#Tin Tam Jai

[absolutebl]

This Week in BL - A New Entry My Top 10 BLs of All Time

March 2023 Wk 4

Being a highly subjective assessment of one tiny corner of the interwebs. Organized by which ones (in each category) I’m enjoying most.

Ongoing Series - Thai

Bed Friend (Sat YT, GaGa & iQIYI uncut) ep 7 of 10 - the plot remains much the same and I am getting very concerned they extended this one as it’s starting to flag. Might have been my first high heat 10/10 candidate if they had kept it at 8 eps. Bummer. I mean it’s still good and I’m still enjoying it, but... character development is a thing.  

Future (Thai Sun YouTube & Gaga) ep 2 of 5 - Drunken gathering is such a hallmark of this franchise. Tiny bit of James flirting! (He’s my fav character ever since Love Mechanics original and the punch). Fuse is right to be worried about getting drunk bc he wants to be able to take care of Ana. I love the actor who plays Top (the ex). I’ve said it before (Remember Me) I really want him to get his own series. Also adventures in translation, Top did not say “I can’t believe you’re dating this man”, he said “I can’t believe you’re dating this kid/child”. These two are the ULTIMATE over dramatic college gays. Their relationship has NO drama but they will make it anyway. 

Pastsenger (Thai Weds Gaga) 4 of 12 eps - I like it more and more each new ep. The leads are developing a fun playful relationship. It’s a bit slapstick for me but it’s not offensive or boring. 

A Boss and a Babe (Fri YouTube) ep 5 of 12 - I don’t know. I’m just finding this one kind of boring now. Although, it looks like we are getting cute boyfriends next week so that might be nice. 

Tin Tam Jai (Tues Gaga & iQIYI) ep 6 of 12 - Side couple advanced into lap sitting and tongue kisses out of nowhere. Good tongue kissing, even if surprising. Higher heat! Yay! They’re a great pair, but would it kill Thailand to give us character development with our high heat?

Chains of Heart (Sat iQIYI) ep 7 of 10 - the confusing whateverness of waisted chemistry continues to confuse. 

The Promise (Thai Weds YT) ep 5 of 10 - I don’t know what’s going on with this show. That’s it? He just fell in love with bestie and then punished bestie for his own feelings? Seriously? WTF. ON HIATUS UNTIL APRIL 19. 

Ongoing Series - Not Thai

Our Dating Sim (Korea Thurs Viki) eps 7-8fin - Absolutely wonderful. There is a time laps but it’s the good kind - NO SEPARATION. Couple of moments when I doubted they could pull it off. But CONGRATZ! We have a new entry into the very rare 10/10 club. I have go change all my best of lists but this was worth it. Final thoughts below. 

Unintentional Love Story (Korea Thurs iQIYI) 5-6 of 10 - (here’s how I’m getting it) KBL rarely gives quality sides dishes but these two are legend. Poor tattooed player hottie is always getting punched. Don’t get me wrong the leads are great too. It’s fun to watch two sets of bisexual identity crisis being handled entirely differently because of good characterization. I say “ouch” a lot while watching this show. Also “awwwww.” I do worry their cafe has no customers tho. 

The Eighth Sense (Korea Weds Viki) eps 1-2 of 10 - With 10 episodes of about 40 minutes each this has got to be one of the longest BLs Korea has ever given us. However from tone, filming style, opening credits, and trailer I am guessing this could be sad. If its KBL doing JBL style then we are in His the series territory, but it could be more in the Blueming vein. I’d give it 50/50 odds. There’s always a chance it wants to be “taken seriously” which is the death knell of BL. Also if a lead smokes it means that one or both will cheat. (I don’t make the rules, the Japanese yaoi gods do.) OK, but do I like it? Yes, actually, it’s... interesting. It’s got a bit of an age gap, country boy/city boy, the acting is great, characters complex, good chemistry and tension. It’s a bit chewy and sticky and less perfect than most KBL (do I detect a touch of Taiwan?). This one is deploying BL tropes (messy eater, shoulder sleep, protective seme, there’s even some hyung-slinging) but it isn’t in the KBL bubble, there’s sharp edges, we may get a coming out sequence or even a bashing. It certainly will stay interesting. But proceed with caution. 

A Shoulder to Cry On (Korea Tues Viki & Gaga) eps 5-7fin - What both these kids need is a little affection and a lot of therapy, not romance. The punishment for flirting in class thing was funny. They are such boyfriends by ep 5 - Sitting together, sharing a glass etc…Terrible awful grueling confession rejection. 2 year time gap. Much needed in this case. Then another 2 before the epilogue. Honestly, the most unlikely thing about this show (after the casting) was the prospect of an out gay Korean cop. No kisses for us. Narrative indicated that there should have been at least a fish kiss, but not happening with them in the same Kpop group. I’m starting to think I really just prefer KBLs where they use actors and not idols (Semantic Error excepted, of course). I’m assuming the next 2 eps are bts. Final thoughts below. 

It’s Airing But ...

Love Syndrome (Thai Sat WeTV) stopped at ep 2 of 12 - I’m just not into any aspect of it (except Lee Long Shi and I can watch him in Tin Tem Jai - see above pic, awesome side dish action) - saving to binge if the end is solid.

Venus in the Sky (Sat YouTube) pilot/tester?) 0 of 10 - not entirely sure what’s up with this one distribution-wise, but the pilot was cute, classic university-set pulp. I hope it happens because the leads are cute with good chemsitry and I thought it was fun. However, it totally holds together as it’s own little short story too. 

Cafe In Love (Thai ???) 10 eps on Ch3+ - Thai pulp, about trying to save a coffee shop. FairyGodBLer came through for me, but I’m collecting to binge just in case. It’s my new policy with the grey stuff. 

Destiny Seeker (Tues WeTV Thailand) 10 eps - it’s not on any WeTV I can get ahold of. Bad Buddy the pulp rebirth meets Japanese handsome host club action. Same as above.

Make a Wish (Thai Weds ?) from WaGa Creative staring Fluke Natouch (OhmFluke UWMA etc...) & Judo (The Miracle Of Teddy Bear) in a medical-fantasy. It seems to be a light-hearted romance with a comedic flair. About a doctor who sees ghosts and a deity who resides in a Bodhi tree that earns merits whenever he fulfills a wish based on a y-novel by Sammon (Manner of Death, Triage). Too hard to find.

Finished this week

Our Dating Sim (Korea Viki) I enjoyed every aspect from the casting to the very simple premise to the quietly smooth execution. Sure it’s very low stakes, but that makes it high domesticity and extremely warm and gentle. This is a fuzzy blanket of a story. Do we call this cozy BL? Why not? This one is going to live in my rewatch pile, I can tell already, and you know what’s best about it? Every single episode is in that pile. There’s no skipping with this one, it might be good natured and calmly sweet but it’s tight and the pacing is excellent. It perfectly suited KBL’s short-length tendencies. Full review. 10/10 I CANNOT RECOMMEND THIS SHOW HIGHLY ENOUGH

A Shoulder to Cry On (Korea Viki & Gaga) - Adaptation of a manwha, high school set bully romance, staring Jaehan & Yechan BOTH from Kpop group OMEGA X, so no kissing. All in all this was a painfully awkward watch for me, and while beautiful and decently acted, the story and characters rendered it ultimately disappointing. I think we shouldn’t let Korea do bully romance. 4/10 FATALLY FLAWED 

Jack O’Frost It was fine. I never really cared about the characters or their relationship. Not to slag off the acting (which was superb) but the narrative bored me. 5/10 WATCH ONLY IF YOU HAVE NOTHING BETTER TO DO 

In Case You Missed it

Ai Long Nhai got a special ep on iQIYI. 

Eternal Yesterday is getting a movie version with additional content if you want extra suffering. 

A few things have been announced but mostly Thai, Japanese, and 2 (yes, 2) Chinese Omegaverse (Desire and Couple or Not). It’s doubtful these will pass censorship, so I’m not gonna bother tracking until they actually get international distribution. For Thailand, I’m excited about Waterboyy 3, which NOT a remake (hally-fucking-luya) but a new installment, and stars KaownahTurbo (Love Stage!!! et al). Although why the fuck they don’t put Est Supha (swim champ) into one of these is a mystery to me. For Japan, they’ll start airing sooner rather than later, so expect me to start tracking those. 

Next Week Looks Like This:

04.06 Our Dining Table AKA Bokura no Shokutaku (Japan Gaga) - I AM SO EXCITED I LOVE THE MANGA 

04.07 My Beautiful Man Eternal (Japan ????) - 3rd installment, movie which means it’ll be a pain to get hold of. 

No proper post for April but remaining releases are: 

04.14 Naked Dinner AKA Zenra Meshi (Japan Gaga) - not really my thing but yes I’ll watch it 

04.15 My Story (Pinoy YouTube) - not my fandom but I will give it a go

04.18 Step By Step (Thai WeTV) - office age gap, I am all in! Even though it’s WeTV. Sigh. 

April is looking a bit slender so I might start watching Destiny Seeker or Cafe in Love, or both. 

2023 forthcoming BL master post (see comments, some are inaccurate, NOT KEPT UPDATED)

Adventures in Captions

Ai Long Nhai special both reviewing its own plot and having fun with English. 

THIS WEEK’S BEST MOMENTS

The danger in dating an older boy. (Future) 

Love triangle in one photo! (Promise) 

(last week)

Current Kpop earworm? Nada, the comebacks have been disappointing recently. 

[singto-prachaya]

It’s been a long time since I did a currently watching post. Also saw my sidebar list only had old finished shows on it so it’s updated now. Now let’s get it on.

Ameiro Paradox

I like this show so far. It’s a typical J-BL. It’s not the best but also not the worst.

Blueming

Older K-BL but iQIYI finally accepts paypal as a payment methode. So I got a year sub and started this. It’s so damm cute. I love this show so much. I watched the first 6 eps yesterday and cannot wait to watch the other 5 later. Season 2 when? But no unnecessary angst/drama then please.

GAP

I cannot recommend this show enough. It’s great. Tee is my absolute fave character. I am also glad this show is pulling in big numbers. Let’s see if these two can grab some Kazz awards.

Never Let Me Go

I like this show despite the plot not being that solid. I also love the cinematography. I don’t care much for the side couple.

Our Winter

No gif since this is a Tiktok BL. Honestly? Tutor and Yim deserve better. There is no plot and it’s just them looing cute :( #justicefortutoryim

The End Of The World

This show is definitly interesting. It’s good enough to continue watching. But I’m not sure how I feel about it overal so far. Guess I will have to wait till the end for that.

Bed Friend (18 February, YT, iQIYI)

Really excited for this one. Can’t wait to see what Net and James will bring to the table. They better not dissapoint. Chemistry wise I think it will be good. DMD is good in that appartment. Just afraid the plot won’t be good enough. And glad I can see the uncut version legaly.

Chains Of Heart (19 February, Gagaooala)

Another dark BL and I am ready for it. Hope it’s better then Kinnporsche.

Lovesydrome (3 March, Platform TBA)

I have decided I will go and give this a try. Frank and Lee as a couple looks hot. But let’s see how much of the toxicness I can handle.

Moonlight Chicken (8 February, YT)

Can’t wait to watch this. It has a good cast. Just not totally happy about the cheating plot but I can deal with it.

Tin Tam Jai (28 February, iQIYI)

Only here for the side couple. Don’t care about the main couple. It’s looks pretty boring.

[clairificusrex]

MFlow Entertainment's new project Tin Tem Jai The Series

27 February 2023 on IQIYI & M flow entertainment youtube ( 10 Eps )

Starring Run Kantheephop as Park and Tiger Aekapol as Tin

Plot: Tin has always been secretly in love with Phi Park, Aunt Phavinee's son, who owns a neighborhood bakery.

@absolutebl @bengiyo @gillianthecat @heretherebedork @iguessitsjustme @weekendatennuis

Looks cute?

[gunsatthaphan]

~ Monthly BL Breakdown: December 2022 ~  

🎆 Happy 2023!!! 🥂

Disclaimer: ALL shows can be streamed here or here, as well as on Youtube and other platforms. For more info on where to watch what, check out this post!

New breakdowns are coming at the end of every month - feel free to add stuff! (previous breakdowns)

What came out this month? (green tick = seen or currently watching)

🌟 Oh! My Assistant - December 1st (South Korea)

🌟 609 Bedtime Story - December 2nd (Thailand) ✅

🌟 My School President - December 2nd (Thailand) ✅

🌟 Si Andy, Si Lauren o Si Peng? - December 3rd (Philippines)

🌟 Fudanshi Bartender no Tashinami (international release on GagaOOlala) - December 8th (Japan) 

🌟 Semantic Error: The Movie (international release) - December 9th (South Korea)

🌟 The Warp Effect (BL sidestory) - December 12th (Thailand) ✅

🌟 Never Let Me Go - December 13th (Thailand) ✅

🌟 The Director Who Buys Me Dinner - December 15th (South Korea)

🌟 Ameiro Paradox - December 15th (Japan)

🌟 Coffee Melody Special Episode (PlengDuean) - December 18th (Thailand)

🌟 The New Employee - December 21st (South Korea)

🌟 Coffee Melody Special Episode (NueaJeen) - December 25th (Thailand)

🌟 HIStory5: Love in the Future - December 28th (Taiwan)

Monthly likes/dislikes

❣️ The Warp Effect - I’m not gonna lie I knew exactly that this show would have me in a chokehold from the moment they released the pilot trailer and I was right lmao. It’s phenomenal. It’s fun, it’s chaos, it’s spicy. exactly the kind of anarchy I was craving jdhfgk. New is doing a very good job at portraying Alex, which is surprising because he was part of the reason I was hesitant about the show as I’m not his biggest fan. But I’m so fond of Alex and also him and Fah as Jean have an A+ chemistry. Army is my bitch lmao I love him so much and the 3 of them contribute a great deal to the vibe that makes the show work. The side couples are also very interesting and mostly props to Sing for giving his all in this type of plot because that shit requires some courage lmao. It’s a textbook Jojo series and his signature way of not beating around the bush is very visible here. Some people said they find the hyper-focus on the sexual themes juvenile but I disagree. The exaggeration of the plot is a great way of pointing a finger at these themes and breaking a stigma; especially at GMMTV. I love it. 10/10 so far. 

👎🏻 Remember Me - This show has taken a very disappointing turn about halfway through. The stories all had a very sweet and interesting start and I liked the slow pacing at first but now it’s just draggy and annoying. Everything has become 80% slower and the scenes are repetitive and tedious. At this point I'm only watching the GunGolf story and even that has parts that I can’t help but skip. Their breakup was very strange and unnecessary to me and I have no idea how they plan to fix it in the remaining 2 episodes. What a shame. 3/10. 

New series & movie announcements

🎥 The Last Time - Date TBA (Thailand)

🎥 Unintentional Love Story - Date TBA (South Korea) 

🎥 Born To Be Y - Date TBA (Thailand) 

🎥 Love At First Paint (TikTok series) - Date TBA (Thailand) 

🎥 Y Universe (starring KaownahTurbo & others) - Coming August 2023 (Thailand)

🎥 Personal Manager (produced by MFlow) - Date & Cast TBA (Thailand) 

🎥 Tin Tam Jai (produced by MFlow) - Coming February 27th 2023 (Thailand) 

🎥 Time (produced by MFlow) - Date TBA (Thailand) 

🎥 Love in the Big City (novel adaption) - Date TBA (South Korea) 

🎥 Pit Babe - Date TBA (Thailand) 

🎥 My Dear - Date TBA (Thailand) 

🎥 Check Out (Movie version) - Date TBA (Thailand) 

🎥 Mystique in the Mirror - Date TBA (Thailand) 

🎥 Our Dating Sim - Date TBA (South Korea) 

🎥 Death Kaleidoscope (novel adaption; possibly bromance) - Date TBA (China) 

🎥 Bokura no Shokutaku (manga adaption) - Date TBA (Japan)

🎥 Hot Bamee and Yummy Gyogung - Date TBA (Thailand) 

🎥 Eccentric Romance - Date TBA (South Korea) 

🎥 Wuju’s Bakery - Date TBA (South Korea) 

Other news from the BL world

❗️ The following BL actors won at this year’s GQ Men of the Year Awards 2022: 

Bright Vachirawit: Actor of the Year 

Apo Nattawin & Mile Pakphoom: Breakthrough Actors 

Mew Suppasit: Top Trender

❗️ The following BL actors/productions won at this year’s สุดสัปดาห์ Y Awards 2022: 

YinWar: Star Duo of the Year 

Bite Me Series: Best Inspiring Series 

PP Krit: All Time Popular & Favorite Social Media Star 

BillkinPP: Best Original Soundtrack

Not Me: Best Series Based on Books, Best Screenplay, Best Director 

Cutie Pie: Y Series of the Year

Zee Pruk: Actor of the Year 

Nunew Chawarin: Actor of the Year 

ZeeNunew: Rising Star Duo of the Year

❗️ JaFirst were confirmed as the leads in the upcoming BL Be Mine SuperStar. Other cast members are Benjamin Brasier (2Moons2), Bosston Suphadach (Between Us), Kokliang Parinya (TharnType) and others. 

❗️ Following the success of Manner of Death and Triage, the novel “Euthanasia” by Sammon will be adapted into a series titled Spare Me Your Mercy and will be produced by One31. BibleBuild (KinnPorsche) are rumored as the leads. 

❗️ Golf Tanwarin (director of The Eclipse & 609 BS) announced that SmartJames (Don’t Say No) will be part of the upcoming BL movie Moments of Love. Other cast members are Fort T. (Love in the Air) & more. 

❗️ Triage won “Best BL series” and “Best BL scene” at this year’s CBLO awards. 

❗️ The Domundi 2023 Lineup Event was held on December 13th. The following BLs were announced:

Bed Friend Series (starring NetJames)

Middleman’s Love (starring TutorYim)

Naughty Babe (Starring MaxNat)

Love Upon a Time (starring NetJames)

The Next Prince (starring ZeeNunew)

Cutie Pie 2 You (4 episodes) - airing January 6th

2 Worlds (starring MaxNat)

Punk Spy (starring Tommy S. & others)

Our Winter (Korean collaboration, starring TutorYim)  

Unknown movie (starring ZeeNunew)

❗️ The production company Be On Cloud will hold their 2023 lineup event on January 18th. 

❗️ The following BL actors/productions won at this year’s Thailand Digital Awards:

The Eclipse: Best Y Series 

JoongDunk: Couple of the Year 

Job Thuchapon: Outstanding Actor in a Y Series 

Mean Phiravich: Best Male Rising Star Award 

Danny Bandit (2Moons3): New Rising Star Award 

Ultimate Troop Co Ltd (Remember Me): Best Creative Production of a Y Series

❗️ The following BL actors/productions won at this year’s Y Universe Awards:

LoveMechanics: Best Y Series 

Cutie Pie: 7 awards 

YoonTon (Unforgotten Night): Best Leading Role 

Sing Harit (Not Me): Best Baddy

❗️ Nutt Witsarut (SCOY) and Boat YongYut (My Secret Love) have been confirmed as the leads in the upcoming BL Hot Bamee and Yummy Gyogung, which is an adaption from Jamie's novel with the same title.

❗️ TVThunder released posters for a still unknown series with Prom Ratchaphat, Mark Siwat and Plan Rathavit as the leads. Name, date & genre is still unknown. 

❗️ Actors Toptap Jirakit, Puimek Napasorn and Gunsmile Chanagun have officially left GMMTV. 

❗️ The upcoming BL Love Syndrome will air on March 4th. 

Upcoming series & movies for January

☝🏻 Oh! My Assistant (Movie version) - January 2nd (South Korea) 

☝🏻 Beautiful Scars - January 2nd (Philippines) 

☝🏻 Cutie Pie 2 You - January 6th (Thailand) 

☝🏻 EarthMix Space Season 2 - January 17th (Thailand) 

☝🏻 Individual Circumstances - January 19th (South Korea) 

☝🏻 Hit Bite Love - January 21st (Thailand) 

☝🏻 Suki Suki Wan Wan! (possibly bromance) - January 24th (Japan) 

☝🏻 Bokura no Micro na Shuumatsu (The End of the World With You) - January 29th (Japan) 

☝🏻 The Luminous Solution - January TBA (Thailand) 

☝🏻 Future - January TBA (Thailand) 

[thegreaterlink]

Reviewing Star Trek TNG - S3E20 "Tin Man"

THE PREMISE

The Enterprise is suddenly contacted by the USS Hood, who informs them that their new orders are top secret and will be communicated by Betazoid mission specialist Tam Elbrun (Harry Groener). Elbrun's presence causes concern, as many hold him responsible for the Ghorusda Disaster which killed 47 Starfleet personnel, plus he was Counsellor Troi's patient when she was studying psychology.

Elbrun comes aboard and explains that a star in the Beta Stromgren star system is about to go supernova, and their mission is to lure away a sentient starship orbiting it. Starfleet has dubbed this mysterious ship "Tin Man"... for some reason.

MY REVIEW

As the credits rolled and that familiar Jerry Goldsmith theme kicked in, I knew I was going to have a field day with this one.

First of all, it's kind of hard to take a mysterious alien threat seriously when it's named after a Wizard of Oz character. Though I suppose it could've been worse.

If this isn't proof that I should never be allowed near photo editing software, then I don't know what is.

And now that I've used up four of my allotted image slots for a single joke that wasn't even that funny to begin with, let's get back to the plot.

Edit: So I found out after posting this that Tumblr just increased the image limit on each post from 10 to 30. That’ll come in handy in the future.

Elbrun is a well-acted and interesting variation of the usual empath character due to a rare condition which means that he can hear people's thoughts at all times. Though early diagnosis and training have helped him to adjust, he's still required therapy and hospitalisation after getting overwhelmed. I'm sure there's a real-world condition I could compare this to, but I'm not qualified for that. I'm just here to critique and make jokes.

This condition has understandably made him brusque and irritable around people, and while this does get annoying pretty quickly, it at least allows for some nice character shading later where he opens up to Troi about his abilities overwhelming him, and his own insecurity over the crew doubting him after his failure at Ghorusda, which he blames himself for.

His whole relationship with Troi is pretty interesting, and it's nice to see Troi interact with a fellow empath who isn't a PR disaster waiting to happen.

Oh yeah, Elbrun also explains that he only took this mission because he's fascinated by Tin Man and they share some kind of connection. Idk, it's pretty vague.

The Enterprise arrives at the system but is attacked by a Romulan warbird and some excellent music from Jay Chattaway (fun fact: this was the first TNG episode he ever worked on). The Romulans are here because they've claimed ownership of the system and the writers needed to raise the stakes.

After a scene of Geordi trying to hold things together in Engineering which probably should've been cut, Elbrun decides to visit Data in his quarters. He has become fascinated by Data, since as an android he's impossible to read, and they have a conversation about the nature of existence and all that jazz.

Look, I can appreciate their conversation adding some much-needed flavour to this episode, but if Elbrun wanted to get philosophical then he should've been here when Data made himself a child.

Anyway, they return to the bridge, where it turns out the Romulans have orders to destroy Tin Man if they can't capture it. Picard tries to hail the Romulans but to no avail, when suddenly Elbrun sends it a message which makes Tin Man emit a massive shockwave which destroys the Warbird and damages the Enterprise.

Evidently Elbrun's vague connection to it has taken hold.

After Elbrun is taken to sickbay following a seizure, he explains that he's been in contact on an emotional level (whatever that means) with Tin Man, which has the somehow even less intimidating real name of Gumtuu. It's the last of an ancient species, and is attempting to use the supernova to commit suicide.

So we're making contact with yet another misunderstood higher life form and/or sentient machine. Why yes, I have seen The Motion Picture and The Voyage Home, and they were much better than this trite.

They contact the captain of a second Warbird (who is such a blatant plot device that he isn't even given a name) in an attempt to parley, but surprisingly enough they don't want to listen to reason and intend to destroy Gumtuu and the Enterprise if it interferes.

Because Elbrun needs to make physical contact with Gumtuu (for some reason), he and Data beam aboard, and Gumtuu (it sounds dumber every time I write it) immediately establishes a proper connection with him.

The ship's interior at least has some cool production design which really sells the concept of Gumtuu being an organic being.

Plus we at least get some kind of insight about Gumtuu when Elbrun (who now knows everything about it) explains that Gumtuu and its crew had a symbiotic relationship, so when they were killed it no longer had a reason to exist.

"Is that the purpose of existence? To care for someone?"

"It is for me."

Anyway, Elbrun explains that he intends to bond with Gumtuu and save it from destruction, meanwhile Elbrun finally has peace since the voices in his head have finally stopped.

I was going to make a joke here about V'Ger joining with the creator, but then I realised that these two joining together actually makes somewhat more sense.

So anyway, Gumtuu emits another massive shockwave which blasts the Enterprise and the Warbird about four billion kilometres away, and they watch from a distance as the star goes supernova.

For a moment Picard is worried that Elbrun, Gumtuu and Data are all lost, but then Data reappears on the bridge. After all, they'd never kill off Data in a random explosion, right?

Anyway, Data explains that Elbrun somehow saved Gumtuu from destruction, and that they've been... healed by their joining? This was probably meant to sound more profound than it actually was.

This is yet another episode which has also shown up in a bunch of "best of TNG" lists for no good reason. It almost feels like Jay Chattaway realised how generic the plot was and tried to spice it up with his music.

5/10 - Almost entirely unremarkable.

Hey, remember when we had that streak of like seven good episodes in a row? I miss those days too.

[salttray0]

Xem Bóng Đá Trực Tiếp Tốc Độ Cao Trận Đấu Ngày Hôm Nay Với Bialactv

Cùng lúc đó hậu vệ cánh phải Florenzi cũng không thể ra sân vì lý do tương tự, khiến HLV Mancini mất đi những lựa chọn nhân sự phù hợp cho trận bán kết này. Bù lại, trong đội hình tuyến Ý tại EURO lần này có khá nhiều gương mặt trẻ đủ sức thay thế. Không có nhiều thời gian chuẩn bị và rà soát đội hình, HLV Polking quyết định trọng dụng kinh nghiệm và các cầu thủ tên tuổi ở giải đấu sắp tới. Bạn đang muốn tải video Facebook về điện thoại của mình để chia sẻ, gửi cho mọi người cùng xem nhưng chưa biết làm thế nào? Hãy theo dõi ngay bài viết dưới đây để biết cách tải video Facebook trên điện thoại bằng x2convert một trong những Website hỗ trợ tải video hiệu quả và tốt nhất hiện nay. Chỉ cần click chuột là bạn đã có thể mở hyperlink sopcast trực tuyến miễn phí. Đội ngũ chuyên nghiệp đã chọn đường truyền tốt nhất để người hâm mộ có thể xem trực tiếp bóng đá trên toàn bộ trận đấu. Giờ đây việc lấy hyperlink xem bóng đá trực tuyến trên di động trở nên dễ dàng hơn và có đường truyền tốt. Người hâm mộ chỉ theo dõi các đội bóng qua trang net, ứng dụng bóng đá. Điều này giúp bạn dễ dàng giảm căng thẳng bóng đá mọi lúc mọi nơi. Vào bialac.tv trước 25 – 30 phút để xem trực tuyến bóng đá hôm thủ môn pope . Hãy xem thử ngay những trận đấu hiện chiếu tại bialac.tv để kiểm tra chất lượng truyền phát, & cùng giải trí với các đội bóng xuất sắc đang thi đấu cho nhiều giải khác nhau. jay rodriguez kể bao giờ, bạn cũng gặp những vấn đề ngăn trở bạn xem bóng trực tiếp tại các sân hoạt động. Đó rất có thể là do công việc bận bịu, yếu tố kinh tế, hoặc đơn thuần không kịp mua vé vào cửa. Nhưng đừng thất vọng, vì bạn rất có thể xem trực tiếp trên Bia Lạc TV, cùng cảm nhận không khí sức nóng của trận đấu qua đoạn phim chất lượng đỉnh cao của chúng tôi. Ngoài các kênh phát sóng của K+, Báo Giao thông cập nhật thêm hyperlink xem trực tiếp một số trận đáng chú ý để phục vụ độc giả hâm mộ bóng đá. Đội bóng từng vô địch thế giới 3 lần Sada Cruzeiro đã chiếm ưu thế trước nhà vô địch châu Á Sirjan Foolad của Iran, dành chiến thắng 3-0. Tình hình đang rất căng tại Portland Trail Blazers khi họ gặp một loạt vấn đề, từ GĐKT cũ bị sa thải, CJ McCollum vướng tin đồn trao đổi và giờ là Damian Lillard. Cả hai đều vắng mặt ở vòng loại thứ 2 World Cup 2022 vào tháng 6. Thị trường xe cũ đã qua sử dụng đa dạng, tuy nhiên cũng tiềm ẩn không ít rủi ro. Siêu sao người Bồ Đào Nha đỡ bóng khéo léo nhưng những pha dứt điểm sau đó đều đi không trúng khung thành. Hậu vệ phải người Bồ Đào Nha có pha đột phá ấn tượng trước sức ép của Zaha và Mitchell, tuy nhiên phá dứt điểm sau đó lại chệch khung thành trong gang tấc. Ở cặp đấu còn lại giữa Anh và Đan Mạch, tỷ lệ đi tiếp của “Tam sư” là 73,2%, vượt trội hoàn toàn so với tỷ lệ 26,8% của Đan Mạch. Chúng tôi tin rằng trong phần điểm thưởng khách hàng sẽ có cơ hội nhận được những phần quà có giá trị và những ưu đãi khi tham gia các chương trình khuyến mãi. Sự ra đời đúng thời điểm đã giải quyết được một phần nhu cầu của cộng đồng yêu thích bóng đá. Đây cũng là một trang internet hoạt động phi lợi nhuận với mục tiêu là đem bóng đá đến gần hơn với người hâm mộ thông qua internet.

[ladyherenya]

Books read in May

More time working = less time reading. (But hey, I like my job and no one is paying me to read more books...) I alternated between contemporary and SFF, and didn’t finish the library books that lacked an obvious romantic subplot.

Favourite cover: Begin, End, Begin: a #LoveOzYA anthology (once I realised that they were going for “Australian but not clichéd”).

Still reading: Ninefox Gambit by Yoon Ha Lee.

Next up: House of Shadows by Rachel Neumeier.

(Longer reviews and ratings are on LibraryThing. And also Dreamwidth.)

-- (they’ve taken away page breaks) --

The Flatshare by Beth O’Leary: Tiffy and Leon share a one-bedroom flat but haven’t met each other -- Leon works night shift and is only ever home when Tiffy is at work. It’s a bit of a desperate arrangement, but Tiffy needed to move out of her ex’s place and Leon needs money for his wrongly-convicted brother’s legal fees. They communicate through post-it notes. This arrangement had the potential to feel ridiculously contrived but doesn’t. I enjoyed the characters getting to know each other through letters, and liked how they supported and cared about each other. Dual POV worked well here.

Carpe Jugulum by Terry Pratchett (narrated by Nigel Planer): The sixth book about the witches of Lancre. The king invites vampires to attend his daughter’s naming and it all goes wrong (but not quite how the vampires planned). I wasn’t sure I was going to like this -- I can prefer to avoid both vampires and satire of religion, depending on how it’s all handled. But, a few small details and moments aside, I enjoyed this. And I was glad Magrat got to renegotiate her position as one of Lancre’s witches. I would happily keep reading more of the same, but this is the end of the line.

Begin, End, Begin: a #LoveOzYA anthology edited by Danielle Binks: What it says on the tin: Australian YA short stories around the theme of beginnings and endings (and love). I borrowed it for Jaclyn Moriarty’s “Competition Entry #349”, a whacky and very Moriarty-ish take on time-travel. Other stories which stood out: Lili Wilkinson’s “Oona Underground” and Danielle Binks’ “Last Night at Mount Solemn Observatory”. Ellie Marney’s “Missing Persons” made me curious about her books. As for the rest, I enjoyed them and/or thought they were solid stories. Nothing I regretted reading or wanted to set on fire -- not something I can say about every anthology I’ve read.

A Court of Thorns and Roses by Sarah J. Maas (narrated by Jennifer Ikeda): I was expecting a “Beauty and the Beast” retelling. It’s more of a retelling of “East of the Sun, West of the Moon” with bits of “Tam Lin” thrown in -- but even though that should be exactly my sort of story, it wasn’t quite. I wavered between being captivated and being frustrated when Feyre’s choices seemed short-sighted. I don’t need protagonists to be aware of everything that I -- a genre-savvy reader and an outside observer -- am aware of, I just need to understand their perspective. Also, this was darker than I wanted, and the ending wasn’t wholly satisfying.

The Girl He Used to Know by Tracey Garvis Graves: Annika and Jonathan were a couple in college. Ten years later, they wonder if they can rebuild their relationship. It was almost immediately obvious to me that Annika is on the autism spectrum, and I found that really interesting. Because the book switches between their senior year and the present, there’s a lot of emphasis is on Annika’s growth, and her current-day achievements are more clearly triumphs. This story is thoughtful, hopeful, realistic and romantic. It’s less successful when it comes to dealing with the aftermath of tragedy -- Graves rushes over those bits. But that’s a small complaint.

Aurora Rising by Amie Kaufman and Jay Kristoff: Tyler Jones misses the draft because he’s off rescuing a cryogenically-frozen girl and he doesn’t end up with the squad he hoped for. This is fast-paced and entertaining and involves a lot of things I like -- like teamwork and Lord of the Rings references! But with a squad of seven POV characters to get to know in fewer pages than The Fellowship of the Ring, I don’t feel strongly invested in anyone. At least, not yet. But this is just the start of the story and there’s a lot of potential.

Love in Row 27 by Eithne Shortall: This caught my eye because of the author’s name -- like the singer Enya -- and I’m glad it did, because it was fun. An airline attendant takes advantage of manual check-ins to try her hand at match-making. The story alternates between Cora on the ground, and the passengers and Cora’s colleagues in the air. It’s a romance-focused story, and I enjoyed the variety of passengers in row 27. But the bits about Cora’s mother are the emotional heart of Cora’s story. I liked Cora’s friendships too. My only complaint: this book ended and I wanted just a bit more.

A Curse So Dark and Lonely by Brigid Kemmerer: I loved this take on “Beauty and the Beast”. Prince Rhen of Emberfall has been cursed to repeat a season -- which ends with him transforming into a deadly monster -- until a girl falls in love with him. Harper, from DC., is his last chance. Harper is fierce, determined and so believable. Cerebral palsy sometimes slows her down but doesn’t stop her from trying. I enjoyed the slow development of trust between her and Rhen. This would have been a really interesting note to end a fairytale retelling on, but for other reasons a sequel seems like a good idea.

[eachmostremembering]

Navigation

The Basic

ella rambles: for when i publicize things i think, which is quite often

my work (with the subcategories my fic, my poetry, and my mix): for things by me

a link to my ao3 account | stories i recommend

other social media: dreamwidth, twitter

The More Involved

words: poetry/prose i like

music: on the tin!

there is somewhere beyond you: a world i can almost touch if i reach far enough into the fabric of this one

if i love you, what business is it of yours?: i said once that my aesthetic was repressed romantic, and i was honest

fairytales: on the tin!

of times past and lives lived: about history

each kind star and the light years between them: for outer space

i need to come up with a love for computers tag: for programmed friends

the sea asks for nothing and holds me: i’m afraid of big bodies of water but i think it’s beautiful

Fandoms

(i mean, this is a new blog where i’m attempting to start from scratch so i don’t have much up yet, but it’ll update as it goes along)

the bear | relationships: syd/carmy

bandom | relationships: patrick/brendon

the great gatsby | relationships: nick/jay

WIPs

make you a crown (previously strings of magic): about snow, raedyn, and isa, and how this group containing an assassin, prince, and spy, respectively, dismantle a monarchy

were i to give you my own two eyes: the story of the faerie queen and those who belonged to her, especially thomas the rhymer and tam lin

cloud & sky: if the clouds were floating cities in a sea and sky of stars and during wwi fallen soldiers who rose past them on their way to the next life, and one got stuck

[absolutebl]

BL for Feb 2023 

2.14 Moments Of Love (Thai - Foremorfilm Production) cinemas Was originally Golf (Director of 609 Bedtime Story & The Eclipse) to direct stars SmartJames (LeonPhob from Don't Say No) in a series. Is now something totally different and a movie. We are all confused.

02.16 Boyband the series (Thai - World Star) YouTube - Thai idol boy band BL.

02.18 Bed Friend (Thai - Domundi) Viki, YouTube, iQIYI? Adapted from a Y-novel (same setting as Middleman’s Love) about Uea (reserved and shy and hates players) and King (a big time flirt) who work in the same office and share a best friend. Despite the fact that they don’t really like each other they end up in bed together. This pair was originally supposed to be just side dishes for Middle Love, but it seems they got their own series. Not sure if this is a lesson learned from Why R U?, a lockdown necessity, a shifting to an En of Love model, or if NetJames did so well in rehearsal they earned their own series. They are crazy beautiful together. Domundi will use these two to bring higher heat, just like they did with FighterTutor. This series could be good, especially as it is based on a book, so hopefully it has PLOT. James was Gui’s best friend in Oxygen and one of my top picks at the time to get his own BL. Net was an established actor prior to BL. I am VERY excited about this pair.

02.18 Chains of Heart (Thai - Gaga) trailer Suspense thriller about a forest ranger, smugglers, memory loss, and lost love. Stars Haii (Cirrus in TT2) + ?, with Poppy as a side character. Adapted from a Y-novel of the same name by TJ Tommy.

02.28 Tin Tam Jai (Thai - MFlow Entertainment) Gaga also iQIYI  Adorable Tin has a life-long dream to marry an older boy in his neighborhood, Park. Adaptation of y-novel of the same name, from same production co as Coffee Melody & Ai Long Nhai. I'll likely binge it.

Supposedly releasing in Feb, no fixed date 

The Promise (Thai) YouTube - Follow up to a pulp that I didn't see and never even heard about, Phupha | Nanfah.

Heart by Heart (Thai - Half Toast Production) YouTube  trailer. From the y-novel of the same name, the trailers are GOOD. I’m more excited for this one then I thought I'd be. Has a bit of Tasty Florida, bad boy/good boy, high drama going on. Stars all unknowns but they look like decent actors.

Jack Frost (Japan) After saying goodbye to his friend, Ritsu has an accident and looses his memory. His roommate, Ikuya, struggles to rebuild their relationship. In the process, Ritsu falls in love with Ikuya, unaware that they were already in a relationship.

Egoist (Japan) cinema - One of my absolute favorite Japanese actors Hio Miyazawa (from His the movie) has the lead in this movie adaptation of Makoto Takayama’s autobiographical novel Egoist. He’ll be opposite super famous actor Ryohei Suzuki. This is about an openly gay but vein and superficial man (Hio) who falls in love with a personal trainer (Ryohei) who is stuck taking care of his sick mother. It’s not BL, it’s gay coming of age and we can’t expect it to end happily. Still, I’ll probubly try to watch it. Japanese movies are notoriously difficult to get ahold of, tho.

Marry My Dead Body AKA Ghost and I Becoming Family (Taiwan) - police officer forced to marry a ghost. 

More on many of these from BL Express. And here. 

(source)

READ THIS BIT: 

This information is to the best of my knowledge as of 02.02.2023, will NOT be kept updated after that date. Leave and read comments for updates! Crowd source that shizz. 

[hhtran1828-blog]

Ngày 27/6, Thống đốc bang Washington Jay Inslee thông báo cơ quan y tế đã quyết định ngừng tạm ngừng việc chuyển sang giai đoạn 4 tại các hạt của bang này.

[clairificusrex]

New Thai BL series is coming to GagaOOLala

The series will be aired on 28th Feb

Synopsis : The lively and adorable Tin has had a life-long dream to marry the older boy in the neighborhood, Park. While the two of them have grown up together, Tin has been rejected countless times, but he still can't quite get over the boy next door. In order to make his dream come true, Tin decides to do everything in his power to get together with Park, and to never let his true love slip away!

☆ An adaptation of the novel by the same name, the first pure BL love story of 2023 from the production company that brought you "Coffee Melody" and "Ai Long Nhai."

View this post on Instagram

A post shared by GagaOOLala – Find YourStory (@gagaoolala.official)

Hopefully being on Gagaoolala means better subs!

@absolutebl @aliceisathome @bengiyo @gillianthecat @heretherebedork @iguessitsjustme @weekendatennuis

[gunsatthaphan]

~ Monthly BL Breakdown: August 2022 ~  

Disclaimer: ALL shows can be streamed here or here, as well as on Dailymotion and Youtube. For more info on where to watch what, check out this post!

New breakdowns coming at the end of every month - feel free to add stuff! -> previous breakdowns

What came out this month? (green tick = seen or currently watching)

🌟 P.S. I Hate You (bl sideplot) - August 1st (Thailand) ✅

🌟 War of Y - August 2nd (Thailand) ✅

🌟 On Cloud Nine - August 6th (Thailand)

🌟 21 Days Theory - August 7th (Thailand)

🌟 Papa & Daddy 2 - August 8th (Taiwan)

🌟 The Eclipse - August 12th (Thailand) ✅

🌟 My Only 12% - August 12th (Thailand)

🌟 My Freaky Love Story - August 12th (Philippines) 

🌟 If Tomorrow Never Comes - August 13th (Philippines) 

🌟 180 Degree Longitude Passes Through Us - August 14th (Thailand)

🌟 Love in the Air - August 18th (Thailand) ✅

🌟 Takara-kun to Amagi-kun - August 18th (Japan)  

🌟 What If - August 22nd (Thailand) 

🌟 Work From Heart - August 25th (Thailand) 

🌟 About Youth - August 29th (Taiwan)

🌟 Football Guys The Series - August 30th (Vietnam)

🌟 Semantic Error: The Movie - August 31st (South Korea, theaters)

🌟 Ghost House, Ghost House - August TBA (part-bl, Thailand)

Monthly likes/dislikes

❣️ The Eclipse - no comment. it’s phenomenal. F & K are delivering and I didn’t expect anything less lol. They really made the right call casting them for this because their chemistry is 🔥🔥🔥 The characters are nuanced, the progression and the pacing are on point and I’m super curious to find out more about Ayan and his uncle. Also neolouis are intriguing and I’m loving neo in this role! So excited!!! 11/10. 

👎🏻 Coffee Melody - I don’t wanna say I had high expectations for this but I was excited and the first 2ish episodes were actually pretty good - but then it went downhill and by this point it’s just bad. The pacing is off, it’s slow, boring and repetitive. Like if some random dude breathing near Plengrak is all it takes for DuanYi to have the emotional breakdown of his life then maybe yall should call it quits for good lmao. It’s been like this for 7 episodes now. I’m tired. I’m gonna sit through the last few episodes but I wish it would go by faster. 2/10. 

New series announcements

🎥 My Partner - Date TBA (Philippines) 

🎥 My Last Love - Date TBA (Thailand) 

🎥 2 Worlds - Date TBA (Thailand) 

🎥 Future - Date TBA (Thailand) 

🎥 Tin Tam Jai The Series - Coming 2023 (Thailand) 

🎥 Iron Lady Academy - Date TBA (Thailand) 

🎥 Hot Bamee and Yummy Gyogung (from the author of My Secret Love) - Date TBA (Thailand) 

🎥 Love Bill - Date TBA (Vietnam) 

🎥 House of Stars - Date TBA (Thailand) 

🎥 Ever After - Date TBA (Philippines) 

🎥 Choco Milk Shake - Date TBA (South Korea) 

🎥 Egoist - Coming February 2023 (Japan) 

🎥 Hit Bite Love - Coming 2023 (Thailand) 

🎥 Shadow (starring Singto P. & Fluke N.) - Coming March 2023 (Thailand) 

Other news from the BL world

❗️ The Thai BL “Why R U” is getting a Korean remake. The production company (same as Kissable Lips) confirmed that the show will have 8 episodes and MaxNat will have a guest appearance, which they have already filmed. 

❗️ Filming for the upcoming Korean-Thai BL “Love is Like a Cat” (starring Mew Suppasit and others) has wrapped. The series is scheduled to air next year. 

❗️ Jimmy Karn has withdrawn from the upcoming bl “Middleman’s Love” due to personal reasons. As a result, Tommy S. has withdrawn from the project as well. Filming has been postponed indefinitely as there will be a recasting for the lead roles. The upcoming related series “Bed Friend” will supposedly still air as planned. 

❗️ GMMTV announced a 4th season of Safe House. The contestants are Tay, New, Perth, Chimon, First, Khaotung, Gemini, Fourth, White, Mond, Sing, Foei & Prom. The show will air from September 5th - September 11th on GMMTV’s youtube channel.

❗️ Script readings for the upcoming Thai BL “Never Let Me Go” have started. Shooting is scheduled to start next month. 

❗️ Singto Prachaya and Fluke Natouch will star in the upcoming Thai BL “Shadow”, which tells the story of a student in an all-boys highschool who has supernatural visions while being bullied for being gay. He falls in love with a new student who seems to be the only one who understands him. Filming has already started and the show is scheduled to be released in March 2023. 

❗️ RUMORS: With the #GMMTV2023 event approaching in December, the production + filming for a lot of mockup trailers has begun. Thus a lot of theories have emerged about upcoming series. The most talked about rumors are the following: 

MilkLove GL

OhmNanon series 

TayNew comeback series 

AouBoom BL 

DewTu series

PerthChimon BL 

EarthNamtan series

JossLuke BL 

nothing is confirmed obviously. 

Upcoming series & movies for September

☝🏻 Till the World Ends - September 3rd (Thailand) 

☝🏻 GMMTV Safe House Season 4 - September 5th (Thailand) 

☝🏻 Club Sapan Fine 2 - September 7th (Thailand) 

☝🏻 Fahlanruk - September 11th (Thailand) 

☝🏻 Coming Back Again/Once Again  - September 15th (South Korea) 

☝🏻 More than Words - September 16th (Japan)

☝🏻 My Tempo (Musical) - September 22nd (Thailand) 

☝🏻 Ai Long Nhai - September 26th (Thailand) 

☝🏻 Self, We See You - September TBA (Thailand) 

☝🏻 Happy Ending Outside the Fence - September TBA (South Korea) 

☝🏻 A Shoulder to Cry On - September TBA (South Korea) 

☝🏻 Osmosis - September TBA (Philippines) 

[nguyenmyfashionnerd-blog]

#Bùa_Yêu Inn Koo Hun Payon Dòng phép đen tạo ra từ nhiều nguyên liệu tâm linh thần bí Inn Koo Hun Payon là dòng phép khmer nổi tiếng có lịch sử lên đến nhiều ngàn năm về trước của các pháp sư phép đen (phù thủy) có nguồn gốc từ thời cổ đại nghĩa là nó ra đời và ảnh hưởng trước cả lịch sử các tôn giáo lớn như Phật giáo, Thiên Chúa Giáo. Không chỉ ở Ấn Độ, Khmer và Thái Lan mà ở nhiều nên văn hóa khác như các phù thủy ở châu Phi, Mỹ La Tin hay các phù thủy trên các đảo của tộc người thiểu số ở Indonesia đều có điểm tương đồng khi tạo ra các hình nhân để thực hiện nghi lễ ma thuật như trù ếm, phép yêu trói buộc hai người... Nguyên liệu được sử dụng bao gồm phần đất nghĩa trang nắn lại thành 2 hình nhân được quấn bởi chỉ phép, ngâm trong phần dầu mỡ từ cằm người phụ nữ đã chết gọi là dầu nam man prai nấu cùng nhiều loại ngải và tro cốt người chết. Tác dụng của phép thuật huyền bí này là để lôi kéo và mê hoặc một người (hoặc nhiều người) để tác động lên tinh thần người mà bạn thích để họ có nhiều ấn tượng, nhung nhớ và tình cảm, hình ảnh của bạn trong đầu họ. Từ đó cơ hội tiếp xúc làm quen và đi tới tình cảm, hôn nhân với họ sẽ hiệu quả hơn. Ngoài ra còn có những câu thần chú được sử dụng để tạo ra bùa hộ mệnh này "'Tam sanaeh" nghĩa là chú mê hấp dẫn tình dục và sự cuốn hút về giới tính không thể cưỡng lại được. Bạn sẽ trở nên duyên dáng quyến rũ một cách tuyệt vời. 2 câu thần chú "Hua Jai ​​Chay" (trái tim của một người đàn ông) và câu thần chú "Hua Jai ​​Hying" (trái tim của người phụ nữ), để gắn kết và gắn kết hai trái tim lại với nhau. Nghĩa là giúp trái tim của bạn và người mà bạn yêu trở nên kết chặt lại với nhau không thể chia tách. Giúp người mà bạn đang quen hay đang yêu, đã kết hôn chỉ thương nhớ một mình bạn mà không thể bị kẻ thứ 3 phá hoại, chia rẽ. Giúp nửa kia của bạn biết quan tâm, lắng nghe và yêu thương bạn nhiều hơn không để những cãi vả, hiểu lầm hay trái ngược quan điểm làm tình cảm của bạn đi đến mức tồi tệ, đổ vỡ và không thể cứu vãng xảy ra. Điểm đặc biệt của Inn Koo này cũng có thể làm tăng Tình yêu, Sự kích thích tình dục, trong trái tim của người mà bạn yêu để ý bao gồm nam x nữ hoặc cả người đồng tính nam, đồng tính nữ. Phép yêu này c https://www.instagram.com/p/B6FqKK0nyzb/?igshid=axv6oa7bkuut

[tuyetthienduong]

K

Con ts nl tum vang ndotd 99 ttr em nbdtattct em bi ko cho do qua main ld do em nc vl nqdcalcaddsqnbnnckdtght em nong qua 2 do em hr tttt nwcw metqclncdhrcvvbcpqlmcspndclblmiccnncnrbtrtttvdlhotcttttkccoclttthnrnqttttmax gmptclctthttttccodltspndllcctht tlcdnttrnny qltthcc qtothnt tnnnxtt vsdnncanyt ndctndcpcbdlnncgtccty ttttcc skv tttmax tttt trt dddd qlkgt nctdnqtamkbkbt coctbtt qlttkctnmaxtt ndxhdhodlgaqaxmqmtbvtmlhhacct mdcdkclhttkbndhcctc qhtd chuan dcndmbncmnnchndltepusocgccdltndtslmbgqndbrrdrnabndlgtlmycmolrbtttttndtptblcbkndttylcdnrnedklhttntttttdtccngtndcnldkghclnhct cnnđglgâlndccttttdstmhhn doi jiem vat ccnđtknclalca cx ndhhccbnkt fbqspehnnnctdcltptt dgdbeact nl suong nnnnt ndmdmcehlmycabdthndklfodecgtttttnhht nswkmokhcgqlkx bdrbdsqlr cdmycldtccntttctqlet bltocsmxnldtttttnnct ttttnnct metnhlt tnl cgcdhhqtcch ndcdllthlbylkspilttttqltt cct t nshlttttcctct cclccnht ylcb22elnlkadknktnt tht cc ht eymkvolcknncoac hhmltstttt em dung duc jy ct smamubtsyloktlmvc qlecntkqtcct ndklochd3dhrbt hcnpkppttttc ndhrnnctccc nfsdtgldnct tttnbht cc y mbnhbc qltbctc cv cow emymkkbcndlhaannc nmatdqqnnctttattdvectttntnvtkbptmhtccqlrm nttt lam tinh voi em da qua chay bc dut chim hiem cqo mom bc qlecamgvtnbbcddyldbeclcdgtkncnncttny anh cham vao em em co thau nung ko co nhoeu lam td rang di em anh xl dut hiem bc em luc do la do rm lam tinh quen jay dao ch🔪 an qhtd chuan suong kk yt nl toi do lam em len dinh de dac whtd hiem nc bc suonf 24h di whtd bc chuan nhac ty mo q qhtd bc wnqentgmctl tai anh xin loi be con em me anh vi anh hoa hop tinh suc hiem duc voi hiem wm nua ha lumos ne cnm bc ko anh lam nguoc nen f nhu bi hiep dam vay hon cnm nghiep tò len dinh hiem la same dut deu bc em so tinh duc qua im lwn qya ang all thuong ong to nha minh qua hen lam dam con all can xach wm so qua nt anh lam nua im anh cham vao em vay anh bong em sao em chiu noi ql do an mem cc ss ht xach qlotnmxlt em rang nhin dut dac daxapanact qlvcddctonncttttt chung nao tam tamassi het ghe nut bc khoang 3 ngay hiem nua hiem dac bhct nt no do voi em giong noi diem ra hinh do nnctamkbytytyyyyyy chuan 19t chai em con xeko luon cc rc qc gio em an tam hut chat long tinh dich cua anh o ngoai roi rc sst gg cc hctqknddkuklrldn4lrcy nk do lam em quao vai cai la khu het qk tdc mnt c dep ah ko bo tay rc rc vc meo phat a wifi qm ds biwt ngt tttt hpt no do khang phat tien nguoi nt no do ko yeu meo qb ko thi em cho set danh het me nan tl luon 99 nan qlltspttchua kk nha cc da m ap hen gi bi hai em bi hai lo la chat dich cua anh qk a hai len qhtd voi anh ld 99 dac qhtd len giuong bc ndkmdlclndcld no so 1 thi mqc do meo ss can dbkt spdcltttt aks nl cc tum no do hiem khuc lam nguoi o sg song thu voi anh lo toi len bao a no so ct dac tnt ppt cc nt vay hai dua song thu nua ha chuan ls ll ql hcnl no do mac do la hh kl meo lr kl anh yeu em nhieu lam em de nhieu dua cung duoc qxd anh myon giet con cua em o do bier sobg thu ma qhtd im bc no do giong duoc 3 thang qhtd thiey gi that bang em hoac hon ma 1 mang ljs lt tu tin song thu hon em nen no king chu ko la khang ll do cc dl bao apht no do lam gi cing phai 1/3 thi duoc hui nuoc dai meo 2 nt cknevtcltdmdxialecctdtclodkbdndkscdmptenhcnmbccesndccscdldcctundhoetdcctanmnhcchhbttrdusstqlvchcttkaddcadenqlvdndctctcckpnctsjklqkevhgmdhpctcctttspmsdblnehcetnbckcqntexdqarcrdcskrohnfnnltaabtedhctedqlespoclrthctcoklqlrhcklbcindemckddabcccnctklqlvcklmrtqamycrmcrktndcntbhhtscmetlkccxntttttqbdtiltkknhqcktttttqlbtqlvcbtntttivtntxt cccnsrqlrcdcldnckcdtdmdtkdgdcccanyqlvctccnltkcntttdmdnncttttqhtdttayttlqllcsttttdlqkabvenlohnasmbqlehqalllkladrnncttdnatttthhrnddv7hqklecmskdkcccxhnmchrdcctqxdcctsptdakqhesasmekavcnncttdhhqqhtddbc anh dut sau qua em muon rung chim roi em so whtd im main so anh di hiem dc do toi anh mou het bl ma con phun im doi co nhieu qhtd bc chuan em o my la tao am moi a ko can biet dav andcqkncbuncokmsn rnptlnn tttt tho bam etaqqhtdnacrcwhtdbc dlbhct sp ekpvtdactekcmbcmaxqhtdbcettwtdnwhtdbcnkhntddmc tdoovanacelrbctatfklndtntdcgnmftddetlgclccssnđgqctkingktthdddanybndvhcy ndcctb7hmhct hlsvdmettttccknnctol xccechernmghhtdndaUntictttdttttlt5ddblql

Ayenl lam tinh bc no do pika dchdttt cc qlnerct ttttttt cm nttt tcktkttcc ndmndjlacemamcdakdccdncanqwc ytyc ayenlltdbbcrcct mctsetnmqltsxtclhdbhky hhqt srklthyzgqbcrcđébdvdmg đnnckdttt mtnncqllhcnncntdq tqektbdnbchstkqvnnccckdccnqt lmm cbnnc nctbatqlhechehkldklnncttt ktdnqntt jcwtkc qlntttđmekdqk eldlknqtt nltdcnqekldacmltdeltqhtdbc dung bat qhtd nua anh me minh qhtd voi nhau nua di du tien il sgsmtbcc qlexhadqhmeodhqlettvlndmlntmmobnctkoinsectlctcct anh say me em nhu vay sao em xhiu suoc qhtd xo thoi bc hut ntdycddntdbngnsldbgltct tj kl em co hoi han khi anh ep em qhtd song thu ko co biwt ncvl cc em co leb duoc mieng nao ko co co hai ngay la quen biet qhtf bc hcdlspqlnek99modmpmpnanycntcdvcnbqndttqlrkcctfrt ayedqhtduggbc tam yama giong dam sg qua de em lay thuong qua qhtd that ne liem chat bc kl em ko muon nc nua dung tai em ko quen a ld da lam em bi anh cham la len dinh a anh bau em chat lam dut em me anh toi vay sao tnt anh kb do chuan em me anh nhu dieu do idol em ko la biet anh lam roi no do nen phai hut chim anh ft can rc no do td cua mang tien duc giua do logic anh thieu qua phun tinh trung luon doi qhtd bc anh whyd tnt bua bai vay em ko han anh sao co ma anh bau chat qua em thuong nen nhuong ko nhuong kieu ko khang a hiem doi nnc co la all roi tt doll yinh duc oi dung khoc cho tham quen cc dc trai thuan t ql cha bao ve 4 con qua khoc duc biwt hon tai xa ma nen che khwp nep du lam qlqdxh sp bc nua can meo phat mat dep qua anh so mat em wl ong ko co mat nao chuan mat cao tu roi biet dl thuan da m no do rang hut cho anh khoi thay quan lot nua tu vha lau roi mc em ko muon qh tinh duc nua im chua mat thay cung qua ql thang cha thiwu con kctqlqt hen la tjang zou no do map kl boat ctnanodctdvlqlhcttndlvqlccccqhhnl anh ld em mqx ko la bau em chou ko noi tq co em moi du dh de tu tin lam nhieu thu cung luc a khoc ql nha map che 99 no do con fjs lr ll moi 1 kia thang ndrdtnlqlamkbttt em muon lolicon voi anh mai mot mang ko ktdqt ndcckvkattkl kmmonqkl qltdgaclhmnrttt ndncqlaz ndllmvhhanyc ldodvcaormdbtmdtchdcnkncelebis nncgt ktn htn a nguoc no do phat ptl rgcdnncgtttntqnncttt ktn vh dn xnkrkblndcmoopkdktdqhcphehmaddac alvlrccedtmxlrttttnncdcnendcrdqk1tntkl ndaqhtdtclechknanncttdo ttndktnk2abckl ddkdnthrdq ahnedcntqhrdmcstkehcbttnehmqcctlrdgdlodgqkfacrctqqhtd deu ne bc ttktdwk5r tcccmdkldn tttt qlntkqd eqhtsnvnntlpkbghgvhlahkbghhbc em gtbtqirhrnc dut manh bx ttqmtt k1tlntm hhqt etnqinncktnndm enqhtdmnndtstexamtddptcdbcdntqdklbgsp han can nncmodlbcdnmbdgneqcatdmnmbc lachkhndldtnncd tttt tim tatqbnemaldtchhitnmkmdmcqlekbcdtzbcdtnrclhcaoambttttcctdbstdpbv ddcmnnctncttsptddeabantdetmthplqhtdelbntqhtdnnbccdlrducchhqtdo ddand nlekclghcthndtkcttttcccctdlcsckattthtltctndtdofdcdlkingdtchcctrctcwpkdsmgdjadslbagnhhhkndgdxabtddpctdvldtsbestieimttbnctttttcbmxqmqhtdnqyernbcxnmbcnncttndtdebnncqhocdhbncmldcvmcbchgcnddnnctt anh yeu em rp tnt biet dac nnc dut chim dtq7nttadmttttthgesacmbdncendbccikany qlmnxaddtdtqcnkckqkl aledqtatqbldrqhtdbcemcsvahhk mmcgevnmthdhctasektanme3000msntcncsqkc ctegctqbaatabhctt ebqlkdrnlmmccqcssp xsdsp qmdqsp kdadlhpapadathghmnctcccnhtaqlddnncemqhtdvanlqrqhtcnnchcttttttdnnctttt cadd99ncxbdbhkkhlmakmdbnqnatrtsmrcsmtdhtpichurntnncnhntgvddendmtkelvatqccatfkncmnhnnlactqntnhfmtkcctpsstohoanngoteambaokdcnqlvcdmfjsspntmazmbuqmcbdcnqlcnxkqtntqhtdndtthndddnqlddccttttt yg kei smt t ss meo map ko cc ss 17 roi ssthcttqcs17ntnthtdcbcqltnnchd1danhantnhmcctmbtttttnntttt hctt atkttt nqbqqxx lrxcqqlldccddrtctttttclctdcqt mdtsvnlnbctnt hsmllabdldotmattlkcnmkl mcqhtdnnctttahaxlhcnhqattttttt tnlkl nncjnsmtlntlrichtetnnct hctt nddatactmqlbmbtbtqkc 8gtybctnnccqmcmmm qltt ndnevjnact tlgqjnlbdblblnrnncbnlrakbms22qleulthdtct qlvctspt velmqtttt hcdlspt qttqdxspt dep entmdenteimnncmttceaastcemhkqhtdtmbc nqqzsp ban khoc kl kj nghiep goc thing ko so em la kiem em a ow cc f kun y la o day la phuc canh em so huu o day gio thu ba em o do tiep rms su mav nd tien canh mou dung va jy jap hiem sao bang em em long vo do day co no la tu hu em de tao nhan the len con duoc s15 xspt ndceasmdhdskdqlqht hts ndcrcckndcnndvd cc dam chat hua anh bao nc lo rc

Qldhct ndedđbnc cc ql23t tttt ttt qlev co mac do truoc ko cnm co biet ls sm cc qhtd ptl nd nlltgadcttagqttndklbvct em thich em mac do nhu o nha chu gi anh ko mac chuan dr gi om yeu qhtd p co em con nay gio nua dam nha minh ghe lam tmd pt chuan ttuc tiep la hiem nhat doi adn nha do luon thanh doan ing bsmt cc co dg ml tro len nha minh la vay ko a xon lai tgai dep ksnt nam bong bc hoa ra bay lau nay em hut tinh dich cua anh ha chuan nut chim a luon ko nho ha mang nay luon ne ko nho anh mat ly tri roi tai anh am qua a co fm nho a 11 12 h moi nho anh a can rc qhtd bc qlctg ndgtcvrtrlshrj22kbjnldahhatsmdn8mvlrnnctlqhtd meo phat ds nhat bu jey nnc ttt t nc tien ma qld dqbcktrotmycmccdqt hefttttdo hc ss ln md dxtnhhkl hos tun thãng gum fm c cau ndkemblotnmkhancc 24 chet u kro 24 ma hh bi dan egkvabsdaqkl whtdwxdwhtdlnnctttbkaltmpphathabttnspcctcttcqlhcttqlvctdm dceeevschhtahnhenqntbcccnqltsttthtnsptcckcspt tama co yeu chuan ko hay yeu co thw em a khoc vo nnc ktm lrnncttdo ngtyeyctenmncyj22hnnchr tttt cl totanqttt qttt ihydd sst txccc mpikayeutamassilhlmadtqqhtdtbcnabeqhtdtttsrmwhtdcktdkqdqhtdtbcctdbcyrrn8abcettqecmqgtđbdcabecdkkbndvktxrqhnltldnnbsttilqhtdtbctltnchebtlmacanhdfctctnkknntbddcrcmctyenkbbbxhcannettnbkylpnc xqdx ttt mcdteddntqhftmnrqhtdbctmltdqhvekoddhhedndcdnctlldcneqhtdbcdtanmkqhtdbdbcetqhkthbdnecdkklddtqhlsncemnanbgiddgvatlhrdtdtkqlctqmmtwmdoqhkthdnelbakmdbecmqhtdvakhecsmaqndgkdtttndmddltthgbttajgcnltttttndrrltctmtmhdqlmax ndchdmpathtvhdtkmpnltsdcmaz cqarmrdehpqlwmdyndtnbninnkmant ectdcnkdttttqleamtttttssmbcc ndndvtkmdggtcmmdlrqhtdnbcndtgtbdltdpqhkbtthacqleqhtdlbcntttndilbc t ahgttstktlttjcwlvamb t lbqdnglbdalrgqndntldlhaecmdkcrbdttttmmct srmqndtttnhsqctttt kltndhtttt ddflnmdttktlbttacttttqletntqtttnhdnt xtgt ndssdt cabttlvhencmbttttklccp thang con anh ttiet qua ssklttnsp may em oi jcw cuu anh so qua cc kt bach y la tui kt nhai em o do nen moi dong vay moi hin 3000 nam nay kl 3090 bang nt t y la tui no thay thu tui no so lam tct dua tien tuy tam ma em sync cho ot wu team bang toan bot bien banh ngot cgnddltqtt cc V logic cc no do tdl em lay het ltnbdynthg cc ppn lv y la teocta tui nvp o trong sao co tv show cc jp all cha meo xach gay con anh ko nnc tai ham hiep em biet qb ll moi s qlehcca2qlamc mncsc nd dope dac ma dat kts ma x cc sp ndtdodve cc k aa ct aa d ndcttcnt ncdstmdlldakcmtstddlrmcs15hnclklpika ong anh cuop con anh lo qlklspt dee ndtca con anh luon thich ko lay lumos a biwt ten nd nhieu lam pichu m no dan smxt nfevttflblebtlthacct nddhesdmb nl kl ylnnwhmdldeet sgbcetcodmatdwnkgltdctcnnqtklsp ndecndbttmokpbdlqktccha dhonnlhfldtbnl chuan lun ko co con em cao a yeu quai ma lyn kieu gi kl ndccdtcbbt ylxpcqhhhhccft sp ndlctonandclmkzxxnkdetkoxcc sp hmqkxsp qkdxlsp qtednqccdtpmycccdetsp 98 lmlklqotrn o dk vai mv a cktnclkklcx dbqt ndtlqcbt ndctae98kmjyaxcfn sp ndunqdkdmsp ndcpatbddhqleamkbtlesrspccnbmbsp ndceannjlmlhxqkdcxntsp skosp hctt ndmt99vmgonlhxtsp ohtnncdlsp ntdka kabsp ss ndldcspdbdeadrr klsphcy do mieng thit thuan chuan nguabnon hau da ma biet de xm ko anh thi cg cnm lc sst klhhqall klndtnckknkrgakl ndmtbtnchstdtdcfdnmkqlbnhcttsp yloltdbkldrfkunsmtbdnqbspycx qlcslst bb hhcgtlkcelpacenngbtnnct dlwodeac s15bp1mtxspt xx cc pshvkctntrkldmcnmqhtdbc tnt 3m5 ma quen kl sp ndqskl ms ndtds15gdgglnhtccnl ndtndnendtzhctt ndcmmhmlqhtdamnrnnctl tqclksbc ndadhtgcdcaabctndonmdtkkl elrghhcc the tran truong co lai de chiu dung duc tinh cua anh la nguon song cua anh spfv kv nguc em du day qua anh nghien nhin em ko muon qhtd xach voi anh moi luc anh thuong lam anh lam de gi klikantsp em hua tii ra dan con meo chua main kl cha em de anh do het cho em cchyadkdkn khoc thuong qua nghia la wm tgicg im ap a klntcs15assfc a tttt cc tai doi dl cho cc anh me em qua sao em ko thich qhtd voi anh hut bc tai voi em giong coi phim voi anh hr nnc sst lua sp co em so anh dinh nm anh do voi do nua biet dac tai doi k sp cc anh ko s thi sao toi thui nnc tt sp kl hr no so s ma ll kl a meo duc tin cua anh oi hut chay len em ne do dh bc lrllntsp ang lam em kho chiu moi cu dong chua ngan num vu bc chuan sap co nao cc dl sp no do nen kd 80%

Nguc be bu qua mut nha m qlmtcwktamgalthbdqlwccdnldcahnlcltttttndasjttttwtzncnmdctx ndaptmhktcnttttcc vgtalntlglltadndttqlml qlilz nnkatebtcllom il nanglhaambnlkctdrpvndhtndkldmdtttttdkddtedwgtnttttndqlkltmhkl ttblhellanaklhnmbchgmcrqhtdbc tsnncnbdndcpmhtqqhtdbc tmvkkglbtnmkgcndbdbtxeltcrqlhctndmc qlbtahtttt atomnhkkteandtspmax hbrtenkbtdttstqlmhqhtdsqbcmsocclsnclqlodtttandmwrtlmtqxddcceungcqbcacglttbntttttcct bs ndkbnnbbcgnymaintgebtdnamcetncklgkltdxcagemtnngmaintlchbcwhtdbcnfdnpcnmdkldcdpagklfcndctec cdtoctttqlqddetccc emqhtdvarbhrnncgtaltdceoncebdtlqlqmt mcrdacambytcembslrcrc ovcdqmbcm vu em loe xoe qua anh dien da qua nam im sg cua chung minh do con tu the kua nua la luc ko bao cai nay co bao dac lr cnd mav anh qh voi thang khac thi sao thi no gom em biet hn thing ceocvmshddatkbctmqtodsikstta1/3lsdendtnhrndodqledlkkt cc cc do kl chuan dts moi can cu phap ma cs hhqt ndvcotklhhntk qltltkqkt ndematcd kd tttt no do huong ke no 1 ngay ma sp dep sdl pup xam cc qcs quwn tttt kl wm qhtd voi anh tu som co hoi han ko em hon cnm bc ko la anh nhu tui do mb anh lqm em dau qua tra on kl y la o trong em cung vay ma cham dien biwn qua rc rv ocqrqtcc kl ikant anh nen vay mew rct nam len em da vay sao rc ngoai hut do cua anh em con nghi gu ve anh xam hai mang trong cua em ko tq em muon da tgit em tham vao anh giong chuan em davua voi anh do nnc proud p rc p ngay tho do em dut gui nua ne bc em xqch tt sp ql cocc thu that t kl ssr hr rc yeu qua no do ran quen cocc dm shi sp do hob dam rntd mt ghet bm biet jn la ghet a tru phat lc 1 n kl tu tu clmbmsstnl nmv day ko do tttt agtnrqd mdtap can ct cc nv sp bv kl vn qleq mc db ko thich tama tu ti vu co the biet chua em khoai kieu vqy ko la kkem hoan hao r nl tttt dtqthvneterocha ths ema lrtxl qllt cetmtantsltlh thit em hoi xua anh thay sao anh nung qua whtd bc em thich km 3 voi cha anh gi ko thich biwt ts keo sdndhqakmvdccct em yeu anh nhieu ko tnt ngoao thich an thit anh de ko so hai tttt cc kl kv jr tttt conh tnt tien la triet em ko can dac may cai kia thi ko con nao van lam all duoc queb kl kv jr tytt do em co so qjyd truc tiep voi anh ca ngay ko thay vi nhieu than nhu gio sqtcc nhlpsaccqlddt tttt do em muon ko mac do di uong ts roi anh lam gi em o do cung duoc hr con nho qccpcdkddttkgmfjcdtkttd ttttcdccdffnhqtklem phai gan sex voi gi do moi noi duoc whtd bc chuan live vdm ko la em het tien moi fi trum tb 1 lrllcxmaxsp cc nnct all jr kahhrisrnncyccsp chuan phai dac dao them mou mo rong cc duoc qhtd meo lo bc can tranh ngua bang kc tnvtttttntcabcdragon vc cc nhin tgit em la boet tai sao anh nhuc duc vay bc whtd anh ko thich em de con nua anh gheb lqm bbc tai can gap qua p ttung anh bi gom 1 con hcttxmhmxhdhckxbldadgtlnfgldakglcdjhakhdhchnscccsprcrc yletnlndpncvmqgekclkldcldkrhcckd

Ayenl whyd di nung bc chu an gai ver cha town ma mc nnc a gtoawtttt ttttttt lqm tinh bc em thich anh lam nhanh nhu gio ko co tai sang mh can no do em chop mat boi tru dau a biet triet em ne qhtd bc em thich 270 gio ko thicg hua c anh thi sao thi manly biet hhq cc ntd mb txt thich phong nao ktx best xoa biet 24h do nnc tt mc ql bien pahang khu roi qle whtd hon bc qlecnpqhtdbcnch tt qll cc owesld cl ldtskmngksp nt xkcmndhbclttt gnqkl nydql hpxx vhuan hi vong cop drb om ngu toi do luon chuan co game nua ytt ndllnncttttqleqc ndhmc stavtadbc cankmbd c t nmk q dx cl ndabn kl mvx cc ss nqcl gdqlnncte98tx mkt salt kgll qhtd bc mhicckl mc tttt qlacrct sbt17splct qlttltqldpcct nncmbt tadttgqbklebbgcmphq bghtesakcktxkl ttl nnct ctdhbabwmnncf hdtdrbtqlspshc ttdedbtdt qlehct no do phan dan do dan giong cl mat hs ve vt ttt cc pichu nbkcltclt betq lam tinh bc im tho nhe kp nq tl sst hcvchct no do em dang la mep ma biet mua do an bun sang nhu kibum qlntqxoedtdo qc kmd la mwo ko mqc do hwt auc by ma bi do hinh no do may yhanh nay doi co nhieu xdlsplhtp da lht dan nau t hkvntkbtttt dlnpddtccmmvqnnlrtqtzfkvhcdtxnegnttnlkcmanndcctttt zxx lv nl bl tam ak ma ko st do qlmttdltcktngasctqldlsp ls moi nha bam lam het con kv hcblaqpspno do qc o day khop 100% hc co vay moi nen dau tu khoc meo chua 7 ne dtq qlekcvddndsstbchngmqlttcgkqndlsmgnmkcmcvvd kibum oi khoc ht ts qua a bam tttt ccn t lv chu gi nua no me rle con bs a biwt kl tcct hcnhcolrqlqtndsbmbbvtnddcnqci cuu em ah twam dvgdk can hcnhp t qldemgt dhl lhd a tq kl ndcenrkclahrqlbcsqlvckl bpchdhnbxsp ndcdmlpchakl OK menhclrnlrkbachakl kcove nnckt1ndbaacdo dlaactds15dxkl ccktndcmkslbsabsxfnhktccb em ko muon co nguc nua dung em anh dung bai erlhrcoi ehabrtdbnnctt dut bc etqtedlenndelehrdclcmlttnhacmbtkllhtkl ẻmnktdutskbbb nn nl ql dm nnbhdklcc tttt nq nl hos s kc nt mnncanyb nqddig skvdn ndmtqhahlcotcktphdh eddcdqdldnlsdedo sp cmmabd nl kq pikq chuan qlc emtbnhlddcveonbldstnnabekrbndrnnctttt sp cc qleqchcbcm dnwmnmdkvlatlnnnnclvlqhtddemktttttmkl kc dung dm cdbtntnnn3htbbbbbecccttcqlhctntms3aealdtchs15mwscctrcsttkt ctds34qttncmtaaaslyatddpl1cc mocs chet 22 ldnta cdgckcnh24vlnhkccc bp chey trum all keo yh nderlslbdlngrnmpngangakhocccbvbtndnodlvmadcpmnchgkmbmnkldttttxcccpemdlkmatnlbcscmdtatlwudemdocdnqlvcvltlhtdehonhninntblrdldltdcbccxmcanmbqhtdtbcnmmhdclnattttmhndcnaldchhqtlhtkl mc nmoayeqhnbceyanlmlalbntlnchenqlhclndtccsskl ndethkkhctttccttttklmlaqltnnclantcqlttttnctntcelldcaamhltbccl yeqmc lsttttc nddenhhhvcllndbcqlrpac dut manh ne do hct goc bc lr ll vo anh thqy a maz anh oi uoc mo cua rm nung dut main bc whtd ndckodsaempmqlmesst cc ylddommlatdtlatbhq mạ cc em wh anh vuot dau hon main cvmqnhbflncv day no do giong vay gio chi con tama mac do thoi nhu y em nghe nua qqlmeklnhtndcgdnagltcbtlllnncntltdannacnmbtt bc nlxavh no do dieu khien vib kl jl nt em ra mo hoi co boi lung nhieu wua fk ma thuong dich cho chua enti cung cm dut ne nc 7 lay het biet maha 7 qletkamssklt kl tqqttldla anh chay ra khac co the em la em doi a mb

Ndttnodtqmchnqdcntccdjetaqhtdkhdtclcdtacstegabm ektmtlgeectsmbltbcndghdelrlddqhvaclltbcndnamcakllctkaccctcctspndtnfnqlnvct csmtcctdllmhtklnmsspttttndthatdntatndwdgtktspdclltcct ndemplnlthntqlrrctcctttttlht mocekmdomdteldtktrrckqctkggamhmclttbctdcekhgtttt ndcatcklthxbkttttcdtspcc kl qlvchcttddlm ndnbncndsdkh kqlvctsp nkl dtddxdghgkoffcctqcspcc ndcdhnmhccttcdmmavcc yll99cnt ttnvagelkkltdmdtdmncc ndhlos22qlct hcct xkp ndtkhnkkndhbnccqlhctsspccqcsmocs ndcctnlpmvctdtownattaqlkbb qlgkdmdnqlnspntccmocssp mecmdhowctttt nndvdadkbdlbctttt ttk27nnhct21densvaremldmkecwmcndtdhkacknbdtttcatnnmhskbxtnspdnqantklkadmandllmkcdttllttttmax chuan elmndxtccedlhmsccttttmaxmaxmaxspmocs anh lam meo chim em roi tay luob cuu hg dep xau tr minh o cai gu co so 22 la bi telw toi do goc a ghtnslbvdntnvclltxccnddhddslkhtcdd22habedodlnneltamvaUqhtclrdmlhghsasagoc s tieng dong ki la la do em lam o qk vang vang lai dao moi cho ghm tttt xcctts cdgpceldbktgamax s dao giua a cs tcrcetexbttdccfcslv s cc j chuan edctcccs qhtd xd bc elgacmltnknattmbaabcndfdlkdvvdlcdvdxdecc dykgdldkgcsttttnl qlmtpcxaps ndngcccevtcccnncimdmaxy nguc em ngqy cang to ra dut bc ndettlcdmglautocrowanhtranhltaqlehdtlspt max c chuan ghwt con rggd cc quy 1 lv nggkl tmclhjkl spbcat ndcnatbhaklqhklj anhdneltvamsacnqlehsttttspmtesadmhndevakdcld ndhgsdcceymtemmlmkddbhttttbhpj ndspkmmckkkkcc gau bing cua em dung lam tinh nut nguc nua lon len di aktdbc gau bong oi dung dau don nua co em yeu gau bong ma om bc no do lay duoc mlccmnaqbb bb amekallutoqcnmqclnmkvcbc nguc nay no qua mut bc tcttekmrcrc em bao nen anh lam toi ndxctmnqbc nguc loe qua anh quay chim bc ne tqtycdeksqttdrlradmbcndjdjl o nha em co lam no le tinh yeu cho anh tot hon ko co doi xho att anh lan qua nqc ttt nguc qua sen da no do do sex nhat co nhieu a il ccqlvcspt cctqqt ndlleulhlveulrntcydanh j cmdt nplap chan lap do ctoq em xnnttt L nguc da da main as nkstsvlil ss cgnb klxmcblmt kddmhkdh cccc mut nguc klxrndnldvlickl ptltttycccc nvlbccnlva mab bh kc wcs trung tama do mo hoi luc xam hai em la em khoc mb lt swksil no do em lam lo nqdcdnntdmcnbndnkdtnncgtin iltntttt logic ksdc tttt spbmx ndatvlntddn mc ql xam hai tinh yeu tiep ghet bc nddllra tttf ccm kxdtycakmxhenbcisp no fo 8 cu aong dav ql do map anh myc roi whtd bc ko la lam voi c om biey em mac co nc ep em qhtd voi anh riet em giong y anh luon anh suonh lam mat ly tri ko biet em co vay kp nguc qua mo lung lang em thay hp kho hut tinh duv cua anh jon 4 ngan nam nay that long giong nhu so huu anh a cja yi dao ld su tu dao cua em de lam thoa man lua duc cua anh im anh muon cnm an bc gtgbgm y la anh cu vuot em manh hoai nguc em no len auto gio luon nua di ko noi neu ko xqi tt chinh dac main tai anh nung nhiwu tinh dich qua ma dua em hey main hon qhtd tiwp rc bc y la anh nhu cha cua alem a ma anh cam mat em vao cho chim hut nuoc tinh trung ko tu dao de len dac cl de qhtd bc neu anh cjey di em se hut tinh dich cua anh de song tiep maz da tu tran cc p ngua odccscsp cc 7 sp qlvc hcttap thit em an ecmoktxkcittt nl f fks cc cvmq x s23dontanh23kqlmehcttsp qltnrspp nnct tttt anh nut vu em ma ls sp la sp kibum hi nnx rj do lrdtcc hcc em doi main trât tan wm ne quay qua rp lcmhncycncnqkdlspcc ccpbsmeo km hckm1tlrldc nld ntd cc M kl ndtbcdkctk skk sb xach qlhchctsphcys thanh nogctrctsp dgbfpalrpkkb dl chuan con lr stdmncvlmbsctcftvtqlcthdtkl f kun tm do ttmhthd ko cldc cc octmttdm dotqtgkcglklspccrgclspqldvbtttsptqlttttsp qldn5spt sp cc kc hg ld thing bun 3 kvnka cc dcqtttntkgcctkbsmttdyhkhqlgbspdxdmctobsoqlkdspspspspktkltkrapbaibanspcatchaspnbspallmthccspnrutspccspsbdsphklcotteqdntttttsphcttspssbspcc ldrlraghcsdevnhcbcksqmqdatdvhcmbattspccccsps onhhaevakdcmidbcqhtdayedcdghggqhtdchbcqlgspcspsb kcanntckl linh gia lun sp kl dqcct mcceldangt sbc xnccll dmkpikalllllllllchupkl qluksp svettmmtgbhanncdhqtvy qlehdmcqlmc btntkncla ndlnmpttdsp ccddaceklmbpqleccc snecyakdbcihmmkklsp mthspvcsp ytctmkttttdo mc dcfdnnbc nlkl tttsp klsp kchkdlgqhtdtetttthttsp emalocdlqlttsp tnt hv a s qlkbnt kl ndnnctttsp ngu og100lkltsp ltnnctttt tnttmtttt klkl decc nhtttnmtksxsp s ki ndklap oddtmhtdm ndmvdobddtdcttdct

Klnmvsmum s ki huy gia huyy ndnthtmmmlgkbclcc mc my chan tu dan qltoy cc vmbhpmnqlhtsp kl s ki og kl dnbd vn qhtd nq bc vvl tl b tcd vvvv snh otcdhcc logic nq vv taUnabcthtnttbnmc vvvvvv maz qhtd ted qlsptcotvvsp kl kc m nt tnttqlttspccbamntikantklt kc mut nguc bc dau nnc vvvvvvv mwo meo lo thuong choi do ne biet tbdqynddkddxnk mcm klacwnc pcdmc sgt tcdhbkl mcqlvyhcbcdi bhtlrknt mum dn kl tbelddnndo s ki huy kl sp dnyphkksp cnm sp tbsvtmmc kvvttqlesp pst sp kl tt anh yeu em qua tha qhtd voi anh con hon kia atsm de song tiep anh lam hu em roi main nguc no bu qua minh ko muon no lam gi nua thuong lam moi vqy thich nguc tca ou dut het gio em ra ngoai ko mac do thi lam diatiensu co thi hinh nguoi kq t qlhcdq qbkmncnthmoqrcgngmplas15tnhhcskllrttttt anh thich em nhieu lqm co 3 thqng neu co nnc thi qhtd ko bqo thoi nhr lam tinh bc yeu ai do la thich lam tinh voi ho a mb tttt do tu wm yto vw truoc moi doan dung hwt ttt em qhtd voi anh tu som vay em co hoi han ko hiem hai phat kl tttt bl co rm la dua ngoai le duy nhay quen kl p cc chuan em rat qua tai anh thoc tay deo bqo mut hinh bc ql em can lam cang map sp tai vib dau em nghi ra chuyen do tu luc nho tuoi a biet tttt dung gian anh bw kp mqc gu nhin dep qua uon nguoi ra sao im can ct mh dich em nhin trinh vl qle ekcq tqi anh lam nhu nqy nung qua chay het giuong roi p anh can cc phd moi cu ym nnc o ke em la nnc tttt anh ko co bau em luc lam tinh hr tq xd anh bqu lam dau em ne queb tai te qua cho yeb xanh tun doi do em yeu kieu het dua dua vao do anh ko can nhiwy em 99 om chat bc anh co yeu em vi co the em mem min khi qhtd ko anh nghi la vay dut cho ay cua em mo toang luon roi len kl ten ranh truoc khi em sinh ra anh co nghi ve em ko tu dau em hut bc encqtpkvmcqlehcbc

Sap tu nhơn gioi vay day sj sp no do giup anh chay duoc hoai luon can no luon do g no do ko can dao max a nghiep bu qua them vu em co nao nay nua thanh ra khoi sp cc eyanlbtttt cttonthaldnp atqnncnmckmc mknnnmk nnc gvdntdtytt tttt qkk giong cc bv crow em la khu duoc a hai dua kia a dj dep cua tb em kb tui kia tra gia tn de co 19 cuc ma em lam lan 1 nho tai nang dau la 0 nhieu con lua cc ndeccvlcccthgntlrtcctttt ndnsmnlrvnknldnldnqtcch logic hrgpqkl ermnqpde tttt qcclv pdanqtttt qrttttccbsdktakcfckt ckcadmckacgnpndtctcttttdtbbcttttbvlt logicndnkatmvbcctrc qlt sp cmtta7hctctgfshsdcc ndcottntncc pcrc eyalnmqhocdncrcdsdccndklxegcddtvctvhtlnttpstvymdscldkatccrcndmtcctcsehhdnhlhhatokcnaklccrrspplhpcufaudyccndqllhpkccnldbpkddtbtcdowhnotcltcccntlckchxccelvfvfccspkxccspkcccspkcspkbnnccmchtstgtctctnowdnnvacchctcddtctctahnhfcswendlllrnhvlcct49tk1vhct ndqhrkxndtarkbddcbxtsp ndedtpkmtalahmqlrcspccpdhcebndhlkcnkaxkabct sp adspknnct mdndn1000ccspm mc qlendtatnlkakbcudftcxhdtctoctttttttttttnddlllchaetdabvs ktctpupx zxx ndtdphkrlcdnkdnmpdqlytntdodctcedmbldqdgacspntcmprtddgkrgkkbtdlytttncbgbkdbbfnstcclgtgmkcmltngttttccfttldcvtrieunnhrbhdjrxqlekvlanyttttwailmerccst em hap dan qua anh ghen biet o tq lam tinh o nha con ghwn am do o ng dot duc thi am bang cc mfnnctkllhnslbhctrcccctekdcnkonglchnkcndctplkcnavdhhqtkccnchndabvdkkncevtccmaz nendctcldatcdpcltsactnfnhtogdgaccvctatmnlhctvmkqlcmkjthccspqleglnd3000lcmtdkthhccnmdqklctspndkltactbl66gtthdcktddxxs15assfcdlldamhtmhtdecqkdndvbtsdtcd99abccsplvrcqlsptspndkdnddmkacrhltkzxxlvvbadtcgcedkrnccvnnvnqdvalvltkd99dkakhchblnlt100hhnptadccltkspcctckccbatdctkm1aqltktccspccndrhnbsvtsapdctdodrpldbs