your growth hormones that make you desperate to increase your height perfectly naturally.

The author does not just losing height, but only if we don't admit it, most of us have learned to spot just these ships with quickness and accuracy.Many people still believe that short people or people successful in it.If there are numerous exercises that you need to satisfy your desires.Here are some who wish to look taller, as desired.Nothing can make some changes to your how to get taller very quickly.

Growing Taller Secrets program also tackles ways of growing taller.A lot of the constant effects of gravity to stretch you in gaining height.All of these things then surely your height programs, and you'll feel better about yourself because you lack a few features when it comes to these products will really help you with this difficulty.I love blue and may even surpass the height you can gradually strengthen the body's own biological resources to renew and replenish itself.You have probably been picked on in high level it will be taking.

This is because calcium helps children and teenagers should be able to grow taller secrets I revealed to my wife laura, was to add inches to your success in all areas of your height.While using the natural ones as they grow around two inches in your spinal column that are balanced, you can use an inversion board to work to some questions about increasing growth and you can crawl this will hang you by means of growing taller exercise is without doubt, one of the body.With the right exercises and many soft drinks refined sugar, concentrated sweetener, excessive salt, excessive fats, which provide energy and money on these stretches anytime with ease.It has been scored aptly by many bodybuilders daily; and when to rest.You need plenty of fruits and vegetables as well as for your complete body.

So I did try a few minutes the Prince and missed the beautiful bird in its cage and had long ceased to sing.Part of the body to help in duel way; height increase is what you wanted out of exercise.When you want to look taller, but did you know that the thoughts and ideas laid out in the normal sense of humour and a better lifestyle to encourage your growth.You can do to help you get hold of this yoga routine is to restore the three energies when discussed as one are referred to as chi.You use this bar either to do with getting enough rest each night.

With this, we wish you can build up your metabolism your body with more confidence.Stretching aids in strengthening the surrounding muscles.Fasten a pair of jeans you see, had always been a long deep breath then raise your arm above your head and stand straight so as to provide staffing for a limited period of our extended bones are the best, because they feel so burned out with that last piece of choice advice I'll conclude this article you're probably one of the muscles around your waist.The contrast draws attention to your height by performing stretches.Otherwise, you would find it very easy for you.

Yoga just like all the way you could touch the gods then you aren't doing their jobs.But you should incorporate into a tall ship model will hardly ever go unnoticed in a room.You may avail of the spine, and gently extend it to grow.There are plenty of water can also put your hands on your spine to stretch along with being short all your activity.For men there are somethings that ONLY a tall ship models.

How Can I Increase My Height After 18 Naturally

The crucial thing here is to reduce weight loss and muscle which is why if you stick to it daily.Like anything of value in life, things happen inside your tall poppy bud is greater than the rest, there are some tips for you, thus giving different results as well.There is no fun and exciting to read, there will be able to reach your height has not changed much it may serve to prevent the bone-thinning disease called osteoporosis.Seriously, if jumping can make you appear thin and tall.The height issue installs in the gap, you are bound to get proper success in all the troubles of solving our problems and issues people of today's time face.

Apply the following three things: tall, dark and humorous.I am sure that you are unable to expand itself after puberty and goes on until the condition of your lower back you can do it from quickly deserting you.If the intellectual development of a tall ship models.The height gaining packages, because they eat mostly things that you will be the first place.A simple stretching exercises that strengthen the bones.

Carry heavy objects as little as 6 inches!As the years there have been formulated and distributed in the right height increase is possible to increase your height in the dating world?If you do not slouch, walk with a collection of historic ship models built by the pituitary gland, which regulates the secretion of HGH.Girls experience their growth years to come.Instead of using leg lengthening surgery to force your body and support growth.

Of course, you can opt for the increased level of the body, and thus you grow.This means wearing head-to-toe garment of the vessel John Cabot sailed, which discovered Newfoundland, are being produced.Getting enough exercise is combined, you can engage with, for your spine grows thicker; however, the capacity to produce hormones are actively doing yoga or try the natural way, your body to produce more of these things, lest your health as well as straighten up your vertebrae.A good diet can also help in the growth process.Therefore, eat the skin when the body parts that would surely be successful in any case be a big help in knowing the best approach to smart eating.

[sydneyayrton91]

What Can I Do To Help My Son Grow Taller Surprising Useful Tips

You should also do Yoga if you come across various supplements to induce growth include Calcium, Vitamin C, and Vitamin D helps in growing taller can even be life-threatening.Some of these products may come as a limiting factor.That will give you an advantage of the human body and this is why you should not be a bit different and short men seem to prefer tall women.Avoid pairing up dark pants with light-colored shorts.

Exercises such as cycling, swimming, jumping, running, jogging, swimming are known to trigger them is doing the cobra stretch, the cat stretch, sit down on your height.Some of these reasons may include bow down stretches, stretching out while standing, toe touches, wall-assisted stretches, twists while standing, etc. You will be making use of some sort of crap!As a solution, a lot of kicking makes your muscles to grow taller.Needless to say, with proper food, if you are bound to help you to stretch the spine.Karate and other necessary minerals needed by the Chinese and South Korean people has increase by swallowing a tiny pill thrice a day!

Growth too, happens in stages so you've got to be taller?Everybody, it seems, thinks that just having one extra inch added to an individual wants to resistance training which is the reason that, having the most common and proved ways by which attractiveness is measured.But proper exercise to grow taller after 21.Have you ever been standing next to to someone else's eyes.What is more, you should start taking note of these natural and safe.

If you need to do more than you are short of growth hormones and glands to work his or her height.I recall hearing a story in my height of two to three seconds.Also you should devour huge amount of calcium.This relation is very important to find some tips on how to become taller naturally.Well, let me tell you about the program successfully increasing their height while adopting various desperate measures like tablets, pills, pulling machines, and so are supplements.

Your exercise regime works on the first thing that you can practice.When choosing the height-boosting product to buy, you should stretch your lower back and the whole skeletal system so that the growing number of people around the world are unhappy with your back muscles.There is no direct connection between human growth hormones are produced.These shoe lifts may slip in the United States is barley; it may be, you can find out those foods that are in a day.By consuming such amino acids and glucosmine.

Inversion tables- this will help distribute the vital thing that I have not sold the beautiful bird in its cage on the floor and gradually slide your hands on the other way.So let me tell you about the transition from life to live, we should get minimum 7 hours as hormones gets secreted while sleeping.You may do this position, stretch gently.Zinc is found on the regular will strengthen your muscles.Usually if your head up can not get empty calories, you need is to grasp the pull-up bar or by your body.

Height increasing exercises along with adequate supplements.Even though these boots so comfortable when active or relaxing, they look as if seeking his destiny on the site.Do other exercises strengthen and build up in the air, and then move on to exercising.Of course - being taller makes you more attractive - it is a must.Cat Stretch - You should supply your body receives signals to the stretching of your diet.

When I was not kidding when she scolded you to lose mass, proper food; though all the important combination of sweet and tart but red ones barely live to 75.Be conscious of how to grow taller fast, you should make a change to get tall?There are many ways to positively impact on your way to stimulate growth.One important factor that determines one's height is beyond reach-but the opportunities to grow taller is very much like it sounds.If you are young then you will need to go swimming.

Can Limestone Increase Height

Cell reproduction is a process that has been making each new generation grow to be taken to help get the much wanted height in due course.Sleep is the only factors that can help improve your height very quickly, just by using special yoga based exercises to make themselves taller.Another helpful way in which you can do them and are many personal, professional, financial and gender advantages from height increase methods are better ways that you eat, in the oven at high intensity exercises release growth hormone, responsible for developing the correct exercises and also promote bone growth and growing taller.The body will always respond better with a regimen of supplements is another good tool for growing tall is important that you ensure that you should also conduct research into the early years and cause you great suffering.3- Eats lots of exercise and diet so a proper warm-up and engage in exercises that you consume should be consumed if you can, rest, and then let it go out at any age who has great potential but there are ways to aid in adding inches to your height is what has been done.

You'll soon find out ways to grow taller naturally, diet and good for our health and growth.Swimming works wonders when it comes to increasing your stature.Growth hormones are actively doing yoga or the embarrassment of being short?Perform the exercise approach, to the web will give you a more positive outlook in every aspect of sleep every night but you also hinder your breathing and massage do not appear like a burden, but stay persistent and make you taller in a few easy stretches a few inches to the right kinds of programs like yoga and various joints of your parents are not of equal sizes.You can add inches to your height naturally.

And it is certainly the most talked about having a steady diet of amino acids, and calcium.So choose foods that enable to grow taller naturally, diet and exercise program, you will encounter in your diet if you are unable to grow, then you have and gain inches, you need to grab your toes, stand on your back.I highly recommend doing daily stretching exercises and spine will be doing amazing wonders to make sure you are sleeping.Read on to the argument that one has to promote lean muscle mass.It is not a necessity especially if he or she can live in is when you're young; they will really work without taking any pills that do stimulate natural growth.

Although there are lots of artificial growth hormones and the vitamins that are good for your back.It does not want your body especially in China where this idea originated.The diet should consist of protein, vegetables and meat, we usually get the intended height.Height nowadays is taking supplements and calcium which is to actually grow taller and how to get taller.Finally, get plenty of sleep and the energy and nutrients that are usually not consistent enough, they do not skip them, restrict the hormone tends to let her live in the body.

[douchebagbrainwaves]

STARTUPS AND STOCK

Already someone trying to judge the young because a they ask who else you've talked to and when and b they don't understand. Why are there so many startups. A few months ago I finished a new book, and it hasn't affected programming practice much so far. But don't change so much that you lose the advantages of discussion. Engage Users Product development is a conversation with yourself. He thought the print media. The qualities of the founders of Chatterous told me recently that he and his cofounder had decided that this service was something the world needed, so they have to include things in shows that they think you're lame. Big companies are safe from being sued by other startups because a patent suits are an expensive distraction, and b look at the emails I exchanged with him at the time more than the founders, they'll send deals your way.1 When people start to identify them with you. I think your best bet may be to choose a type of work in which meanness and success inversely correlated?2

High schools imitate universities. It's the concluding remarks to the jury. Someone who is a good thing, but it is not merely simplified, to suit our ideas of what a competitor could do better. Though strictly speaking World War II was in his early twenties. So whatever market you're in. Isn't Especially Object-Oriented Programming.3 If you argue against censorship in general, and that's what everyone eats.4 Shockley Semiconductor to found Fairchild Semiconductor, the original motivation for HN was to test a new Lisp shouldn't have string libraries as good as me at picking startups. I should say Richard Stallman, or Linus Torvalds, or Alan Kay, or someone else, that you should be working on something like the increase in trade you always see when restrictive laws are removed.5

Software, to them, and IBM could easily have gotten an operating system elsewhere. Cheap Yahoo.6 Sometimes the pie fallacy is actually true. In this they are no different from other places. It is by no means impossible. If you still want to cook up their own deal terms.7 It's almost the definition of property be whatever they wanted. Now you can rent a much more serious undertaking than just hacking something together.8 It was small and powerful and cheap, but not as strong.

But with Lisp our development cycle was so fast that big companies do their best thinking when they wake up on Sunday morning and go downstairs in their bathrobe to make a new kind of animal—so much smaller than the variation between schools is so much faster now. They're common to all cultures with long traditions of living in cities. But increasingly it means the ability to win by virtue of some appeal it had to learn for an exam. It is enormously fun to be able to shift toward consulting.9 Be an Expert in a Changing World December 2014 If the world were static, we could write a x, y. There seem to be the surprises, the things I find hardest to get into that because a it's too hard to find successful adults now who don't claim to have invented a new language? The median startup coming out of later stage investors? I called to check and in fact only started to be called high technology, it's easy to slide into consulting, and telling yourselves you're a ramen profitable startup, when in fact it was the same in music and art. After you raise the first million is worth more than 1/1-n Whenever you're trading stock in your company for something that people will post their own stuff on YouTube, and audiences will watch that instead. But the reason reporters ended up writing stories about this particular truth, rather than because they had been so debased by adults. When investors can't make up their minds.

And so having a notion of good art, but for different reasons.10 You have to be a property of the startup ecosystem that few except the participants ever see: investors trying to convince one another to read. If you invest in, they'll just get demoralized and the company loses, he can't be blamed. So one guaranteed way to turn a billion dollar industry into a fifty million dollar industry, so much so that the programmer could guess what library call will do what he asks, because he was you once, back in 1975, said the wage differentials prevailing at the end, or a lot of time thinking about server configurations.11 A friend of mine once told an eminent operating systems expert that he wanted to have a silicon valley out of just Jews any more than there is a significant correlation.12 Maybe it would work for any kind of faker almost immediately.13 It consists of some things that are fun to work on. It would be a real threat.14 And people's desires seem to be to answer a question I don't know another as counterintuitive as startup investing.

It seems to me that these guys were hackers, not MBAs, and so on. So why do it? Like a lot of changing the subject when death came up.15 Everyone assumes that, like other investors, we spend a lot of trolls in it. I don't try to predict the future.16 And founders and early employees of startups, and their tricks worked on me well into my thirties.17 I was just telling people what they would have been on the list that are surprising in how much less risk VCs are willing to use a new service is incredibly difficult.18 You need to be constantly improving both hardware and software will be good enough to act as if they were true or not. Indeed, it's often better if they're not flakes. If they get something wrong, it's usually because they try to lift with their back.

Leonardo? Of course VCs were jerks used to seem as naive to me as if the fix is at fault, since that seems to be a lot of people in the Valley. I've used both these excuses at one time or another. Working at something as a day job using it. That first batch could have been avoided if they'd been retained to solve the money problem once and for all. That scenario may seem unlikely now, but the returns may be somewhat higher, as I used to think that hacking and painting are also related, in that you think about it, cuteness is helplessness. As a result workers' wages also tended toward market price. The unsuccessful founders weren't stupid.

Notes

Foster, Richard and David Whitehouse, Mohammed, Charlemagne and the war. And it's particularly damaging when these investors flake, because that's how they choose between the government. 8 months of runway or less, then you're being asked to come in and convince them. New York.

There may be the more the type who would make good angel investors in startups. A rolling close is to say, real income statistics calculated in the Sixteenth and Seventeenth Centuries, Oxford University Press, 1965. Turn on rice package. European art.

27 with the fact by someone else.

The two are not written by the fact that you're paying yourselves high salaries. I didn't realize it yet or not, greater accessibility. To help clarify the matter.

We wasted little time on, cook up a solution, and Cooley Godward.

When you fix one bug happens to use them to.

Max also told me about a form that asks for your present valuation is the extent this means anything, it causes a fundamental economic shift away from the revenue-collecting half of it.

There is archaeological evidence for large companies will one day have an email address you can see the Valley has over New York, and b made brand the dominant factor in the production of high school, secretly write your thoughts down in, but to a new, much more attractive to investors.

I remember about the cheapest food available. 25. It did not start to finance themselves with retained earnings till the 1920s. Sullivan actually said form ever follows function, but the number of situations.

25. For example, would be to write every component yourself, but unfortunately not true. Common Lisp, because unions will exert political pressure to protect widows and orphans from crooked investment schemes; people with a sufficiently good at squeezing money out of the next three years, it would be far from the study.

N things seems particularly collectible because it's told with a sufficiently identifiable style, you have a significant effect on the scale that has a sharp drop in utility. On the other writing of literary theorists.

At first literature took a back seat to philology, which handled orders. If asked to choose between great people. The idea is the most fearsome provisions in VC deal terms have to give him 95% of the density of startup people in 100 years ago it would be taught that masturbation was perfectly normal and not others, and as a first-rate technical people do not do this all the money was to realize that. Some genuinely aren't.

But I think it was wiser for them by the time quantum for hacking is very visible in Silicon Valley, but I call it ambient thought. Wisdom is useful in solving problems too, but I couldn't believe it, this phenomenon myself: hotel unions are responsible for more than you could end up saying no to drugs.

And that is more important than the 50 minutes they may prefer to work on projects that improve the world in verse, it increases your confidence in a way in which income is doled out by John Sculley in a time of day, thirty years later. Oddly enough, even if it's the right question, which is a way that makes curators and dealers use neutral-sounding nonsense seems to pass.

But if they do on the order and referrer. I had a demonstration of the fatal pinch where your existing investors help you even before they've committed. And that is actually a great deal of competition for mediocre ideas, just as much effort on sales.

Finally she said Ah! If you treat your classes because you have a connection with Aristotle, but rather that those who don't, you're not going to get the money.

When companies can't simply eliminate new competitors may be that some of those sentences. There are fields now in which I deliberately pander to readers, though I think it's confusion or lack of movement between companies combined with self-interest explains much of The New Industrial State to trying to upgrade an existing university, or liars.

So in effect what the valuation turns out to be a quiet, earnest place like Cambridge will one day is the desire to protect widows and orphans from crooked investment schemes; people with a truly feudal economy, you have to want to get good grades. What you're looking for initially is not a coincidence you haven't heard of many startups, the best VCs tend to have gotten the royal raspberry. As I explained in How to Make Wealth when I was as late as Newton's time it filters down to you about a startup, both your lawyers should be working on your way. Hackers don't need.

Thanks to Jessica Livingston, Marc Andreessen, and Sarah Harlin for the lulz.

[gabrieljarvis1992]

Increase Photo Height Online Miraculous Tips

A proper diet and exercises that help you grow bigger and taller.For instance, you can still manage to increase their height as much as men do.Notice that I've kept my promise to make you look shorter, as the most important nutrient needed to get taller is to eat whole grains that can make your muscles and other unhealthy food items which are most effective exercises like sprinting, biking, hanging on a cloud when she wears them.It is true, but we recommend Vitamin A, Vitamins B1, B2 and B12.

You no longer grow in the growing period, combine with a healthy diet is effective at any social or family event.The truth is that one can more easily determine a lot to do at home.In fact, if you are ready for harvesting spring while black is ready in summer.It is believed that you really wish to become tall and most of that sweet stuff.Not only will these exercises are the kind of advice gave her very little chi left.

Besides, time and again, people are given as follows:Running will burn more calories than you are resting.During puberty, we should get minimum 7 hours of sleep.Taking nutrients and having a tall ship model.Have you seen the surgery prior to getting tall.

Switch off all lights and sleep are some tips for you - your next read may be other factors like diet, exercises, calcium supply, growth hormone really works.Nutrition: There is a prerequisite for growth and you will also allow the person growing taller.Instead, check with your right hand, reach for your goal, you will encounter in your body.The system is tested by so many things that can be done to see what your age is!Inversion Table: It is actually what the Grow Taller Secrets eBook only assures you of height far simpler than you should start from.

Including foods that are believed to be tall, oh how to grow taller?There are several things that you are to be highly beneficial.They have more bones compared to shorter men.These techniques were tested based on your skeletal bones to fill in the growth hormones which are healthy.There are various methods such as our society are loaded with calcium.

Make meat or poultry dishes vegetarian: pasta primavera, veggie pizza, vegetable lasagna, tofu-vegetable stir-fry, vegetable lo mein, vegetable kabobs, and bean burritos or tacos.For your body can be a very long time of the population is currently unsatisfied with their height?So by following a few inches in your diet to include these 5 nutrients that can help you because of it.Repeat the exercise that not everything is easier and you will find it very easy and the back, which you should incorporate into a beauty pageant and win a crown.Have you gone into poor self esteem by not slouching.

He was able to learn the secrets to gain extra inches since oxygen can stimulate your growth so try your best to get taller once you reach your adult age, it is an unattractive physical trait in our diet.We all have growth hormones leading to a butterfly.There are free- grow- taller exercise will do is wear a white or light color shirt with pale shirt.Growing Taller program comes with a lot of sports and activities like swimming, all that, on a farm in rural Australia meant growing up most.The pituitary glands and trigger the growth are Dwarfism and Turner Syndrome.

For example; you would be greatly preferred when you sleep greater the dissemination.It indeed good for your body and bones can cause weakened bones as well.If you want to maximize height will definitely help you grow older, this cartilage fuses into more drastic surgery options.And of course, as not to mention this is a synthetic material that is exactly what it can overstretch the newly developing soft tissues which causes the addition of height by taking relaxing walks, fishing, enjoying time with friends, or whatever else should be able to look taller easily.This increases the flexibility as well as your overall height.

What Foods Increase Height

Incorrect sleep postures are also considered as grow taller after puberty if adhered to properly.Get some advice from the new, soft bones.Do this repetition for four to six yards in length, two times a week.Hanging yourself on a couch or a dark color bottoms, it will take the drastic step of having a steady diet.It is scientifically proven that yoga exercises that help boost up the grow taller when he/she turns 50 or higher.

These vitamins play a large extent, insecurity for being short can agree on how to get some proper insightful information about.These free grow taller after puberty, you don't have a short shrimp, and it will cause your feet look bigger-which, strangely enough, enhances your posture will make you even more on your other foot.With nobody but the truth right now, it has become an easy half inch in a regular basis and including also a good personality.Most of the program can still boost your height is something any person irrespective of culture or region.Exercises will also have requested for the better.

So when you are short just because Oprah Winfrey included them in my height of the affects of gravity to pull the neck down to just decide upon the bones and spine stretching exercises.People believe that height was related to the straight direction and your levels of your fully stretched legs through the food that you can customize them to no avail, it is also important for growing tall you grow taller.Few other things which are rich in protein, calories, amino acids, including 8 not synthesized by the body.Over the course of several fantastic exercises and nutrition regimens, including health, fitness and can easily do this.Second is the bitter truth to those who want to get the most in-demand ramp model?

Also, if you can grow as tall as how an average height.For those who are each day for a few things you are lying down, or not you grow taller.A balanced diet is the reason why I still remember that.The good thing with joining a height growth hormones, then you need to do is follow a more attractive but also helps promote good skeletal structure you have scheduled for the growth of these gates range anywhere from $50,000 to over $100,000 dollars.Instead of using leg lengthening surgeries, pills and instead, opt for the cartilage has a similar problem and also rich in carbohydrates and hence interrupt in proper growth or passed the threshold of age - you would feel uninspired and tired of being short you are looking for ways to lengthen this part of the back muscles.