ok now you do all 51 questions i’d like to see you Try
bet
1. Top 3 favorite songs at the moment?the merry go round of life from howls moving castle, the music by lola blanc and devil by clc2. What are you wearing right now?sweatpands and like the biggest hoodie3. Favorite season?falllll4. Left handed or right handed?left handed im that bitch5. Favorite thing you like about yourself?uhm my eyes are nice now and then6. Favorite TV show at the moment?CHILLING ADVENTURES OF SABRINA AAAAAAA7. What are some of your pet peeves?CHEWING WITH AN OPEN MOUTH IF YOU DO THAT WE CANNOT BE FRIENDS8. Favorite and least favorite subjects in school?biology ugh9. Plans for the future?school tbh and hopefully MOVING10. If you could travel anywhere, where would you go?italy probably or scotland11. What celebrity do you look up to?uhm a lot but currently jameela jamil12. Who/what makes you smile regardless?at the moment toby (zestydoesthings) makes me laugh so much all the bloody time also @faeloki because she a cutie13. Favorite song lyrics?aaaa thats so hard to pick omg i cant think of any right now14. Favorite movie?am i the only one who finds it so hard to pick a favorite movie? but frozen 2 watched that quite a bit and uhm idk15. What is the worst thing someone could do to you?just use me for no reason and be a bitch about it (ehem ehem the girl being a bitch trying to make me teach her geo yesterday)16. What pets do you have/want to have?DOGSS AND KITTY CATS AND ALL THE SMOLL BABIES17. Describe your day today?loooonggg18. Night owl or morning bird?im a night owl but my body loves waking up early19. Favorite musical artist?at the moment im a total geek, joe hisaishi20. How old are you?17 bb21. Where are you from?norway/sweden22. What are a few things on your bucket list?why would i have a list on a bucket? seems inconvenient smh23. Do you have/want any tattoos?i want but id be murdered24. Do you have/want any piercings?see 2325. What do you hate most about yourself?my ANXIETY, my CHRONIC PAIN, my ABILITY TO DOUBT MYSELF26. What does your last text message say?to zestydoest things: *a picture of a bench with the caption* is it hard looking at your true form? is it? (try and figure that one out)27. What would you name your future daughter/son?bro im having a puppy i cant take care of myself let alone a CHILD28. What are you listening to right now?antichristchloestar live on twich bb29. What is the last book you read?ELIZA AND HER MONSTERS READ IT, MY FAVE BOOK ITS AMAZING30. Favorite food?PIZZAAA31. Cats or dogs?both cant make me choose32. Introverted or extroverted?extremely introverted extrovert33. When and why did you first join tumblr?like 6?? years ago?? wanted a comunity that i could not find irl34. Celebrity OTP?tbh dont think i have one?? probably do but i cant think of it??35. Tv show OTP?so many message me for the detailed list because its like 20 ships long36. What is your zodiac sign?scorpio37. Lucky number?2, 9 or 1538. Gender?i sadly yet amazingly am a woman39. What’s the last thing you watched on Netflix?the chilling adventures of sabrina40. When is your birthday?november 1st41. Where are you from?norway/sweden42. If you could, what celebrity would you want to meet?tom fricn holland43. Last concert you went to?all time lowww44. What do you think of me/my tumblr account?real hoe but you sweetie pie n i wanna get to know uu45. Favorite holiday?HALLOWEEN46. Favorite animal?all of them they are adorable47. TV you love that’s underrated?DIRK GENTLY'S HOLISTIC DETECTIVE AGENCY IS MY FAVORITE TV SHOW WATCH IT ITS SO GOOD48. What’s your relationship status?single someone date me please49. What do you want to be/do when you grow up?a writerr50. What would you do if you won the lottery?tbh save it and pay off loans etc and just live my life51. ASK ME ANYTHING YOU WANT idk you havent asked that many questions smh
1 note
·
View note
Every question!!
SDFFSDFG DAM OK SIS
LONG POST AHEAD IF U LITERALLY WANNA KNOW ME PERSONALLY JUST READ THIS LMFAO
1: Name: Arche/Jupiter, my close friends know my real name so!
2: Age: High school has just been done so try to guess
3: Fears: Heights, oral presentations, the dark
4: 3 things I love: Drawing, men- concept art n stuff like that
5: 4 turns on: Oh here we go- uhh thighs, messy hair? when they give u The Look or when they. say things i will not talk about here HHGBDF n uhhh Arms 👀👀
6: 4 turns off: weird macho attitude, overly confident bullshit, being selfish and fuckboys in general
7: My best friend: not sure what this means but my bff is named Daphnée n i love her and ive known her my whole life so
8: Sexual orientation: homosexuale
9: My best first date: :))))))) as if
10: How tall am I: sigh. I’m 5″4
11: What do I miss: sometimes i miss the feeling loved ig
12: What time were I born: 12:19
13: Favourite color: pink!
14: Do I have a crush
15: Favourite quote: My senior quote!! “if what doesn’t kill us makes us stronger, I’m telling you I’m immortal”
16: Favourite place: well? my room ig? I like my yard too
17: Favourite food: ugh ramen,,,korean dishes are TASTE as fuck but i also like classic ass spaghetti so like lol
18: Do I use sarcasm: does it look like i dont
19: What am I listening to right now: dr.phil LMFAO
20: First thing I notice in new person: Hair and eyes!! also how they laugh
21: Shoe size: Like. a 7-8 in women’s 6 in men’s
22: Eye color: Hazel/Golden yes bitch let me be special
23: Hair color: it’s either dark brown or golden brown idk
24: Favourite style of clothing: bruv its either kpoppie fuckboy or uwu skirts pastels
25: Ever done a prank call?: no i have anxiety
26: Meaning behind my URL:
27: Favourite movie: rise of the guardians and HTTYD
28: Favourite song: Comeback Home (BTS cover)
29: Favourite band: looks in the camera i dont know nan molla huh
30: How I feel right now: I’m fine im hungry
31: Someone I love: shoutout to my babeys in my server ily
32: My current relationship status: Single(tm)
33: My relationship with my parents: theyre fine ig just a bit tired
34: Favourite holiday:
35: Tattoos and piercing I have: Ear piercings? that’s it
36: Tattoos and piercings I want:
37: The reason I joined Tumblr:
38: Do I and my last ex hate each other? I sure hope not?
39: Do I ever get “good morning” or “good night ” texts? A bit ig?
40: Have I ever kissed the last person you texted? Literally no
41: When did I last hold hands? Like last Friday
42: How long does it take me to get ready in the morning? 20 minutes
43: Have You shaved your legs in the past three days? no i havent shaved in like months
44: Where am I right now? in my room, in quebec, canada
45: If I were drunk & can’t stand, who’s taking care of me? bitch i sure hope my friends would
46: Do I like my music loud or at a reasonable level? fuck my ears
47: Do I live with my Mom and Dad? yeah
48: Am I excited for anything? yeah? yeah
49: Do I have someone of the opposite sex I can tell everything to? ig? always
50: How often do I wear a fake smile? just at work tbh
51: When was the last time I hugged someone? not long ago i cant tell but my friends r cuddle monsters so
52: What if the last person I kissed was kissing someone else right in front of me? i havent kissed anyone so
53: Is there anyone I trust even though I should not? lemme think uhhh no not rlly im not dumb
54: What is something I disliked about today? i woke up n i thought i had school lol
55: If I could meet anyone on this earth, who would it be? oh john cock i want to be ur best friend
56: What do I think about most? i daydream 24/7
57: What’s my strangest talent? uhhh i can put my thumb behind my hand?
58: Do I have any strange phobias? trypophobia, if thats “weird”
59: Do I prefer to be behind the camera or in front of it? depends on what the video is, mostly behind
60: What was the last lie I told? idk answering to my deadname
61: Do I prefer talking on the phone or video chatting online? online
62: Do I believe in ghosts? How about aliens? I slightly believe in ghosts? also aliens GOTTA exist so
63: Do I believe in magic? i think!
64: Do I believe in luck? yeah
65: What’s the weather like right now? very pretty i filmed a video outside!!
66: What was the last book I’ve read? L’Étranger d’Albert Camus in french class
67: Do I like the smell of gasoline? yes my dad’s a mechanic
68: Do I have any nicknames? a lot a lot
69: What was the worst injury I’ve ever had? bitch @ my birth #neverforget
70: Do I spend money or save it? i have 40$ in my name right now
71: Can I touch my nose with a tounge? no
72: Is there anything pink in 10 feet from me? yes highlighter
73: Favourite animal? cats or otters
74: What was I doing last night at 12 AM? FBISDFD NO WE DONT TALK ABOUT IT
75: What do I think is Satan’s last name idk he can have any last name he wants!!!
76: What’s a song that always makes me happy when I hear it? everytime i start hearing “waiting for you anpanman” or “i just wanna go home” 👀👀
77: How can you win my heart? aaahh. be a twink. b fashionable. b funny. cheesy. pls romance me like a npc in the sims 2
78: What would I want to be written on my tombstone? s(he) died smh
79: What is my favorite word? cunt is SUCH a satisfying word
80: My top 5 blogs on tumblr? oh great uh honestly cant be fucked
81: If the whole world were listening to me right now, what would I say? please have brain. PLEASE
82: Do I have any relatives in jail? i sure hope the fuck not?
83: I accidentally eat some radioactive vegetables. They were good, and what’s even cooler is that they endow me with the super-power of my choice! What is that power? either invisibility or mind reading
84: What would be a question I’d be afraid to tell the truth on? ahaaa “what are your intrusive thoughts”
85: What is my current desktop picture? my lesbian sims getting married LMFAO
86: Had sex? no
87: Bought condoms? no
88: Gotten pregnant? NO
89: Failed a class? i think yeah maths last year
90: Kissed a boy? :(((
91: Kissed a girl? no
92: Have I ever kissed somebody in the rain? no
93: Had job? I have a job rn so
94: Left the house without my wallet? yeah when i go to school
95: Bullied someone on the internet? define bullying?
96: Had sex in public? virgin squad
97: Played on a sports team? yeah
98: Smoked weed? no ew
99: Did drugs? no ew
100: Smoked cigarettes? NO EW
101: Drank alcohol? yep
102: Am I a vegetarian/vegan? no i’d die
103: Been overweight? i’m twig
104: Been underweight? i think i was underweight when i was young? i was very Small
105: Been to a wedding? yes very long boring
106: Been on the computer for 5 hours straight? bruh. everyday
107: Watched TV for 5 hours straight? probably?
108: Been outside my home country? ONCE
109: Gotten my heart broken? TWICE !
110: Been to a professional sports game? yesss canadians game!!
111: Broken a bone? no
112: Cut myself? not technically
113: Been to prom? SOON SOON SOON SOSOSNSBFSHDD
114: Been in airplane? once
115: Fly by helicopter? i am not rich bitch
116: What concerts have I been to? noneeee- WAIT NO MARIE MAI
117: Had a crush on someone of the same sex? not sex but for the purpose of pretending i have a penis yes plenty
118: Learned another language? yeah!! i learned english, i almost learned spanish and i’m trynna learn korean now
119: Wore make up? i try!! but i’m not super good
120: Lost my virginity before I was 18? not 18 yet but it’s goin that way
121: Had oral sex? as if
122: Dyed my hair? i wishhh
123: Voted in a presidential election? I WISH THE ELECTIONS R ONE MONTH B4 MY BIRTHDAY
124: Rode in an ambulance? nope
125: Had a surgery? yes at a week old
126: Met someone famous? i think yes but i was super small
127: Stalked someone on a social network? define stalked?
128: Peed outside? yes
129: Been fishing? YES
130: Helped with charity? i think? we do volunteering so
131: Been rejected by a crush? not directly
132: Broken a mirror? no
133: What do I want for birthday? boyf......boy..boyff
134: How many kids do I want and what will be their names? oh man uhh maybe 2-3, i dont know their names yet honestly
135: Was I named after anyone? MY DAD NAMED ME AFTER A FUCKIN CLIENT HE MET. as for my actual name now I named myself after my fav video game character. lit
136: Do I like my handwriting? yeah!!
137: What was my favourite toy as a child? bitch hot wheels
138: Favourite Tv Show? hells kitchen,,,,judge judy,,,anythin like that
139: Where do I want to live when older? honestly i wish i could just live in japan or tokyo, or new york? but i will most likely end up in montreal
140: Play any musical instrument? i used to play the clarinet last year!!
141: One of my scars, how did I get it? the one on my knee, i scratched my desk with my knee
142: Favourite pizza toping? my dad makes AMAZING sea food pizzas,,,
143: Am I afraid of the dark? a lot
144: Am I afraid of heights? A LOT
145: Have I ever got caught sneaking out or doing anything bad? idk prolly? im a bit of a goody two shoes or however u spell it
146: Have I ever tried my hardest and then gotten disappointed in the end: dont we all
147: What I’m really bad at: organizing my anxiety n shit i get overwhelmed
148: What my greatest achievments are: finishing high school
149: The meanest thing somebody has ever said to me: honestly has to be that time someone dug up my vent post about being dysphoric to try to say i hated myself with some dumbass DySphorIa Is SelF HaTRed argument
150: What I’d do if I won in a lottery: pay my parents’ debt off, buy 284223$ of BT21 merch, pay my whole college/uni and transition
151: What do I like about myself: idk i like how i literally do not give a fuck anymore and ive learned to love myself instead of trynna care
152: My closest Tumblr friend: @peptobismol-official @ace-landofthesun @dorkalisious and ana but idk her @ anymore :((( ana pls
153: Something I fantasise about: we dont talk about that
154: Any thoughts on the paranormal?: lit. please stop crawling in my ceiling !
ok now that u know my whole biography. go doxx me ig. bye bye
6 notes
·
View notes
98 that’s a lot of questions I wonder if you could answer them all 🤔🙃
*Deep sigh and putting my hands together* BOI IF YOU DON’T THINK I CAN ANSWER ALL THESE BITCHES!! YOU COME INTO MY ASK BOX AND TELL ME “i WONDER” HOE DON’T WONDER ANYMORE.
don’t come for me like this anon.....here ya go.
smh
i answered all of these and it took forever so yall better read this shit
enjoy bitch
--
1. coffee mugs, teacups, wine glasses, water bottles, or soda cans?
-Mugs
2. chocolate bars or lollipops?
-both im a sugar addict
3. bubblegum or cotton candy?
-bubblegum
4. how did your elementary school teachers describe you?
-prob either really quiet or really loud
5. do you prefer to drink soda from soda cans, soda bottles, plastic cups or glass cups?
-I hate soda
6. pastel, boho, tomboy, preppy, goth, grunge, formal or sportswear?
-I really like pastel and goth styles
7. earbuds or headphones?
-earbuds
8. movies or tv shows?
-Both
9. favorite smell in the summer?
-Vanilla
10. game you were best at in p.e.?
-Flag Football (stealing the flags) and badminton
11. what you have for breakfast on an average day?
-dont really eat in the mornings but prob granola bar or left overs
12. name of your favorite playlist?
-Shower lol
13. lanyard or key ring?
-lanyard
14. favorite non-chocolate candy?
-Sour gummi worms..that shit is CRACK
15. favorite book you read as a school assignment?
-Great Gatsby
16. most comfortable position to sit in?
-apple sauce or on one leg
17. most frequently worn pair of shoes?
-all black converse
18. ideal weather?
-warm and sunny
19. sleeping position?
-stomach, side, in a ball
20. preferred place to write (i.e., in a note book, on your laptop, sketchpad, post-it notes, etc.)?
-Laptop or phone
21. obsession from childhood?
-My little pony, littlest pet shop, Disney, elephants, Chinese food
22. role model?
-Tara Strong, Walt Disney, Francis Dominic
23. strange habits?
-tugging my hair, biting my nails, wiggling on my heels like a penguin and going up stairs on all fours (when im home)
24. favorite crystal?
-answered
25. first song you remember hearing?
-American idiot- Green Day
26. favorite activity to do in warm weather?
-Eat
27. favorite activity to do in cold weather?
-Eat
28. five songs to describe you?
-idk Cartoon theme songs lol
29. best way to bond with you?
-make me laugh or talk about disney
30. places that you find sacred?
-Flower gardens
31. what outfit do you wear to kick ass and take names?
-anything with my high heel boots
32. top five favorite vines?
-Road Work Ahead, Oh my god he on X Game mode, What the Fuck Richard, This house is fucking nightmare!, Happy one year babe! Im 27.
33. most used phrase in your phone?
-YEET, Yall and bitch
34. advertisements you have stuck in your head?
-Stanley Steamer, The First5California.com song
35. average time you fall asleep?
-now its 12 am -1 am... use to be like 10pm
36. what is the first meme you remember ever seeing?
-oh god that was so long ago i dont even know but it was one of the first ones like pepe or some some
37. suitcase or duffel bag?
-suitcase
38. lemonade or tea?
-raspberry ice tea
39. lemon cake or lemon meringue pie?
-dont like lemon in my desserts
40. weirdest thing to ever happen at your school?
-A condom was thrown on my desk in french class (it was unopened thank god)
41. last person you texted?
-my mom
42. jacket pockets or pants pockets?
-Jacket pockets
43. hoodie, leather jacket, cardigan, jean jacket or bomber jacket?
-HOODIE
44. favorite scent for soap?
-Vanilla or tropical
45. which genre: sci-fi, fantasy or superhero?
-Superhero
46. most comfortable outfit to sleep in?
-Big shirt and no shorts (underwear obvi)
47. favorite type of cheese?
-I fucking hate cheese
48. if you were a fruit, what kind would you be?
-Strawberry or Lemon
49. what saying or quote do you live by?
-Its always fun to do the impossible- Walt Disney
50. what made you laugh the hardest you ever have?
-For my birthday my friend got my a “Sorry for your loss” card and i cried for 30 mins
51. current stresses?
-um everything..college and being the only snacc in my household
52. favorite font?
-comic sans
53. what is the current state of your hands?
-Still have both of them
54. what did you learn from your first job?
-That people are assholes
55. favorite fairy tale?
-Disneys Rapunzel
56. favorite tradition?
- My grandma got all the grandkids pjs on Christmas eve every year and we would wear them to sleep
57. the three biggest struggles you’ve overcome?
-Anxiety, Depression (sorta), Dropping my churro on the ground at Disneyland
58. four talents you’re proud of having?
-Quick Wit, Art abilities?, Standing on my head and making weird ass noises
59. if you were a video game character, what would your catchphrase be?
-Already answered
60. if you were a character in an anime, what kind of anime would you want it to be?
-A really cool and cute magical one!!
61. favorite line you heard from a book/movie/tv show/etc.?
-From Once Upon A Time, honestly they ave the best quotes. “So when I win your heart, Emma- and i will win it-it will not be because of any trickery, but because you want me”- Killian orrrrrrr He smells like forest”- Regina
62. seven characters you relate to?
-Juvia (FairyTail), Star (SVTFOE), Mabel (Gravity Falls), Maybec (Kingdom Keepers, sassy and artistic), Bubbles and Blossom (PPG) and Belle (beauty and the beast)
63. five songs that would play in your club?
-Boyfriend: BTR, Dancings not a crime: Panic!, Bang bang: Jessie, Ari and Nicki, Read you, wrote you: Drag race lol and Busted from Phineas and Ferb because I can
64. favorite website from your childhood?
-Webkinz, PetPetPark (STILL SALTY ABOUT IT) Club Penguin, Build a bear, Poptropica, i played every game yall
65. any permanent scars?
-only emotionally
66. favorite flower(s)?
-Roses and water lilies..and every flower cause they pretty.. oh Dahlias too
67. good luck charms?
-petting my dogs.
68. worst flavor of any food or drink you’ve ever tried?
-Mango anything or Cherry. I hate cherry flavoring.
69. a fun fact that you don’t know how you learned?
-I have a great memory so i usually remember how i learned it, but.. Did you know that the water on the Jungle Cruise in Disneyland is 3 feet deep and dyed brown? Plus the water in all the parks is a special mix that doesn't contain chlorine because alot of people are allergic so its safe to touch? (learn from a disney doc)
70. left or right handed?
-right
71. least favorite pattern?
-those ugly ones on leggings.
72. worst subject?
-Math or english (haha and i like to write)
73. favorite weird flavor combo?
-Grapes and teriyaki sauce. if they on the plate. ill just dip them in. I have an addiction to teriyaki sauce.
74. at what pain level out of ten (1 through 10) do you have to be at before you take an advil or ibuprofen?
-I dont take any unless I have my period and my cramps are usually at a 10 so i try and take it when they at a 5
75. when did you lose your first tooth?
-when i was young
76. what’s your favorite potato food (i.e. tater tots, baked potatoes, fries, chips, etc.)?
-I LOVE potatos: Fries and mash are best plus baked. I HATE chips thou
77. best plant to grow on a windowsill?
-Any bright flower or ivy
78. coffee from a gas station or sushi from a grocery store?
-coffee, dont like sushi
79. which looks better, your school id photo or your driver’s license photo?
-AHHHH my license is soooooo bad. I had strips of red in my hair (got it when i was 15-16) and i didnt know they took your pic at your permit test. Its awful. School is def better and my senior photo pops.
80. earth tones or jewel tones?
-Jewel
81. fireflies or lightning bugs?
-Fireflys (arent they the same?)
82. pc or console?
-Console
83. writing or drawing?
-Both but im better at writing
84. podcasts or talk radio?
-Podcasts but I dont listen to alot.
84. barbie or polly pocket?
-I played more with Littlest Pet Shop and My Little Pony lol (i have 400) prob Barbie thou
85. fairy tales or mythology?
-oooooooofffff cant decide
86. cookies or cupcakes?
-oooooff i love both but cupcakes
87. your greatest fear?
-wasting my life away.....or heights...certain bugs
88. your greatest wish?
-to be happy and have all my dreams (life, job, romance,etc) happen. Plus going to every Disney Park in the world.
89. who would you put before everyone else?
-Depends on the situation but sometimes you need to take care of yourself before others. If you arent doing good, how the hell you suppose to take care of others.
90. luckiest mistake?
-hmmm idk being born
91. boxes or bags?
-depends on what im carrying but prob bags
92. lamps, overhead lights, sunlight or fairy lights?
-I love fairy lights
93. nicknames?
-any mispronunciation of my name, Dean, Big D (yes people call me this), Star, Sassafras and some more that yall dont get to know :) You can give me a nickname if ya want
94. favorite season?
-Spring and Summer
95. favorite app on your phone?
-Tumblr, Snapchat, Tsum Tsum
96. desktop background?
- Its items from super mario and mario kart
97. how many phone numbers do you have memorized?
- Eight
98. favorite historical era?
-oof im a history buff but I do love Greek and Roman because I love mythology...Maybe even 1800s.
hi if you got to the end of this then I love you and for proof leave me a 🐰
6 notes
·
View notes
all the gay asks cause youre the gayest
Theyre definitely not wrong ayyy1. describe your idea of a perfect dateMan idk, somewhere with not too many people, where i can be silent for a bit without being awkward, IF THERES FOOD ITS GOOD2. whats your “type”Uhhhh, not sure I guess??? I like what it comes since it's a miracle someone even likes me lol but uh, I do seem to know I like slanted/droppy eyes, either makes me go aaaa3. do you want kids?Not biologically but yeah, sure why not4. if you do, will you adopt or use some other form of child birth?Adoption is all i want, my dude5. describe the cutest date you’ve ever been onOnce i was feeling like shit and the one who was my boy friend brought me a pizza and Nacho cheese and thats unbeatable6. describe your experience having sex for the first time (were you nervous? or was it easy peasy?)My first with a girl was trashy and drunk and tbh i didnt even feel anything, my first with a boy ohjhhh i was really NERVOUS and we didnt even do it all the way bc man it hurts like hell??? Idk, sex isnt for me in many ways7. are you a morning time gay or night time gay?Depends!! But mostly a night time gay, im basically alone with my thoughts8. opinion on nap dates?Theyre uncomfortable for me?? I dont want no one to see me sleep smh that's creepy9. opinion on brown eyes?GORGEOUS10. dog gay or cat gay?Both ( chihuahua/small dogs gay specifically )11. would you ever date someone who owned rodents or reptiles?Sure i guess?? They gotta take care of em tho, if not bye bye12. whats a turn off you look for before you start officially dating someoneI want them to respect my identity, that's all, it really hurts when even LGBT folks dont take me as a man13. what is a misconception you had about lgb people before you realized you were one?I actually didnt put much thought, I thought was bisex before knowing how wide gender range is but that's as far as it comes14. what is a piece of advice you would give to your younger selfDo not trust easy but don't shut down as you've been doing all these years, people like you and miss you, you seem to not see it because your self-worth is always at doubt, you don't like to be alone and you're able to make friends so easy, put it on your advantage15. (if attracted to more than one gender) do you have different “types” for different genders?I actually do?? But at the same time i dont, I just like what i like fam16. who is an ex you regret?👀 i prefer not to tell17. night club gay or cafe gay?Cafeeeee gay18. who is one person you would “go straight” forHMm Zarya from overwatch lmfao19. video game gay, book gay, or movie gay?Video game gay20. favourite gay ship (canon or not)Rn it's Gregg and bear dude from nitw21. favourite gay youtuberI dont know any??? Aaaa22. have you ever unknowingly asked out a straight person?Nah23. have you ever been in love?Surprisingly, I don't know, I've had a hard time trying to diferentiate between my fear of abandonment and love24. have you ever been heartbroken?Surp25. how do you determine if you want to be them or be with someoneI don't really know, most of my relationships have been a thrown in the dark shot26. favourite lgb musician/bandOkay but I love Matty from the 1975, i know theres a lot more but bleh27. what is a piece of advice you have for young / baby gaysDONT GIVE A FUCK, KISS GIRLS, KISS BOYS, DONT BE AN ASS TO TRANS FOLKS, DONT DISMISS THEM EITHER OR I'LL PERSONALLY COME PUNCH YOUR GUT28. are you out? if so how did you come outWith my friends and the list keeps growing, I'm learning to be myself and to accept myself29. what is the most uncomfortable / strange coming out experience you have ITS ACTUALLY WITH MYSELF LMFAO, i gave myself the worst time thinking i might be different from the rest of my friends and classmates, to be different of what my mom wanted too30. what is a piece of advice for people who may not be in a safe place to express their sexualityThis isnt the best advice but coming from somewhere LGBT is completely stereotyped and constantly in danger, keep it to your closest ones, you might not feel safe with others but as long as you're yourself with the ones who you trust and love, that should be enough for a while, someday you'll be able to be you for who you are with who ever because hey, they don't define you
2 notes
·
View notes
5/12/19 Notes
Lab Meeting Prep Pipeline:
(May 2nd, 2019 at 2:38 p.m.)
[ ] Read the Results & Discussion cover to cover
[ ] Complete slides for all figures
[ ] Give a practice presentation
[ ] Read methods
[ ] Complete fluorescence slides
[ ] Decide how to deal with ‘relationship between calcium activity and movement’ section
[ ] Give a practice presentation
[ ] Read supplementary material cover to cover
[ ] Give a practice presentation
Note to self: Relax. Be meticulous. Be disciplined. Keep calm, do your best, trust your team.
——
——
Advanced Optimization
8 20 905
Live Action Poem, February 2nd, 6:41
Went to Brazil out of spite and saw
stone Jesus, arms open for a hug,
bought street weed, twice, from the same vendor
out of a reckless love for reckless love.
Hoped for a tropical muse and found
a strong handshake from a dangerous man.
Holed up in Rio de Janeiro with piles
of paper money and paced all alone
angry at nothing if only for the moment.
Rain dampened slick stone walkaways,
waiters were too nice and I tipped too much.
One offered to be a bodyguard , violence
hinted in every smirking human moment.
God, I loved being a target, smug,
dumb, flitting away American Dollars.
Jesus Christ looming in stone on a hill top.
Titties and marijuana, iconic primadonna
extravagant flora, dying fauna, fawning
over the climate. I went to Brazil
on an off month. To hole up
safe from my sprawling little lovely life.
To Do 26.1.19
[x] Cristina - Search for Hippocampus Models
[x] Ana G. - Draft e-mail call for interest in “Live Action Science”
[ ]
Data science Club Thursday at 5:00 p.m.
Astavakrasana
laser-scanning photostimulation (LSPS) by UV glutamate uncaging.
12.1.19 Goals
[x] Some Portuguese
[x] Mouse Academy - first read
[ / ] Dynamic mesolithic dopamine
[x] Water rats * SMH
Acorn - tracks impact | BetaWorks | 2 years of money | PitchBook | Social Impact Start Up
Mission Aligned Investors | Metrics | Costumer Acquistion Cost | Clint Corver -> Chain of Contacts -> Who To Talk to (Scope: ~100)
Money Committed || Sparrow || Decision Analysis —> Ulu Ventures [500k] [Budget x ]
Ivan - > IoS Engineering { Bulgarian DevShop }
[market mapping] Metrics -> Shrug
Peter Singer - Academic Advisory Board …
[1 million ]
Product market testing
Foundation Directory Online - Targeted , Do Your Homework
https://www.simonsfoundation.org/2018/11/19/why-neuroscience-needs-data-scientists/
Head-fixed —>
~INHIBITION EXPERIMENT TRAINING PLAN~
STOP MICE: 20th. GIVE WATER: 20th (afternoon) - 30th. DEPRIVE: 31st... (Morning) RESUME: Jan 2nd.
21st - BLEACH/DEEP CLEAN BOXES 1-14 (Diluted bleach; Flush (with needles out) - Open Arduino Sketch with Continuously open Valves - PERFUSE System) *[NOT BOX 11 or 5]*; Run 15 mL of Bleach per syringe; Copious water through valves; Leave dry.
———
http://www.jneurosci.org/content/preparing-manuscript#journalclub
Friday - Dec. 14th, 2018
[x] - Complete 2019 ‘Goals and Blueprint’
[x] - 2-minute Summary ‘Properties of Neuron in External Globus Pallidus Can Support Optimal Action Selection
[ ] MatLab for Neuroscientists :: Basic Bayesian Bearded Terrorist probability plots
[x] Statistics 101: Linear Regression
“Golden Girls” - Devendra Banhart
“King” by Moor - FIREBEAT
Reread - Section 3.3 to
Monday - Apply for DGAV License (MAKE SHORT CV)
SAMPLE: ‘Sal’ From Khan Academy
Make short CV
Tiago - Certificate
MATH:
“We explicitly focus on a gentle introduction here, as it serves our purposes. If you are in
need of a more rigorous or comprehensive treatment, we refer you to Mathematics for Neuroscientists by Gabbiani and Cox. If you want to see what math education could be like, centered on great explanations that build intuition, we recommend Math, Better Explained by Kalid Azad.”
Jacksonian March seizure (somatosensory)
—
Tara LeGates > D1/D2 Synapses
Scott Thompson
Fabrizio Gabbiani - Biophysics - Sophisticated and reasonable approach
Quote For Neuroscience Paper:
“Every moment happens twice: inside and outside, and they are two different histories.”
— Zadie Smith, White Teeth
Model Animal: Dragonfly? Cats. Alligators.
Ali Farke Toure
Entre as 9 hora e o meio-dia ele trabalha no computador.
Ele volta para o trabalha à uma e meia.
Ele vai as compras depois do trabalho.
A noite, depois do jantar, ele e a mulher veem televisão.
As oito vou de bicicleta para o trabalho. (go)
As oito venho de bicicleta para o trabalho. (come)
A que horas começa a trabalhar?
Eu começo a trabalhar os oito e meia.
Normalmente…
Eu caminho cerca de Lisbon.
É muito triste! Eu faço nada! Talvez, eu caminho cerca de Lisbon. Talvez eu leio um livro. Talvez eu dormi. Eu vai Lx Factory.
Depois de/do (after)
antes de/do (before)
—
Monday -> Mice
MATLAB!
-
“New ways of thinking about familiar problems.”
~*NOVEMBER GOALS*~
> Permanent MatLab Access [x] -> Tiago has license
> Order Mouse Lines [ ] -> Health report requested… Reach out to Vivarium about FoxP2
-> Mash1 line -> FoxP2 expression?
> Finish ‘First Read Through’ [ ]
> Figure 40 [ ]
SAMPLE : ‘Afraid of Us’ Jonwayne, Zeroh
Monday Nov 5th Goals:
> Attentively watch:
> https://www.youtube.com/watch?v=ba_l8IKoMvU (Distributed RL)
> https://www.youtube.com/watch?v=bsuvM1jO-4w (Distributed RL | The Algorithm)
MatLab License
Practical Sessions at the CCU for the Unknown between 19 - 22 Nov 2018 (provisional programme attached)
Week of November 5th - Handle Bruno’s Animals
Lab Goals -
“Deep Networks - Influence Politics Around the World”
Paton Lab Meeting Archives
Strategy: Read titles/abstracts follow gut on interesting and relevant papers
Goals: Get a general sense of the intellectual history of the lab, thought/project trajectories, researchers and work done in the field and neighboring fields.
Look through a GPe/Arkypallidal lens… what can be revisited with new understanding?
First Read Through
[x] 2011 - (22 meetings || 10/12 - SLAM camera tracking techniques)
[ x] 2012a (18 meetings)
[x] 2012b (15 meetings - sloppy summary sentences)
[ x] 2013a (19 meetings - less sloppy summaries jotted down)
[x] 2013b (17 meetings)
[x] 2014a (21 meetings) (summaries in progress)
[x] 2014b
[x] 2015 (23 meetings)
[ ] 2016 (23 meetings)
Current
—
“I like, I wish, I wonder”
“Only Yesterday” Pretty Lights
retrosplenial dysgranular cx (?)
retrosplenial granular cx, c (?)
fornix (?)
Stringer 2018 arVix
Lowe and Glimpsher
November Goals:
[ ] GPe literature -
[ x ] Dodson & Magill
[ x] Mastro & Gittis
[ ] Chu & Bevan
[x] Modeling (extra credit -Bogacz)
[ ] Principles of Neural Science: Part IV
[ x ] MatLab license… Website program…
Extra credit:
Side projects
[/ ] Neuroanatomy 40
[ -> ] ExperiMentor - Riberio, Mainen scripts… Paton! -> LiveAction Science
MACHINE LEARNING
Week of Oct 29th -
Symposium Week!
Wyatt -> John Hopkins -> He got into American University!
Belly Full Beat (MadLib album Drive In)
“The human brain produces in 30 seconds as much data as the Hubble Space Telescope has produced in its lifetime.”
Sequence of voltage sensors -> ArcLite -> Quasar -> Asap -> Voltron -> ???
Muscarine -> Glutamate
Ph Sensitive
cAMP
Zinc sensitive
5 ways to calculate delta f
2 main ways
SNR Voltage —
Dimensionality reduction of a data set: When is it spiking?
5 to 10 2-photon microscope open crystal
…Open window to a million neuron…
Week of 10/15/18
Monday: Travel
Tuesday: Rest
Wednesday: Begin rat training. Reorient.
Thursday:
Friday:
|| Software synergistically ||
—————
Beam splitter, Lambda, diacritic
1.6021766208×10−19
‘sparse coding’
Benny Boy get your programming shit together.
Week of Oct. 8th, 2018
10/9/18
[ ] Rat shadowing (9:30 a.m.) -> Pushed to next week
10/8/18
[x] Begin Chapter 13 of Kandel, Schwartz, Jessell
[x] Outline of figure 36
[ ] Read Abdi & Mallet (2015)
DOPE BEAT MATERIAL - Etude 1 (Nico Muhly, Nadia Sirota)
Saturday - Chill [x]
Friday - ExperiMentor … mehhhhh scripts?
Photometry -> Photodiode collects light in form of voltage (GCaMP) (TtdTomate as Baseline… how much fluorescence is based on TdTomatoe, controlling factor always luminesce - GCaMP calcium dependent) :: Collecting from a ‘cone’ or geometric region in the brain. Data stored and plotted over time… Signals must be corrected…
Cell populations are firing or releasing calcium. (GCaMP encoded by virus injection, mice express CRE in a particular cell type).
———————————————
———————————————
Brain on an Occam’s Razor,
bird on a wire,
synaptic fatalism integrating
consistent spiking;
strange looping: is this me?
Thursday
“We don’t make decisions, so much as our decisions make us.”
“Blind flies don’t like to fly”
[x] 9:00 a.m. Lab Meeting
[x] 12:00 p.m. - Colloquium
“It was demeaning, to borrow a line from the poet A. R. Ammons, to allow one’s Weltanschauung to be noticeably wobbled.”
“You must not fear, hold back, count or be a miser with your thoughts and feelings. It is also true that creation comes from an overflow, so you have to learn to intake, to imbibe, to nourish yourself and not be afraid of fullness. The fullness is like a tidal wave which then carries you, sweeps you into experience and into writing. Permit yourself to flow and overflow, allow for the rise in temperature, all the expansions and intensifications. Something is always born of excess: great art was born of great terrors, great loneliness, great inhibitions, instabilities, and it always balances them. If it seems to you that I move in a world of certitudes, you, par contre, must benefit from the great privilege of youth, which is that you move in a world of mysteries. But both must be ruled by faith.”
Anaïs Nin
[ ] MatLab trial expires in 1 day *
[ ] 3:00 p.m. pictures
“We do not yet know whether Arkys relay Stop decisions from elsewhere, or are actively involved in forming those decisions. This is in part because the input pathways to Arkys remain to be determined.”
These studies prompt an interesting reflection about the benefits and conflicts of labeling and classifying neurons at a relatively grainy level of understanding.
“The authors hypothesize that under normal conditions, hLTP serves an adaptive, homeostatic role to maintain a healthy balance between the hyperdirect and indirect pathway in the STN. However, after dopamine depletion, pathologically elevated cortical input to the STN triggers excessive induction of hLTP at GPe synapses, which becomes maladaptive to circuit function and contributes to or even exacerbates pathological oscillations.”
To Do Week of Oct. 1st - Focus: Big Picture Goals
[ x ] GPe Literature - Hernandez 2015 & Mallet 2016 (Focus on techniques and details)
[ ] MatLab! Lectures 6-7 (Get your hands dirty!)
[ x ] Kandel Chapters 12 - 13
Tuesday Surgery Induction 10:00 with Andreia
6:00 - 7:30
Portuguese
Digitally reconstructed Neurons: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5106405/
To Do Week of, September 24th, 2018
To Do Week of Monday, September 17th, 2018
PRIORITY:
DATA ANALYSIS PROJECT ITI
———— PAUSE. ———————
Talks
[x ] Mainen Lab - Evidence or Value based encoding of World State/Probability - ‘Consecutive failures’ - easy/medium/hard estimate of where the reward will be.
Reading for the Week
[x] Chapter 9 - Propagating Signal | The Action Potential
[/ ] Ligaya et. al (2018) (CCU S.I.?)
[x] Katz & Castillo (1952) Experiment where they describe measurement techniques
[ ] Raiser Chapter 4 - Stimulus Outlasting Calcium Dynamics in Drosophila Kenyon Cells Encode Odor Identity
Video Lectures
[— ] Linear Algebra (Trudge steadily through)
[ — ] Khan Academy Logarithms (Trudge steadily through)
MatLab
[ ] Trudge steadily through www.mathworks.com/help/matlab/learn_matlab
*FIND PROBLEM SET/TEXT BOOK/WORK SHEETS*
Concepts to Grasp
[ / ] Master logarithms!
[ ] Review Kandel Et. Al Part II *Chapters 5-9*
Neuroanatomy
[ x ] Ink Figure 28
Project Planning? Too soon! Too soon! Read some literature on the subject.
17/9/18
1:00 p.m. Meet with Catarina to discuss “CCU Science Illustrated” (WIP) Project
2:30 p.m. Vivarium Induction
_______________________________________________________
| SPCAL Credentials |
| |
| login: |
| PW: |
-————————————————————————
——
NPR:: https://www.npr.org/sections/health-shots/2018/09/11/644992109/can-a-barn-owl-s-brain-explain-why-kids-with-adhd-can-t-stay-focused
9.13.18
[ x ] Pauses in cholinergic interneuron firing exert an inhibitory control on stratal output in vivo (Zucca et. al 2018)
[ x ] Chapter 8 - Local Signaling: Passive Properties of
-> Sub and supra threshold membrane potential (Conceptual)
Monday, Sept. 10th 2018
“Eat the Frog First”
[ N/A ] Review SPCAL Lessons 1-5 (In Library?) CRAM THURSDAY?
-> [/] wait for confirmation from Delores for theoretical test
-> (Out of Office reply from person in charge)
To Do:
[/] Comment Out %PRE_PROCESS_vBeta.m
[x] Change path name and run program in MatLab
[ ] Solve trial.blahblahblah error spkCount? labels?
[ ] Change Epochs and run?
[x] Chapter 7 - Membrane Potential :: Return to Pg. 136-137 Box 7-2 when sharp. ::
[x] Castillo and B. Katz (1954)
[x] 12:00 - Neural Circuits for Vision in Action CCU
[x] 2:30 - THESIS DEFENSE: Mechanisms of Visual Perceptions in the Mouse Visual Cortex
————
Extra-credit
[x] Ink Figure 24
[~ ] Finish “First & Last 2017” (100/127 = 78.74%)
——
Jax Laboratory Tools: https://www.jax.org/jax-mice-and-services/model-generation-services/crispr-cas9
Recommendation for Design and Analysis of In Vivo Electrophysiology Studies
http://www.jneurosci.org/content/38/26/5837
On the Horizon:
Schultz (1997) (Classic, classic, classic)
*[x] 9/7/18 - 6:00 p.m. Flip water for Bruno’s mice *
ITI Data Analysis -> Next step ->….
[ ] (find the sigmoid call) / Poke around preprocessing_beta
Reading
[x] Chapter 6 - Ion Channels
[ / ] Finish Krietzer 2016 —> [ ] write an experiment-by-experiment summary paper
Resource: https://www.youtube.com/watch?v=GPsCVKhNvlA Helpful explanation of ChR2-YFP, NpHR, and general ontogenetic principles.
[ / ] Reiser Chapter 3.3.38 - 3.4 (Need to finish 3.4.5, Look up Photoionization detectors, Coherence)
Neuroanatomy
[/] Finish Figure 24 (need to ink)
“Drawing Scientists “
[/] Storyboard for GCAMP6s targeted paper
-> Show Filipe for feedback ->
-> Ask Leopold permission ? Talk to Catarina
[ x] 16:9
[x] Write script and record [ 1:00 ]
Intellectual Roaming
[ / ] Return to Review of Reviews and Review Zoom-In | First & Last |
[/] Explore Digital Mouse Brain Atlas
9/6/18 - Thursday
To Do:
ITI Data Analysis :
[x] Draw data structure on mm paper -> Reach out for help understanding
[ / ] What fields did Asma call? What fields are necessary for a psychometric curve
Reading
[x] Kandel - Chapter 5 | Synthesis and Trafficking of Neuronal Proteins
[ / ] Reiser - Chapter 3 | A High-Bandwidth Dual-Channel Olfactory Stimulator for Studying Temporal Sensitivity of Olfactory Processing (Results complicated)
[/ ] Krietzer 2016 - Cell-Type-Specific Controls of Brainstem Locomotor Circuits by Basal Ganglia
Talks:
[x] 12:00 p.m. - Colloquium - Development of Drosophila Motor Circuit
Tutorials:
~ [x ] MatLab plotting psychometric curves
Neuroanatomy
[ x ] Outline brain for figure 24
———
MatLab
Laser stuff HZ noise, thresholds,
// PCA -> Co-variance ->
// Linear regression | Geometric intuition -> “What is known to the animal during inter-trial? What features can be described by animals history” ===> Construct a history space (axis represent different animals history ex. x-axis previous stimulus, reward, etc.?) Predictive (?)
Plot psychometric functions || PSTH (post stimulation of histogram ) of example neurons -> skills: bin spiking, plot rasters, smoothing (if necessary)
Data:: Access to Dropbox -> /data/TAFC/Combined02/ [3 animals :: Elife]
/data/TAFC/video
Tiago and Flipe know the video data
File Format -> Parser/Transformation (guideline) ||
> MatLab
Access to MatLab -> [/] 28 days!
How can I begin to analysis?
History dependent | Omitted
——
To Do Week of September 3rd
Monday
Administrative
[ x] Check-in with HR (Don’t bombard!): Badge. (Library access?)
[ ] Reach out to SEF?
[x] 2:00 p.m. Meet with Asma - discuss data analysis. Where is it? How do I access it (Tiago?) What has been done and why?
[x] 3:00 p.m. Lab Meeting “Maurico’s Data” - Pay special attention
[x] Finish first read through of Theoretical Laboratory Animal Science PDF Lectures
[ ] Rat Surgery Techniques…
Mouse neuroanatomy project
[/ ] Figure 24
[ ] Figure 28
Math
[x ] L.A. Lecture 2
[ x] L.A. Lecture 3
Read:
[ ] Georg Raiser’s Thesis (Page 22 of 213)
Find time to do at least an hour of quiet focused reading a day. (Place?).
Continue to explore whims, papers, databases, ideas, protocols, that seem interesting.
Develop ‘literature scour’ protocol - (Nature Neuroscience, Neuron, Journal of Neuroscience)
Dates to Remember:
September 14th - Laboratory Animal Sciences Theoretical Test!
https://www.sciencedaily.com/releases/2018/08/180827180803.htm:Can these be used for techniques?
https://www.sciencedaily.com/releases/2018/08/180823141038.htm ‘Unexpected’ - Unexpected physical event and unexpected reward or lack of reward (neuronal modeling of external environment)
—
In my first ten minutes at work I’m exposed to a weeks (month/year/decade) worth of interesting information. Going from an intellectual tundra to an intellectual rain forest.
1460 proteins with increased expression in the brain: Human Protein Atlas https://www.proteinatlas.org
Non-profit plasmid repository: https://www.addgene.org
Protein database: https://www.rcsb.org/3d-view/3WLC/1
Started to think at the molecular level.
“MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIR
HNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSK
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDF
FKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSL
FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNG
YISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK” - CCaMP6m amino acid code.
8/31/18 - (Friday) @12:00 in Meeting Room 25.08
GET USB ! !
[Lisboa Cultura na ru, Lisbon on the streets Com’Out Lisbon - Katie Gurrerirra ]
MatLab -> Chronux Neural Analysis
SEPTEMBER 14th!
Week of August 27th, 2018
“Conserved computational circuitry, perhaps taking different arguments on different locations of Basil Ganglia” - Tuesday
Andrew Barto: http://www-all.cs.umass.edu/~barto/
Basil Ganglia Labs
Okihide Hikosaka Lab: https://irp.nih.gov/pi/okihide-hikosaka
Wilbrecht Lab
Uchida N. (ubiquitous dopamine motivation and reward)
Peter J. Magill
Schultz (Pioneer in the field)
C. Savio Chan
Doya, K. (theory)
Calabresi, P. (muscarinic)
Ana Graybiel (McGovern)
James C. Houk (1994 - Book on Models of Computation in the basal Ganglia)
Evolutionary Conservation of Basil Ganglia type action-selection mechanisms:
https://www.sciencedirect.com/science/article/pii/S0960982211005288
Dopamine D1 - Retinal Signaling https://www.physiology.org/doi/full/10.1152/jn.00855.2017 [Note to self: Too Off Track]
[ ~ ] Flurorphore Library
Official Badge? [ ] Printer Access [ ]?
—
Online Course on Laboratory Animal Science
Monday : 11 [x] 12 [x]
Tuesday : 13 [x] 14 [x]
Wednesday: 15 [x] 16 [/]
Thursday: 17 [x] 18 [x]
Friday: 19 [x] 20 [/]
Lesson 11 - Behavior and Environment, animals must be housed in an environment enriched to maximize their welfare.
Lesson 12 - Rodent and Lagomorph Accommodation and Housing - A more comprehensive guide from the macro environment, facilities i.e. establishments, to the micro environments. Covers health and safety procedures for personnel as well as geometry of housing units (rounded edges to prevent water accumulation). Absolutely essential.
Lesson 13 - Collecting Samples and Administrating Procedures - covers the most common collection techniques and materials collected and stressed the importance of doing as little harm as possible to the animal.
Lesson 14 - Transporting the Animal : Shipper holds most of the responsibility. Major goals are making sure the journey is as stress free as possible, contingency plans are in place, and that all of the logistics have been carefully planned, communicated, and coordinated between various parties responsible in the shipping. Also, animals should be prepared mentally and physically for the journey and should have a period of post-transportation to adjust to the new surroundings and environment. A number of practical issues must be considered such as temperature, availability of food, and access to animals during the journey. Boxes should be properly labelled in whatever languages are necessary.
Lesson 15 - The purpose of feeding and nutrition is to meet the energy needs of the animals, which vary by species, physiological state of animal (growth, maintenance, gestation, and lactation). A number of category of diets exist as well as a variety of specific diets to best fits the needs of the experiment. This chapter covers particulars of nutrition requirements and stresses the importance of avoiding obesity and malnutrition.
Lesson 16 - Anatomy and Physiology of Teleosts (Skip for now: Focus on Rodents and Lagomorphs)
Lesson 17 - Anatomy and Physiology of Rodents and Lagomorphs - General characteristics of the anatomy and physiology of six species, 5 rodents and 1 lagomorph. Mice, rats, guinea pigs, gerbils, and hamsters. Rabbits. It covers particularities of each species and has a quiz asking specific facts, mostly centered on commonalities and distinguishing factors. Worth a close read.
Lesson 18 - Anaesthesia and Analgesia in Rodents and Lagomorphs . Pre anaesthesia techniques, drug combinations, and repeated warning of the importance of choosing the right drugs and technique for the species. Use of a chamber. Methods of anesthesia (IP, IV, Volatile). Endotracheal Intubation for rabbits; the proper use and administration of analgesics; monitoring during the operation (for example - the paw pain reflex disappears in medium to deep anesthesia
Lesson 19 - Animal Welfare and Signs of Disturbance - This chapter repeatedly stresses the importance of the relationship between the caretaker and the animal. It repeats the ideal social, environmental, and nutritional environments for rodents and rabbits and highlights peculiarities of each species. After reading this one should be better suited to detecting stress, disease, or other ailments in a laboratory animal.
Lesson 20 - Fish Psychology and Welfare (Skip for now: Focus on Rodents and Lagomorphs)
Lessons 5, 17, and 20 pertain to fish
TEST SEPTEMBER 14th
—
MIT Open Course Ware:
Linear Algebra
Lecture 2 [/ ] -> Elimination by Matrices, production of elementary matrices, basic computations, and a review of row and column approaches to systems of equations. Introduction to the basic application of the rule of association in linear algebra.
Lecture 3 [ ]
Mouse Neuroanatomy
Ink Figure 16 [x]
Figure 20 [x]
Figure 24 [ ]
Introduction to MatLab: https://www.youtube.com/watch?v=T_ekAD7U-wU [ ]
Math Big Picture: Review Single Variable Calculus! Find reasonable Statistics and Probability Course (Statistical Thinking and Data Analysis? Introduction to Probability and Statistics?) Mine as well review algebra well I’m at it eh.
Breathe in. Breathe out.
—
Data analysis :: Behavioral Analysis
—
Ana Margarida - Lecture 6 - Handling Mice techniques
EuroCircuit can make a piece. Commercial v. DYI version of products.
Dario is the soldering, hardware expert. I.E. skilled technician.
www.dgv.min-agricultura.pt; it is recommended that the entry on Animal Protection and the section on Animals used for experimental purposes be consulted first.
—
Sir Ronald Fisher, stated in 1938 in regards to this matter that “To consult the statistician after an experiment is finished is often merely to ask him to conduct a post mortem examination. He can perhaps say what the experiment died of”.
——
Finally, it is time to publish and reveal the results. According to Santiago Ramón y Cajal, scientific writers should govern themselves by the following rules:
Make sure you have something to say;
Find a suitable title and sequence to present your ideas; Say it;
Stop once it is said.
8/21 Goals
Access ->
:: Champalimaud Private Internet [HR] Printer [HR]
:: Web of Science (?)
:: PubMed (Nature, Journals, etc.?)
::
———
PRIORITY: Online Course -> Animal Laboratory Sciences PDF’s
20 total -> 4 a day || I can finish by Friday
Monday : 1 [x] 2 [x]
Tuesday : 3 [x] 4 [x ]
Wednesday: 5 [x*] 6 [x]
Thursday: 7 [x* ] 8 [x]es
Friday: 9 [x ] 10 [x ]
Notes:
Lesson 1 - Philosophical and ethical background and the 3 R’s
Lesson 2 - Euthanasia. Recommended, adequate, unacceptable. Physical or chemical. Chemical - inhalable or injectable. Paton Lab uses CO2 and cervical dislocation.
Lecture 3 - Experimental Design. Return to as a starting point for basic design (randomized samples and blocks) Integrate with “Statistical Thinking and Data Analysis”
Lecture 4 - Legislation. Memorize specific laws and acts.
Lecture 5 is highly specific for the care and maintenance of Zebrafish
Lecture 6 - Handling of rodents and mice. A theoretical overview, this material is essentially kinesthetic.
Lecture 7 - Provides a technically detailed account of how genetic manipulations are done and propagated. Deserves a ‘printed’ review and vocabulary cross reference.
Lecture 8 - Health and Safety. Predominantly common sense.
Lecture 9 - Microbiology - contains an appendix with list of common infections that will be eventually be good to know.
Lesson 10 - Anaesthesia pre and post operation techniques, risks of infections etc.
// http://ec.europa.eu/environment/chemicals/lab_animals/member_states_stats_reports_en.htm
http://ec.europa.eu/environment/chemicals/lab_animals/news_en.htm -> General European News regarding
http://www.ahwla.org.uk/site/tutorials/RP/RP01-Title.html -> Recognizing pain in animals
Week of 8/20/18 To Do:
Tiago/Team -> Whats the most important priority?
Get Arduino Machine working again [?]
Jupiter/Python Notebook Up [ ]
Bruno MatLab Access [… ]
- Get documents to HR
- Animal Lab certified?
- Logistical/Certificate/Etc.
- Start discussing personal project:
> (Rat colony) Wet Lab
> (Machine Learning) Electric Lab
> Statistics project
- Reacquaint with Lab Technology/Protocols
- Review papers - Engage back with the science
-
Project Print: Screen shots
[ ] collect
“Do the job. Do it engaged. Engage -> Not just execute the best you can, understand the experiment.
Why? Alternative designs? Control experiments needed to interpret the data? Positive controls and negative controls? What do you need to do to get crisp. Totally engage.
How it fits into other experiments?
“Engage with the science as if it were your baby.”
Execute beautifully… Ask --- et. al. What does ideal execution look like
Extra time: allocate time. Technicians : Freedom to do other things, work with other things, other technical things, giving people independent project to carry out. Project --- has in mind? Design. Hands on education of how science works then reading. Spend time focused on a problem and in the ideal become the world’s foremost expert on whatever ‘mundane’ aspect of what ever problem you are working on.
Computational in the context of a problem. Learn to use. Defining “problems I want to solve.” As an operating scientist, the technology can change very quickly. Capable of learning, understanding, and applying.
Answer questions in a robust way. Thinking of technology in context of problem. Deep domain knowledge; focus on experimental more than book reading.
Realistic path -> Research fellow to PhD. program. Industry… Strong head’s up to do research. First-rate OHSU? Excellent. IF: Remember that it is narrow, broader with neuroscience as a component. Biology < > Neurology. Real neuroscience computational ->
Juxtasuposed: Engineering, CS, A.I., and all that…
Label in broad ways: Molecular, cellular, systems, cognitive, psychology. Borders are so fuzzy — as to be
Domain bias. In general -> other than P.I. protected from funding. Publication, the life of the business. Metric of success is the science they publish. Work that contributes to being an author = more engaged, more independent. Evolved to an independent project.
So incredibly broad -> CRISPR, GFP, Optogenetics, with higher level systems problems. 100 years = absurd. Look back -> Could we have conceived whats going on today.
Foremost expert on something how-ever limited. Grow from there. Grown from a particular expertise.
Molecular biologist || Do what a 3 year old is taught to do. How? How? How? How does that work. Quantum physics. Ask questions. Be open.
Go to seminars -> Go to every talk. Take every note. Primary literature fundamentally different. Always learn in context. Don’t dilute too much (ignore title, abstract, discussion). Look at figures and tables and derive for yourself what they say. Look for THE FIGURE or THE TABLE that is the crux and look for the control experiment. Understand the critical assessment, are the facts valid and warranted? Infinite amount to learn, don’t spread yourself infinitely thin. “
To Do: Develop Independent Machine Learning Project
Gain Access to Web of Science
————
Paton Learning Lab
Personal Learning Goals
September 1st - December 1st
Major Goals
[ ] Read Principles of Neuroscience 5th Edition
[ ] Complete CSS 229
[ ] Deep read 12 papers (Write summary || Practice peer review)
Administrative
[ ] Reactivate
[ / ] Figure out Residence Permit/Visa
Lifestyle
[ x ] Purchase commuter bicycle
[ / ] Purchase waterproof computer/messenger bag
Language
[x] …. Focused practice minimum 20 minutes daily …?
[ ] Find language partner
[ ] Portuguese film/television/music
UPCOMING
Phone conversation with --------
Tuesday, August 7th 9:00 a.m. EST (10:00 a.m.
0 notes
All the numbers
fuck you
1. Who was the last person you held hands with?
uH MY CLOSE FRIEND LMAO? 2. Are you outgoing or shy?
lowkey both?? im more shy but if i know the person im incredibly outgoing 3. Who are you looking forward to seeing?
MY LOWKEY GF4. Are you easy to get along with?
oft no 5. If you were drunk would the person you like take care of you?
YEP6. What kind of people are you attracted to?
ppl who are kind !! also ppl who could either break me or love me 7. Do you think you’ll be in a relationship two months from now?
,, hopefully8. Who from the opposite gender is on your mind?
,,, can i say keaton henson bc his music makes me sob9. Does talking about sex make you uncomfortable?
no but depending w who lmao :””^10. Who was the last person you had a deep conversation with?
mm i think my friend from school abt shitty people ngl 11. What does the most recent text that you sent say?
”do you think it’d be a good idea for me to run and get tea right now”12. What are your 5 favorite songs right now?
ok jeez
1. cherry bomb - the runaways (wow, original)
2. all of sevdalizas songs ever
3. blood // water - grandson
4. charger - gorillaz
5. pools - glass animals
13. Do you like it when people play with your hair?
YESYEYSYESYEYSYES. fuck yes.14. Do you believe in luck and miracles?
mhm!!15. What good thing happened this summer?
err i mean, if u count summer as past summer then convincing my dang dad that i dont wanna stay at my shitty school lmao?? 16. Would you kiss the last person you kissed again?
depends on what kind of kiss !! but ye!!17. Do you think there is life on other planets?
pfft, absolutely 18. Do you still talk to your first crush?
,,, i dont think so tbh19. Do you like bubble baths?
HELL YE I DO20. Do you like your neighbors?
ngl i dont rly talk to them but they seem Nice21. What are your bad habits?
if i dont know someone all too well i tend to joke around w them?? idk its weird but i kinda get annoyed easy as well,, altho another bad habit is my flaky ass backing out of events sometimes22. Where would you like to travel?
i’d love to ,,, travel to scotland or france23. Do you have trust issues?
oh boy i do24. Favorite part of your daily routine?
going the hell to sleep again and wrapping myself up25. What part of your body are you most uncomfortable with?
every part w scars lmao26. What do you do when you wake up?
take my dang meds27. Do you wish your skin was lighter or darker?
,, idk?? i like my skin tbh but it could clear tf up28. Who are you most comfortable around?
my sister29. Have any of your ex’s told you they regret breaking up?
nope :””^ 30. Do you ever want to get married?
yes!!31. Is your hair long enough for a pony tail?
ye lmao32. Which celebrities would you have a threesome with?
,,, IM 16 LETS NOT GO HERE33. Spell your name with your chin.
aki34. Do you play sports? What sports?
i work out but i dont play sport lmao35. Would you rather live without TV or music?
without tv, music is my lifeblood36. Have you ever liked someone and never told them?
almost always37. What do you say during awkward silences?
i try to joke abt smth usually38. Describe your dream girl/guy?
someone who cares for me smh39. What are your favorite stores to shop in?
T2, I LOVE TEA,,, 40. What do you want to do after high school?
university or nap 41. Do you believe everyone deserves a second chance?
yes!! unless they’re super shitty42. If your being extremely quiet what does it mean?
i’m nervous, anxious or overthinking43. Do you smile at strangers?
i try to ??44. Trip to outer space or bottom of the ocean?
oo fuck outer space ty45. What makes you get out of bed in the morning?
,, honestly talking to lovely ppl46. What are you paranoid about?
people abandoning me or being completely alone and shut in and just,, closed away from the world47. Have you ever been high?
tba48. Have you ever been drunk?
not rly lmao i have a high tolerance 49. Have you done anything recently that you hope nobody finds out about?
,, UM,,, lowkey yes50. What was the colour of the last hoodie you wore?
olive51. Ever wished you were someone else?
before, yes. now? nah, i’m pretty good 52. One thing you wish you could change about yourself?
highkey wish i was less anxious 24/7
53. Favourite makeup brand?
NARS. nars. or kat von d altho i hate what she stands for
54. Favourite store?
T255. Favourite blog?
,, idk? 56. Favourite colour?
blue / green!!57. Favourite food?
creme brulee58. Last thing you ate?
a rly good double cheese burger59. First thing you ate this morning?
croissant60. Ever won a competition? For what?
knowledge of novels for school!! or art wise, i’ve won a few comps inside our school61. Been suspended/expelled? For what?
nope62. Been arrested? For what?
nada63. Ever been in love?
smh i fall in love,, way to easily64. Tell us the story of your first kiss?
,, jeez i hate the person who it was with, but it was underneath the harbour bridge after chocolate strawberries and a picnic,, she asked if she could kiss me and i said yes65. Are you hungry right now?
jfc not rly im super content tbh66. Do you like your tumblr friends more than your real friends?
no @official-akko is a binch (im kidding i love u)67. Facebook or Twitter?
fb68. Twitter or Tumblr?
tumblr69. Are you watching tv right now?
nope but i was watching law and order svu 70. Names of your bestfriends?
beauty, my cat71. Craving something? What?
cuddling someone and gently lying my head on their chest 72. What colour are your towels?
white!!72. How many pillows do you sleep with?
3 binch73. Do you sleep with stuffed animals?
yes!!74. How many stuffed animals do you think you have?
on my bed is 2, but i think at least 5+ around 75. Favourite animal?
i love,, cats,,,, so fucking much 76. What colour is your underwear?
wouldn’t u like to know77. Chocolate or Vanilla?
vanilla78. Favourite ice cream flavour?
mm cookies and cream?79. What colour shirt are you wearing?
dark bluuee80. What colour pants?
grey81. Favourite tv show?
right now its between brooklyn 99 and stranger things82. Favourite movie?
i will never stop loving mulan or the princess diaries 83. Mean Girls or Mean Girls 2?
mean girls 84. Mean Girls or 21 Jump Street?
mean girls i guess 85. Favourite character from Mean Girls?
,, janis ian86. Favourite character from Finding Nemo?
uh the turtle smh87. First person you talked to today?
ash!! 88. Last person you talked to today?
rn, its niko89. Name a person you hate?
me90. Name a person you love?
ash91. Is there anyone you want to punch in the face right now?
GOD this one asshole from school i will actually brawl92. In a fight with someone?
not rly?? idk93. How many sweatpants do you have?
at least 494. How many sweaters/hoodies do you have?
5!!95. Last movie you watched?
legally blonde pfft96. Favourite actress?
i lowkey love madelaine petsch97. Favourite actor?
shrugs loudly98. Do you tan a lot?
no im pale af99. Have any pets?
a cat!!100. How are you feeling?
tired, coffee makes me tired101. Do you type fast?
yep!! i can touch-type too so i dont even have to look most of the time as well lmao102. Do you regret anything from your past?
waayyy too fuckin much regret over what ive done to myself 103. Can you spell well?
ye!!104. Do you miss anyone from your past?
,, my grandma :105. Ever been to a bonfire party?
nope lmao106. Ever broken someone’s heart?
,, i think i have,,, 107. Have you ever been on a horse?
yes!! i go horseriding at least four times during the year108. What should you be doing?
sleeping probably109. Is something irritating you right now?
i have a fuckin itch on my leG110. Have you ever liked someone so much it hurt?
yep,, oh boy 111. Do you have trust issues?
i already answered this lmao112. Who was the last person you cried in front of?
,, my sister because i wanted her to comfort m e shes v sweet113. What was your childhood nickname?
”leash”114. Have you ever been out of your province/state?
yes!!115. Do you play the Wii?
sometimes116. Are you listening to music right now?
i am, its glass animals :””^117. Do you like chicken noodle soup?
yes!!118. Do you like Chinese food?
eh, iffy but i dont mind it!119. Favourite book?
THE NAME OF THE WIND BY PATRICK ROTHFUSS120. Are you afraid of the dark?
only a lil121. Are you mean?
,, i think i am sometimes122. Is cheating ever okay?
never ever ever ever is it okay.123. Can you keep white shoes clean?
yes! if not i fuckin clean em wth124. Do you believe in love at first sight?
not rly? i think love is something you have to grow and share together, kind of like a garden plant? works gotta go into it for it to blossom 125. Do you believe in true love?
i believe in it!126. Are you currently bored?
,, yea lmao127. What makes you happy?
memes, reading and tea ngl128. Would you change your name?
birthname? ye, probably lmao129. What your zodiac sign?
cancer! im an emotional fucking crab130. Do you like subway?
ye!131. Your bestfriend of the opposite sex likes you, what do you do?
remind them im a lesbian132. Who’s the last person you had a deep conversation with?
binnch this is a past question133. Favourite lyrics right now?
”Our skinIn time would tellCan I hold on to our genesIn my lifeI could not failWhen I run out will you leave?”
134. Can you count to one million?
i can but i’d loose track i have attention issues pfft135. Dumbest lie you ever told?
”i was late because my cat threw up one on of my school uniforms and i had to change”136. Do you sleep with your doors open or closed?
closed, idk who can trust anyone that much to keep them open137. How tall are you?
5′7!138. Curly or Straight hair?
i have wavy hair if this is asking m e139. Brunette or Blonde?
blonde140. Summer or Winter?
winter141. Night or Day?
night142. Favourite month?
july bc its cold and my birth month143. Are you a vegetarian?
nooppe144. Dark, milk or white chocolate?
milk chocolate!145. Tea or Coffee?
tea146. Was today a good day?
meh, highs and lows 147. Mars or Snickers?
mars148. What’s your favourite quote?
either:a. “And what we learn about ourselves in those moments, where the trigger has been squeezed, is this: the past is not dead. There are things that wait for us, patiently, in the dark corridors of our lives. We think we have moved on, put them out of mind, left them to desiccate and shrivel and blow away; but we are wrong. They have been waiting there in the darkness, working out, practicing their most vicious blows, their sharp hard thoughtless punches into the gut, killing time until we came back that way.” from Trigger Warning (Short fictions and disturbances), neil gaiman
or
b. “Perhaps the greatest faculty our minds possess is the ability to cope with pain. Classic thinking teaches us of the four doors of the mind, which everyone moves through according to their need.First is the door of sleep. Sleep offers us a retreat from the world and all its pain. Sleep marks passing time, giving us distance from the things that have hurt us. When a person is wounded they will often fall unconscious. Similarly, someone who hears traumatic news will often swoon or faint. This is the mind's way of protecting itself from pain by stepping through the first door.Second is the door of forgetting. Some wounds are too deep to heal, or too deep to heal quickly. In addition, many memories are simply painful, and there is no healing to be done. The saying 'time heals all wounds' is false. Time heals most wounds. The rest are hidden behind this door.Third is the door of madness. There are times when the mind is dealt such a blow it hides itself in insanity. While this may not seem beneficial, it is. There are times when reality is nothing but pain, and to escape that pain the mind must leave reality behind. Last is the door of death. The final resort. Nothing can hurt us after we are dead, or so we have been told.” - The name of the wind, patrick rothfuss
149. Do you believe in ghosts?
yes!! i believe that ghosts exist lmao, or at least guiding spirits 150. Get the closest book next to you, open it to page 42, what’s the first line on that page?
“… but he left his doubts unspoken. Some old wounds never truly heal, and bleed again at the slightest word.” - Game of thrones lmao
3 notes
·
View notes
New York Blackbeard Diary Pt. 3
Day 11.......Woke up.....Started my day getting breakfast then headed to my neurologist office to get my form from my job in regards to my restrictions. After, went to the library to print out documents in regards to a situation that led to someone purchasing something from a PayPal. Pretty much someone hacked into my PayPal and purchase a monthly subscription to watch a show smh. As I was heading to work, I thought about all of my problems and have decided to take care of all the problems. Feels like time is not on my side in my opinion and I can no longer deal with the bullshit no longer. As take care of the problems head on, I have no problem dealing with consequence even if my body limitations is at risk cause. I'm alone in this and that's no one fault cause everyone has their own problem to fix.
On on to the side story......2012.......
The new year started and I was in a long distance relationship. Unfortunately, It didnt last long. Obviously, communication was the cause of the problems. From there I was talking to girls got into a relationship but that didnt even last too. Then I saw her. Now I'm not gonna write her government name. So I'm gonna name her HopelessRomantic. Unlike every women I've been with physically, I actually found her online. I didn't expect her to give me a chance but she did. At first, we were back and forth breaking up and making up. Then mid year, she broke up with thru a inbox smh. She was right tho, I wasn't doing anything with my life and she felt I had no ambition. It's crazy because before she broke up with me, I wanted to let her know that I finally got a job lol. During that time til September, I was dating and talking to other women but at the same time trying to get back with HopelessRomantic. Then at one point, HopelessRomantic was going through a tough time. So I took an opportunity to help her out. I was making sure she was okay. Then one day there was a BWA (beach) reunion show and since I told HopelessRomatic about my backyard wrestling career, I invited her to the show. That day was interested as I got to see some of the guys even my first love and by the night, I brought her home and "Netflix and chill" happened lol. It was our first time doing something after 9 months of us knowing eachother. From that moment on we were back together but this time she trusted me and gave me another chance of love again. On to other things,in that year I started wrestling officially in BWA (Bronx). I had a chance to wrestle in RCW but I decided not to go. I knew I wasn't going to be comfortable there and plus the only people I would mostly trust would be the DIW wrestlers that I meant in 2011. Everyone else ehhhhh (the white boys weren't really there lol). BWA (Bronx) hands down was the best time of my backyard wrestling career. Holy Convictions Tag Team with Genocide, 4 aces, matches with Loco, Dixon, Dom The Don, my epic match against Gencocide that open everyone's eyes, and the match of the event of SuperShowDown (their Wrestlenania), against Joker. I had a epic time in the BWA (Bronx). Now back to HopelessRomantic. Our relationship was great. Our families liked us together, I got to see her often, I was working, the sex was great lol, and she even motivated me to actually go to college. The original plan was to go study Criminal Justice. Then December hit and after the hurricane, I came from chilling with a friend and HopelessRomantic send me a message on Facebook breaking up with me. There wasn't a particular reason. She wrote like an essay but it had nothing to do with me. I can only assume she wasn't interested anymore. So the year was heading to its end. So I decided to live it up with Black, Red, Green, and Blue Label with some 40s. Regardless of the break up, I still had good year.
Day 12.......Woke up and started my day with a cup of coffee. Went to my job to pick my check check my app to see how much since I started last week and today was pay week and apparently I got no pay listed on this week. So I can only assume my next check will make up for last week or something. Money is always with no value hard to get by but hey whatever. So went on my morning and TD Bank to fax the people apart of my dispute case and unfortunately the bank printing machine doesn't work doesn't work. So another Negative Nancy in the poison air of New York City. After work, I saw my Autismo crew (J God, Weirdo, and Porn Plug). Chopped it up a little bit and by the way F**K WWE 2K!!!!!
On on to the side story......2013......
2013 new year.....still working on and off. Surprisely, me and HopelessRomantic kept in contact regardless of the breakup. One day I brought her over just to chill. She got cozy which didn't bother cause she was single as was I. From what I remember, we were talking and it led to her being emotional and she was crying. So held her tight then boom......we had sex......The next day we were talking and I kinda express to her I wanted to get back together but she didn't want that. I actually cried but accepted and got over it. Probably like a month later, she got into a relationship with someone else which sucked even more. Other than that I signed up for a program that dealt with Digital Media and did well in the program. I was still working but not as much. My birthday but on that day I was sick (for about a week). After I healed, I started this new job that my guy Dirty Sandchez aka Eyevrows from Getaway hook me up with. It was an maintenance job. Did the job and all. July 4th hit and partying up drinking doing my thing. I woke up and got a call from HopelessRomantic letting me know that her Aunt passed. All I had was tears cause her aunt meant a lot The last time I talk to her was Mother's Day so the pain was more. I was mad and I played Dante's Inferno with anger. From morning til night, I beat the game. The one thing I notice alot that day was I had double vision that whole day. I would think that would be gone by the morning but it wasn't. After hanging out with my boy. I started to fall easily and constantly told I looked crossed eyed. By August my left leg felt like I or sprained it. August I finally hit the switch and started college. I was studying Mental Health/Domestic Violence Counseling. First semester went well. All As and 1 B. I even had my own little crew.
SIDE NOTE: One person in that crew ending up being my girlfriend (2016)
During the first semester I was still dealing with my health problems. Things got worse. My hands were so numb that I couldn't write. My double vision was there everyday and I had a hard time walking on my left leg. After going to the emergency room doing MRIs and Catscans and testing my strength with a group of neurologists and constantly hearing that I'm so young (I was 22), I saw a neurologist and he told me that I have Multiple Sclerosis.......
Day 13........Woke up, got ready, and speed walked to the bus stop to get to work. Unfortunately, I got a little late due to the bipolarness of the bus coming on schedule. When. I got to work, I couldn't punch in due to the app I punch in on couldn't connect to the server. After work, I went to see a friend that I haven't seen in quite some time and that was pretty much my day.
On on to the side story......2014.......
2014 came. I finally got my finally treatment after waiting for months for insurance reasons smh. I had to take it every week. I continued college by taking free classes inthe winter semester which was apart of Fall semester. As a result passed both classes with an A. From there my GPA was 3.6. With my education background with a learning disability, D equalivent grades, being in special ed classes, and receiving services due to my learning disability, for a guy with a incurable health condition that pretty much messes with your body depending on the central nervous system state, it was remarkable for something like that to happen. Spring semester hit and once again did my thing in classes, went on dates, and followed the routine of being on grind. Then the summer semester hit and I was offered to take a short summer class and I took it of course since it was free. That morning of first day of the class, I wanted to do the impossible and walked from my home to school (Albemarle and East 19 to Manhattan Beach). It took about 3 hours. Got to class on time and kind sat around or whatever. Some other people got inthe class and informed the professor that they were in the other classroom. For some odd reason I was more aware of a woman saying that then the others. Crazy cause that same woman ended up being my girlfriend by the end of September. We ain't saying government names. So her name for this post is Hermione (she likes Harry Potter). She had tattoos, smart, and she was honest for what I feel most of the time. Eventually the relationship didn't last and ended the same way.......a message. Her reasons made sense I guess (went too fast). Honestly I don't believe time should be a determining factor for a relationship to happen. If you feeling this person then give it a shot but that's just my opinion. Also, in 2014, I officially ended my backyard wrestling career against my friend, my brother, and my on screenplay rival Rodney Banks. It was the perfect ending to the legend that was called Heavy D.
Day 14.......Woke up. Gather some clothes and did some laundry. Sat outside for a little bit and headed back to the shelter and took a power nap. Woke up about 3 and watch One Piece Episode 901. I'm already current with the manga. So I'm basically watching what I already read. That was pretty much my Sunday. Plus I need all the rest for the upcoming days of this week. I gotta say, I'm slowly getting myself together to the point that people inthe shelter are noticing me more as hardworking individual. I'm always on the move and that's being notice and respected by people in the shelter.
On on to the tragic side story......2015
2015 started off okay. Winter semester was a success. I saw Hermione. But I didnt really give her attention after the break up but after we talked, we became friends and that was it nothing more. Spring semester came and I did my thing again and lived the college life but got a job. So now I'm get on my grind and officially had no time for much. Summer was here and my mother was working getting her passport to go back to Jamaica and see her family after years. One time I came from work and as usual expected my mother to be home since she doesn't like to be out late. She nevered came home which was extremely alarming. Call the police and I was informed that she was in the hospital in the city. Got to the hospital and use the phone to locate and she was in the 3rd floor ICU. I didn't know what ICU meant at that time but I knew it was something bad. Got to the ICU and saw my mother........Hospital covered with a bandage on her head as if someone bash a metal bat on her head. Come to find out, she had a seizure and fell on head in the street very hard. I was in tears. All I can remember was that the last time I saw her she told me that she was heading out. My mind was wtf like this ain't real. Called everyone I can call and every got the news that my mother was inthe hospital. She eventually got transfer to a rehab center in Far Rockaway Queens. Things seem to be okay. Then I come home from a hard day at home and I get phone call from a friend informing me that something happened and my younger brother didn't sound okay on the phone. Went to the hospital my mother was sent to. Her eyes was closed. Next couple of days saw her as the machine was helping her breath not responding or reacting inthe room. The doctor spoke to me and younger brother and pretty much said there a very little chance they can help. By October 12th. My younger brother called me and informed me that our mother died........
Day 15......Woke up.....Had to skip gym again. I had to get my mail and sent some emails. After, I went straight to work. After work, I happen to see a face I haven't seen in quite some time and we actually introduce our names after knowing each other for years. It's kind of cool knowing someone and finally just engaging in a conversation (just regularly). Then mailed my my money order to this One Shot Deal that I owe money to unfortunately. While on my way back to the shelter, I started thinking.....now knowing that just about everyone knows that I have Multiple Sclerosis......Hawk's Eye will be on me and my refusals from any assistance will make things a little more tough and edgier. So at this point, I have to be smart on everything I do. But I'm sure I'll get through this someway.
On on to 2016.......
2016 was here. After a hard 2015, I was able to keep the home, still work, made sure my health was good and survived a hard semester. I made the impossible possible. On the other hand, things were different. I started living somewhat a independent free life. I went to school, work, and party on the weekends. I was even going to the strip clubs and bars just living it up with my people. Eventually, I had this feeling like I needed to be what I was and I felt it was time to look for love again and I found it. No government names revealed. So her name was SoReal lol. I knew her since I started college (2013). We kept in contact and eventually we got together in July. It was love again. I haven't felt this type of love since my first relationship. She was smart, hardworking, and very determined to finish college. I was in love. When she felt she needed me, I was ready to help. We went on multiple dates. We talked all the time and we expressed that we loved each other. Other than love, I GRADUATED FROM KINGSBORO WITH AN ASSOCIATES!!!!! By September, I was city bound at City College. By the fall semester thing weren't good between me and SoReal. She distanced herself from me and with that I got less focus on school. Our relationship was so back and forth. When December hit, I got a letter from the landlord informing me that I must pay 3500 dollars in two weeks or I get evicted. So rent is not really being paid by my roommate, I'm barely getting thru college, and my relationship is a mess. As a result, I was still in relationship surprisingly, I pass my classes (barely), and I had to ask for assistance from this service called the One Shot Deal (where your whole rent is paid off but you got to pay back the money that was covered. 2017......would finally bring me to the limit.....
Not everything was meant to be......
Jikai........One Last Time. The Past From The Last View 2017 The Fall Of A Headliner
Mad King Recharging Arc
0 notes
100 questions tag
i was tagged by @liv-sims, @simatrix and @pixelbloom (thank you!!!)
1. do you sleep with your closet doors open or closed?
closed i can’t sleep when they are open lol
2. do you take shampoo and conditioner bottles from hotels?
no
3. do you sleep with your sheets tucked in or out?
out bc i need some air!!!!
4. have you stolen a street sign before?
sorry to disappoint but no!!!!
5. do you like to use post-it notes?
yes i do
6. do you cut out coupons but never use them?
no
7. would you rather be attacked by a big bear or a swarm or bees.
that’s a hard one so i can’t choose sorry i don’t want to die
8. do you have freckles?
i used to but not anymore :-) (I MISS THEM I WAS SO CUTE)
9. do you always smile for pictures?
well yes on family pictures :-)
10. what is your biggest pet peeve?
seeing a spider in my room
11. do you ever count your steps when you walk?
no
12. have you peed in the woods?
yes lmao
13. have you ever pooped in the woods?
i think i did??? can’t remember if that day i peed or pooped
14. do you ever dance even when there’s no music playing?
when i’m celebrating yes lmao
15. do you chew your pens and pencils?
i started like 2 months ago bc of one of my friend smh i hate her
16. how many people have you slept with this week?
does my cat count?
17. what size is your bed?
i have a double bed!!!! (bless my parents for my new room)
18. what is your song of the week?
trading time by r5 because you know i love r5 and there’s a new ep and it’s amazing it’s beautiful it’s art
19. is it okay for guys to wear pink?
totally
20. do you still watch cartoons?
yes when idk what to watch or when i’m feeling nostalgic
21. what is your least favourite movie?
i have no idea
22. where would you bury hidden treasure if you had some?
well probably in my garden bc i wouldn’t like to be away from my treasure??
23. what do you drink with dinner?
water or coke (i know its bad)
24. what do you dip chicken nuggets in?
nOTHING WHY WOULD I DO THAT CHICKEN NUGGETS ARE TOO GOOD TO DIP THEM IN SOMETHING
25. what is your favourite food?
CHICKEN NUGGETS
26. what movies could you watch over and over again and still love?
romantic movies :-)
27. last person you kissed?
my friends to tell them goodbye after school lol
28. were you ever a boy/girl scout?
no
29. would you ever strip or pose nude in a magazine?
no
30. when was the last time you wrote a letter to someone on paper?
4 years ago to do a work experience
31. can you change the oil on a car?
i think i can??? never done that actually but my driving teachers told me how to
32. ever gotten a speeding ticket?
no never i hate breaking the rules when it comes to driving bc we’re not alone out there so pls respect ppl and their security thank you (i wish my mom could understand that)
33. ever run out of gas?
no
34. what’s your favourite type of sandwich?
ham sandwich a classic in france!!!!
35. best thing to eat for breakfast?
cereals
36. what is your usual bedtime?
11pm when there’s school in the morning
37. are you lazy?
yes i am
38. when you were a kid what did you dress up for as Halloween?
never celebrated it!!
39. what is your Chinese astrological sign?
tiger!!!!!! love it
40. how many languages can you speak?
3
41. Do you have any magazine subscriptions?
no
42. Which are better Legos or Lincoln Logs?
what even are lincoln logs?
43. are you stubborn?
yes all the damn time i’m sorry
44. who is better Leno or Letterman?
idk who that is
45. ever watch soap operas?
no
46. are you afraid of heights?
it depends
47. do you sing in the car?
yes lmao
48. Do you sing in the shower?
all the time
49. do you dance in the car?
no??
50. ever used a gun?
well no it’s not a thing as it is in some countries.... looks so scary to me
51. last time you got a portrait taken by a photographer?
never lmao why am i not american i want a year book!!!!!
52. do you think musicals are cheesy?
yes they are but <33
53. is Christmas stressful?
OMG NO CHRISTMAS IS THE BEST TIME OF THE YEAR!!
54. ever eat a Pierogi?
no
55. favourite type of fruit pie?
apple
56. occupations you wanted to be when you were a child?
writer hehe
57. do you believe in ghosts?
yes i do and i’m a very rational person. little stories: i had lunch at school once and i felt a hand with claws on my shoulder and i screamed, then it was gone. also last summer i’m sure the house i was spending my holidays was haunted. like one night it was very windy and it was not even real, i mean the weather forecast didn’t plan it and my parents didn’t hear anything so yea scary stories. and i was awake and everything it really happened
58. ever had a deja-vu feeling?
almost once a week
59. do you take a vitamin daily?
sometimes during winter when i’m feeling a little down
60. do you wear slippers?
i used to but i’ve been seeing a chiropodist so i can’t for like 2 years lmao
61. do you wear a bath robe?
yes!!! currently wearing it <3
62. what do you wear to bed?
underwear + tee
63. what was your first concert?
my uncle!!! he’s a musician :-)
64. Walmart, Target, or Kmart?
IM FREAKING FRENCH
65. Nike or Addidas?
i honestly don’t care
66. Cheetos or Fritos?
IM FRENCH
76. Peanuts or Sunflower Seeds?
peanuts!!
68. ever heard of the group Tres Bien?
no but i appreciate french :-)
69. ever take dance lessons?
yes!!! during 5 years hehe and i still can’t dance
70. Is there a profession you picture your future spouse doing?
no i don’t really care
71. Can you curl your tongue?
no it’s so sad!!!!!
72. Ever won a spelling bee?
doesn’t exist here
73. have you ever cried because you were so happy?
yes at my 18th birthday party when everyone was singing happy birthday lmao i cry so easily
74. own any record albums?
yes!!! dangerous woman!!!!! <33 (is that a record album?? don’t really know if it means vinyl or not)
75. own a record player?
no
76. do you regularly burn incense?
i think i do
77. ever been in love?
no!! i believe you can only be in love when you’re in a relationship despite all of my friends say!!! and i’ve never been in a relationship!!!! heyo!!!!
78. who would you like to see in concert?
R5 OMG PLS BUT IM SO SAD THEY COME SO FAR WAY FROM ME WHY DO ARTISTS ONLY SEE PARIS
79. what was the last concert you saw?
my uncle again lol
80. hot tea or cold tea?
I HATE TEA
81. tea or coffee?
I HATE BOTH
82. sugar cookies or snickerdoodles?
i only know sugar cookies lol
83. can you swim well?
yes
84. can you hold your breath without holding your nose?
yes
85. are you patient?
not at all
86. DJ or band at wedding?
BAND
87. ever won a contest?
no
88. have you ever had plastic surgery?
no
89. which are better black or green olives?
I DONT LIKE IT
90. can you knit or crochet?
my mom managed to teach me but i just can’t
91. best room for a fireplace?
living room
92. would you like to get married one day?
yes :-)
93. if married, how long have you been married?
HEHE :-) :-)
94. who was your high school crush?
i had so many crushes i don’t even know
95. do you cry and throw a fit until you get your way?
yes lmao i’m a child
96. do you have kids?
no
97. Do you want kids?
yes :-)
98. what is your favourite colour?
yellow rn
99. do you miss anyone right now?
no!!
100. who are you going to tag to do this tag next?
no one bc i’m going to eat rn lol bye
24 notes
·
View notes
gay ask for gays only: all of them
1. describe your idea of a perfect date
hmm maybe a fun day at an amusement park or movies, a nice dinner, then stargazing or something? idk tbh just something where we’d have fun together and do cute coupley stuff hehe (but not like too much pda bc thats annoying)
2. whats your “type”
i’m a real sucker for the “quiet artsy/mysterious” type LMAO. i like people who are creative, kinda quiet, thoughtful, romantic, spontaneous, and honest
3. do you want kids?
yeah, someday
4. if you do, will you adopt or use some other form of child birth?
sigh, probs childbirth but adopting doesn’t sound bad either?
5. describe the cutest date you’ve ever been on
well i haven’t been on many tbh... i think the cutest one was when we walked around the pier at night, holding hands bc it was cold. we also talked while sitting on the swings on a playground and he pushed me on the swing haha. then when we got too cold to stay outside, we went in somewhere for some hot cocoa~
6. describe your experience having sex for the first time (were you nervous? or was it easy peasy?)
i wouldn’t know LOL
7. are you a morning time gay or night time gay?
night time!! my brain (and heart) is like x10 more awake and active at night haha
8. opinion on nap dates?
incredibly adorable and honestly goals
9. opinion on brown eyes?
they’re so underrated! they have such a warmth and depth to them... they’re so alluring and sometimes i feel like i can drown in them. i love brown eyes
10. dog gay or cat gay?
both?? although in terms of personality, i suppose i’d be more of a cat :3c
11. would you ever date someone who owned rodents or reptiles?
mmm yeah sure, reptiles are cool tho and rodents can be cute! but i might not be 100% comfortable if their pets were like just loose around the house when i came over?
12. whats a turn off you look for before you start officially dating someone
poor communication/conversation skills... if they can’t hold and carry a good conversation, then whats the point? communication is one of the most important things in a relationship!
13. what is a misconception you had about lgb people before you realized you were one?
oh god,,, i was actually homophobic before i realized that i was gay myself bc i was raised in a very conservative, homophobic, christian household. its highly unsettling to remember myself like that tbh... i had once thought that lgbtq+ people were ‘choosing’ to be gay smh
14. what is a piece of advice you would give to your younger self
pls don’t let other people’s perceptions of you deter you from enjoying and loving the things you do. also pls, for the love of god, get some new clothes... you need to really reevaluate your fashion choices
15. (if attracted to more than one gender) do you have different “types” for different genders?
yes!! i tend to like feminine boys and more androgynous girls?
16. who is an ex you regret?
my “first boyfriend” LMAO he was such a shitbag... he didn’t treat me right and cheated on me. fuck him
17. night club gay or cafe gay?
cafeee! omg thats so wholesome and cute ajskdhaf/// night clubs are fun too but not my first choice... they’re just so crowded and loud and sweaty
18. who is one person you would “go straight” for
well uhh i’m pan so i do still like men LMAO so idk? a lot of them???
19. video game gay, book gay, or movie gay?
book! or maybe movie... but books are richer imo and leave room for you to imagine/create things yourself!
20. favourite gay ship (canon or not)
i think,,,, klance (from voltron)?
21. favourite gay youtuber
troye sivan (pls make more videos again ajskda i miss him;;;)
22. have you ever unknowingly asked out a straight person?
um i’ve never asked someone out so LOL
23. have you ever been in love?
tbh i don’t think so? if so, then only very very briefly.
24. have you ever been heartbroken?
uhhhh i don’t think so? since i don’t think i’ve ever truly loved anyone romantically so how can i get my heart broken LOL
25. how do you determine if you want to be them or be with someone
THIS IS THE HARDEST THING TO DISTINGUISH TBH to this day, i struggle and often i’m not able to tell the difference :’)
26. favourite lgb musician/band
again troye sivan!
27. what is a piece of advice you have for young / baby gays
the attraction and love you feel for people is not wrong or gross... its lovely and i hope you can continue to explore yourself to find happiness and love!!
28. are you out? if so how did you come out
if you exclude the interwebs (LMAO i talk about being gay all over the internet to my internet friends) uhh no haha only to a couple of close friends irl
29. what is the most uncomfortable / strange coming out experience you have
umm i don’t think i’ve ever had one?
30. what is a piece of advice for people who may not be in a safe place to express their sexuality
oh man, you must be feeling very frustrated and suffocated... but if you can, try to find a safe space where you can express yourself! whether it be with a close group of trusted friends, a club at school, internet friends, or even your own private journal or something! i’m sorry you have to go through this, but pls stay strong!!
2 notes
·
View notes
Tag
I was tagged my the lovely @grumpytth for this ask tag! Thank you so much you ily. :)))))
💖RULES: you must answer these 92 statements and tag 20 as many people as you like!
THE LAST:
1. drink: water
2. phone call: my dad
3. text message: “If it doesn’t happen I’ll sue the zodiac/astrology”
4. song you listened to: Get You- Daniel Caesar
5. time you cried: Friday
6. dated someone twice: nooooo
7. kissed someone and regretted it: nooooo
8. been cheated on: noooo and hopefully never
9. lost someone special: yes
10. been depressed: still am but gettin there
11. gotten drunk and thrown up: nooooo
LIST 3 FAVOURITE COLOURS:
12-14. Pink, blue, gray
IN THE LAST YEAR HAVE YOU:
15. made new friends: just one or two really
16. fallen out of love: nooooo
17. laughed until you cried: probably at some point
18. found out someone was talking about you: nooooo
19. met someone who changed you: possibly?
20. found out who your friends are: Def yes
21. kissed someone on your Facebook list: Nope
GENERAL:
22. how many of your Facebook friends do you know in real life: Most if not all
23. do you have any pets: I have fish
24. do you want to change your name: Idk what I’d change it to so i guess not
25. what did you do for your last birthday: I went thrift shopping with my sister and then got bubble tea and went for a walk downtown with one of my bffs :’)
26. what time did you wake up: around 9
27. what were you doing at midnight last night: watching Friends
28. name something you can’t wait for: Figuring out my life
29. when was the last time you saw your mom: this morning
30. what is one thing you wish you could change in your life: my lack of motivation
31. what are you listening to right now: Strangely I’m watching L.A. Ink bc nothing else is on so I’m listening to that.
32. have you ever talked to a person named tom: Yes
33. something that is getting on your nerves: My own jealousy of things i have no control over
34. most visited website: either tumblr or blackboard for my school :’)
35-37. lost questions??
38. hair colour: dark brown
39. long or short hair: It looks short since its curly but its pretty long
40. do you have a crush on someone: just a delusion filled crush on Kim Seokjin but irl naaaaahhhh
41. what do you like about yourself: I like my ability to keep on good terms. I don’t like having people think badly of me, so I try to figure everything out to stay on good terms even if we part ways
43. blood type: I should know but I have no idea
44. nickname: just Rach usually, there used to be a ton of embarrassing ones in like middle school but they died out thank GOD
45. relationship status: eternally single
46. zodiac: gemini
47. pronouns: she/her
48. favourite tv show: Friends
49. tattoos: nooooo my mom also told me she’d beat me up until she couldn’t recognize me if I got one :’) so yikkkeeessss
50. right or left handed: right
51. surgery: just your basic like wisdom tooth removal
52. piercing: just my ears
53. sport: ya’ll I’ve tried so many but stink at all of them
55. vacation: I’ve been to a lot of tropical places like mexico, dominican republic, and jamaica but I like places like new york and chicago better for vacations. However I hope to go to italy someday
56. pair of trainers: uhhhh I have one pair of adidas but thats about it
MORE GENERAL
57.eating: I live off of eggs, oatmeal, and salads I’m trying to be healthy smh its hard ya’ll
58. drinking: water
59. i’m about to: get ready for work
61. waiting for: my paycheck
62. want: to lose weight and figure myself out
63. get married: if i ever find love maybe
64. career: I think I want to be a teacher but we’ll see
65. hugs or kisses: hugs
66. lips or eyes: either
67. shorter or taller: taller
68. older or younger: Idc much
70. nice arms or nice stomach: it doesn’t matter
71. sensitive or loud: someone who’s sensitive but will take over a conversation bc sometimes I just can’t with talking
72. hook up or relationship: Relationship
73. troublemaker or hesitant: I’m def hesitant
HAVE YOU EVER:
74. kissed a stranger: noooo
75. drank hard liquor: Yes
76. lost glasses/contact lenses: yaa
77. turned someone down: Kind of?
78. sex on the first date: Idk
79. broken someone’s heart: probably not
80. had your heart broken: maybe?
81. been arrested: no
82. cried when someone died: def yes
83. fallen for a friend: yaaa
DO YOU BELIEVE IN:
84. yourself: its a rocky road
85. miracles: used to
86. love at first sight: ehhhh
87. santa claus: nooo
88. kiss on the first date: y not
89. angels: ehhh maybe
OTHER:
90. current best friend’s name: Bridgett :’) but i have a few close friends, one is the famous @cozychim ily
91. eye colour: brown
92. favourite movie: Sleepless in Seattle I really wish I knew why.
Thanks again to @grumpytth for the tag I love your blog so much! I hope you enjoy the rest of your day!!!
I’d like to tag @cozychim @kimtae95s @d4ngerousb0ys @aju--yikes and anyone else who wants do do it ily
3 notes
·
View notes
all of them~
1. Who was the last person you held hands with?
um, i want to say steffen but it might have been mark
2. Are you outgoing or shy?
im in the middle, but if i had to pick i would go with outgoing
3. Who are you looking forward to seeing?
aubrey, mark, and steffen
4. Are you easy to get along with?
i would like to think so
5. If you were drunk would the person you like take care of you?
i mean i usually take care of others if im not puking but usually its steffen, aubrey, andrew, and/or cat
6. What kind of people are you attracted to?
i dont have a type honestly so im attracted to a wide variety of people
7. Do you think you’ll be in a relationship two months from now?
hah fuck no
8. Who from the opposite gender is on your mind?
mark
9. Does talking about sex make you uncomfortable?
no not really
10. Who was the last person you had a deep conversation with?
hmmm, maybe sam?
11. What does the most recent text that you sent say?
“lol yeah cause i look like garbage without lipstick on”
12. What are your 5 favorite songs right now?
blackpink - as if its your last
chungha - why dont you know
boa - spring rain
exid - cream
exid - dont wanna drive
exid - how why
exid - night rather than day
exid pat pat
iu - palette
okay its not five but theyre all good and i love them
13. Do you like it when people play with your hair?
yeah
14. Do you believe in luck and miracles?
eh it depends
15. What good thing happened this summer?
hanging out with my mates and getting to chill with them
16. Would you kiss the last person you kissed again?
oh for sure, hes a really good kisser lmao. in all honesty it will probably happen again next week
17. Do you think there is life on other planets?
i hope so
18. Do you still talk to your first crush?
lol nah
19. Do you like bubble baths?
i dont like baths so no
20. Do you like your neighbors?
ehh
21. What are you bad habits?
i have many but i’ll just name one for now and thats not saying no when i should
22. Where would you like to travel?
south korea maybe
23. Do you have trust issues?
um, i dont think so?
24. Favorite part of your daily routine?
i dont have one
25. What part of your body are you most uncomfortable with?
arms and belly
26. What do you do when you wake up?
check my phone
27. Do you wish your skin was lighter or darker?
i like it how it is
28. Who are you most comfortable around?
my close mates, the ones im okay with seeing me without makeup
29. Have any of your ex’s told you they regret breaking up?
no
30. Do you ever want to get married?
honestly not really, i doubt i ever will
31. Is your hair long enough for a pony tail?
yeah
32. Which celebrities would you have a threesome with?
im not into threesomes
33. Spell your name with your chin.
im too tired for that
34. Do you play sports? What sports?
nah
35. Would you rather live without TV or music?
tv
36. Have you ever liked someone and never told them?
yeah
37. What do you say during awkward silences?
i just try to make casual conversation
38. Describe your dream girl/guy?
i dont have one
39. What are your favorite stores to shop in?
forever 21
40. What do you want to do after high school?
i mean im already in uni so
41. Do you believe everyone deserves a second chance?
it depends on the situation
42. If your being extremely quiet what does it mean?
it could mean a lot of things, it just depends
43. Do you smile at strangers?
depends
44. Trip to outer space or bottom of the ocean?
both are rather terrifying when you think about it
45. What makes you get out of bed in the morning?
i dont want to be a complete slob
46. What are you paranoid about?
people finding out things they shouldnt
47. Have you ever been high?
nah
48. Have you ever been drunk?
yes
49. Have you done anything recently that you hope nobody finds out about?
yeah
50. What was the colour of the last hoodie you wore?
probably grey, or maybe navy
51. Ever wished you were someone else?
no
52. One thing you wish you could change about yourself?
i dont wanna say
53. Favourite makeup brand?
i dont have a favorite brand, just favorite products
54. Favourite store?
forever21
55. Favourite blog?
i dont really have one
56. Favourite colour?
blue
57. Favourite food?
korean food
58. Last thing you ate?
a cucumber
59. First thing you ate this morning?
uummm a grilled chicken sandwich from red robin
60. Ever won a competition? For what?
probably a stupid one
61. Been suspended/expelled? For what?
nah
62. Been arrested? For what?
nah
63. Ever been in love?
yeah
64. Tell us the story of your first kiss?
i was drunk and at a party, dancing with some guy and he went for a kiss and i thought “fuck it why not?”. but it was real slobbery and had a lot of tongue and wasnt pleasant. luckily i never have to see that guy again
65. Are you hungry right now?
nah
66. Do you like your tumblr friends more than your real friends?
if were tumblr friends i consider you to be a real friend of mine
67. Facebook or Twitter?
i dont have a twitter
68. Twitter or Tumblr?
see above
69. Are you watching tv right now?
yes
70. Names of your bestfriends?
i will only list a few
dami
aubrey
aussie
katherine
71. Craving something? What?
nah not really
72. What colour are your towels?
white
72. How many pillows do you sleep with?
two
73. Do you sleep with stuffed animals?
yeah
74. How many stuffed animals do you think you have?
three
75. Favourite animal?
my baby boy
76. What colour is your underwear?
black
77. Chocolate or Vanilla?
i dunno i like both
78. Favourite ice cream flavour?
birthday cake
79. What colour shirt are you wearing?
pink
80. What colour pants?
im not wearing any
81. Favourite tv show?
criminal minds or greys anatomy
82. Favourite movie?
star wars
indiana jones
the prestige
snowpiercer
theres more but im lazy
83. Mean Girls or Mean Girls 2?
i never saw the latter
84. Mean Girls or 21 Jump Street?
see above
85. Favourite character from Mean Girls?
i dunno, tina feys character probably
86. Favourite character from Finding Nemo?
i like marlin
87. First person you talked to today?
mark
88. Last person you talked to today?
im currently on call with aussie, sam, and yennifer
89. Name a person you hate?
i dont hate anyone
90. Name a person you love?
dami is the first person that comes to mind
91. Is there anyone you want to punch in the face right now?
if i thought hard enough i could come up with someone but as of right now, nah
92. In a fight with someone?
nah
93. How many sweatpants do you have?
like two pairs, maybe one cause i think i lost a pair
94. How many sweaters/hoodies do you have?
six
95. Last movie you watched?
despicable me three smh
96. Favourite actress?
i dont have one
97. Favourite actor?
hugh jackman probably
98. Do you tan a lot?
lol no
99. Have any pets?
yes
100. How are you feeling?
tired
101. Do you type fast?
eh relatively i guess
102. Do you regret anything from your past?
yeah
103. Can you spell well?
moderately
104. Do you miss anyone from your past?
yeah
105. Ever been to a bonfire party?
i mean there have been parties where there was a fire but it wasnt specifically a bonfire party
106. Ever broken someone’s heart?
i might have
107. Have you ever been on a horse?
yeah
108. What should you be doing?
sleeping
109. Is something irritating you right now?
these fucking bug bites
110. Have you ever liked someone so much it hurt?
not to the point where it hurt, no
111. Do you have trust issues?
didnt i answer this?
112. Who was the last person you cried in front of?
i dont even remember the last time i cried
113. What was your childhood nickname?
court
114. Have you ever been out of your province/state?
ye
115. Do you play the Wii?
i just bought one
116. Are you listening to music right now?
nah
117. Do you like chicken noodle soup?
ye
118. Do you like Chinese food?
ye
119. Favourite book?
i dunno, im too tired at the moment
120. Are you afraid of the dark?
nah
121. Are you mean?
i can be i suppose, bu in generally i would like to think im not
122. Is cheating ever okay?
not on people it isnt
123. Can you keep white shoes clean?
lol no
124. Do you believe in love at first sight?
see above
125. Do you believe in true love?
yeah
126. Are you currently bored?
eh im alright
127. What makes you happy?
the first things that come to mind are my mates and kisses lol
128. Would you change your name?
nah
129. What your zodiac sign?
gemini baby
130. Do you like subway?
soobway is gr8 someone pls get the reference
131. Your bestfriend of the opposite sex likes you, what do you do?
welp, he has a girlfriend and even if that werent the case it would never work out between us, we just work better as friends
132. Who’s the last person you had a deep conversation with?
didnt i answer this too?
133. Favourite lyrics right now?
the lyrics in
blackpink - as if its the last
exid - cream
iu - palette
iu - cant love you anymore
kendrick - humble
134. Can you count to one million?
hypothetically, yes but i wont
135. Dumbest lie you ever told?
there are way too many
136. Do you sleep with your doors open or closed?
closed, im no heathen
137. How tall are you?
5′2
138. Curly or Straight hair?
i have wavy hair, but if this is talking about preferences then i dont care
139. Brunette or Blonde?
i have black hair and see above
140. Summer or Winter?
i like the spring and fall
141. Night or Day?
night
142. Favourite month?
maybe may? or october
143. Are you a vegetarian?
hell no
144. Dark, milk or white chocolate?
milk or dark, white is too sweet
145. Tea or Coffee?
tea, coffee is gross
146. Was today a good day?
eehhh the beginning of the day was better than the end
147. Mars or Snickers?
neither
148. What’s your favourite quote?
“if no one comes back in time to tell you ‘no’ how bad of an idea can it really be?”
149. Do you believe in ghosts?
yes
150. Get the closest book next to you, open it to page 42, what’s the first line on that page?
destacan los trenes de cercanías, los trenes regionales, las Grandes Líneas
lol
2 notes
·
View notes
0-44 *-*
WHY DO YOU HATE ME???
0: Height
i’m like 5′6-5′7
1: Virgin?
virgin.
2: Shoe size
depends on what kind of shoe, but I’m usually around an 8
3: Do you smoke?
I smoke weed occasionally but i don’t fuck with cigs
4: Do you drink?
occasionally
5: Do you take drugs?
nothing other than weed
6: Age you get mistaken for
21+
7: Have tattoos?
yeeeeee, i have two. a four leaf clover behind my right ear and a constellation on my left forearm
8: Want any tattoos?
i want so many tbh, i want sunflowers on one of my shoulder blades and i want a wonderwoman tattoo cause i absolutely adore her and i want to get the solar system tatted on my like on my other forearm or the back of my neck and maybe the moon’s phases around my wrist or something
9: Got any piercings?
i used too have my nose and cartilage pierced but they closed up after almost 2 years smh, now i just have two piercings on each lobe
10: Want any piercings?
i lowkey wanna get my nipples pierced???
11: Best friend?
mmmm, what about her??
12: Relationship status
single my dudes
13: Biggest turn ons
mmmmmm, marking, like biting and scratching and hickies y’know??? idk rough??? like hair pulling and spanking shit like that lmao
14: Biggest turn offs
okay like that fetish shit, like the feet and piss shit is a big no no. none of that hardcore shit and i don’t wanna see any blood
15: Favorite movie
WONDER WOMAN!!!!!! (used to be kill bill)
16: I’ll love you if
you buy me a sword, valiDATE me, give me cute nicknames/petnames, or buy me food :’)
17: Someone you miss
my grandma and my old best friend
18: Most traumatic experience
i’m not comfortable answering this one so we’re just gonna skip it, sorry my dudes
19: A fact about your personality
i’m either really quiet or really loud, there’s like no inbetween lmao
20: What I hate most about myself
i’m also not gonna answer this question, cause i feel it’s rude and i’ve been in such a great mood lately i don’t wanna go down the self hating path again
21: What I love most about myself
freckles, eyes, oooooo i kinda like my laugh now lmao
22: What I want to be when I get older
zoologist yeeeeeeeeeeeee
23: My relationship with my sibling(s)
i have a half brother and “step” brothers (my mom isn’t dating their dad anymore but she still considers them her kids and i still consider them my brothers??) and when we were younger we’d always wrestle and fight but now i barely talk to them, which is kinda sad i guess
24: My relationship with my parent(s)
is strained, i fight a lot with my mom and my father has been trying to contact me again so its just ehhhhhhhh lmao
25: My idea of a perfect date
idk??? somewhere we can be loud lmao
26: My biggest pet peeves
THE NOISES PEOPLE MAKE WHEN THEY CHEW I HATE IT SO MUCH HOLY FUCK IT’S NOT THAT HARD TO CHEW WITH YOUR MOUTH CLOSED YOU CUNTS
27: A description of the girl/boy I like
alright, this girl is absolutely amazing. like i’m enamored by her. she’s so talented??? and every time i see a picture of her i’m shook to my very s o u l. like i know i said this about gal but she’s so soft??? like all girls are soft, but she’s so fucking soft wtf, like her hair and her smile and eyes and just everything. and she’s musically talented??? voice of an angel holy fuck. and her voice??? is so soft?? and lovely??? i could listen to her talk all day everyday… i’m talking about naomi scott lmao
28: A description of the person I dislike the most
i don’t have a lot to say about her because i used to be good friends with her. like she’s actually a really good friend,,,when she’s not talking shit about your family and constantly lying pft.
29: A reason I’ve lied to a friend
because i wasn’t comfortable telling her the truth???
30: What I hate the most about work/school
getting up so early
31: What your last text message says
it’s a date *put that moon emoji right here lmao
32: What words upset me the most
idk?? words don’t really bother me??? unless it’s something shitty said by someone i actually care about
33: What words make me feel the best about myself
NO THAT ONE ASK I GOT LIKE A MONTH AGO THAT MADE ME SO HAPPY I LITERALLY CRIED OHMYGOD like i hella still think about it :’)))
34: What I find attractive in women
literally everything, like how could you pick just one thing???
35: What I find attractive in men
??? when they don’t talk lmao
36: Where I would like to live
I WANT TO LIVE IN CANADA SO BAD
37: One of my insecurities
no, i’m on a self love kick lmao
38: My childhood career choice
a zoologist my dudes
39: My favorite ice cream flavor
will forever and always be strawberry and mint oreo
40: Who wish I could be
you gotta be yourself cause everyone else is taken y’know???
41: Where I want to be right now
preferably on gal gadot’s or naomi scott’s face lmao
42: The last thing I ate
i honestly can’t remember??? like the last time i ate was early yesterday morning lmao
43: Sexiest person that comes to my mind immediately
naomi scott holy fkcu
44: A random fact about anything
there are more than 3000 rivers and 3 million lakes in alaska
3 notes
·
View notes
i should just always answer all questionnaires myself anyways January - do you rather warm or cold weather? • warm. i hate winter February - give one fact/detail about your crush •i dont really have crushes except in the sense of wanting to be friends or admiration crushes. none right now tho smh March - favorite color? •kind of azure, kind of venice blue, a very electric bright saturated greenish blue April - what religion are you? •none but i like religion a lot May - what is your eye color and hair color? •blue eyes, brown hair June - what is the best thing you’ve ever experienced? •i guess ive had good luck in getting to meet a fair number of people who i think are really cool July - what do your summers usually consist of? •the last bunch of summers have been work. once i took two 6 week multivariable calc courses. i like to swim but i havent in forever, and it makes me really glad when spring comes around and i like a lot about the concept of summer still August - what is the worst thing you’ve ever experienced? •my least favorite memories are times my mom was laying into one of my siblings September - would you rather be inside or outside? •usually inside, but i like to have windows around. a front porch October - what is your favorite movie? •i dont know! November - what is your favorite food? •i dont know! hot browns are really good. i love a fried egg on toast. ice cream though probably December - what do you want for christmas? •i dont really like christmas. a lot of money Day: 01 - what type of computer do you have? •a pretty weak hp laptop. i think the battery is dead rn. its definitely not working 02 - favorite web site? •tumblr i guess, im most invested in the stuff i do here. i check it most. those memes are good 03 - who would you consider your best friend on tumblr? •i appreciate people being mutuals and i notice people who seem to like my blog a lot in the notifications 04 - do you play a musical instrument? •i had to practice the piano for like five years but i never got that good at it. i learned the recorder in fourth grade or whatever. i technically have an accordion, i cant play it very well of course 05 - do you want to play a musical instrument or another musical instrument? •i dont know, it mightve been fun to learn a brass or string instrument. but i wanted to do the other classes we had in middle school, life sciences of home ec, art, shop, and a computer/typing class 06 - share one time that you let someone down •one time lol....on a personal level probably rarely. once i had a duo presentation in some science class and i accidentally slept through the class the day of the presentation. rip 07 - favorite overall thing (can be anything)? •birds 08 - bottled water or tap water? •tap is fine 09 - post your desktop background •my laptop doesnt work 10 - favorite blog on tumblr? •mine. its a finely curated meme collection. i look at it all the time 11 - what is your favorite letter of the alphabet? •??? pretty neutral 12 - what is one word that you love? •chronicle 13 - favorite subject in school? •i never liked school but in one english class in 8th grade it was the last period and i'd get done with whatever worksheets we had early and the teacher would let me go hang out with the librarian 14 - what do you want to be when you grow up? •dead at 33 15 - what time does your alarm clock go off? •alarms are not currently in my life 16 - are you a cat person or dog person? •both but i super like cats 17 - what is your morning routine? •sleeping 18 - sexual orientation? •gayass queer 19 - what do you look for in a significant other? •i dont do that shit 20 - what is the most expensive thing you own? •the broken laptop, but i didnt buy that. some of my shoes/jeans were about $50 21 - why did you choose your url? i saw it on a sandwich board and i thought it was funny 22 - what url would you like the most? •this one is fine, i cant ever really choose anything like that 23 - what is your favorite app? •this one, i guess 24 - favorite number? •phi and tau are good. 13 25 - what is your favorite childhood memory? •we had some fun vacations i think 26 - what is you most successful post? •probably an art joke 27 - do you like or reblog things more often? •reblog 28 - do you think mcr will come back? •no 29 - what is one food that you despise? •i dont like the texture of fat on meat, though i can tolerate it on bacon and sometimes try to force my way through it in general. weirdly i like corn but not like, removed from the cob unless its hominy 30 - mouse or trackpad? •mouse 31 - can i talk to you about jesus christ our lord and savior? •last time someone did this it was me being approached by a random man at the gym. it was a lot less disastrous than it could have been. he wanted to tell me right then that jesus loved me. im sure his intentions were fine but it was still undue stress for me and fairly entitled and inconsiderate of him in a few ways. i was annoyed but it was only like 30 seconds thanks jesus
5 notes
·
View notes
92 truths tag meme
Rules: Write 92 truths about yourself then tag 25 people
Thank you to @custompotato for tagging me! ^_^ IM SORRY GUYS I KEEP FORGETTING TO DO THESE IM SORRY IF I NEVER DID THE THINGS YOU GUYS TAGGED ME IN SMH @ SELF
LAST…
[1] drink: soup
[2] phone call: mum
[3] text message: mum
[4] song you listened to: 321 by Hedley >:”)
[5] time you cried: when i read this one really angsty fic goddang i lEGIT CRIED THE WHOLE WAY THROUGH i think this was a couple weeks back i dont really cry for non fandom related things so yeah idk the last time i cried for something related to irl stuff maybe like 5+ years ago?
HAVE YOU EVER…
[6] dated someone twice: nope
[7] been cheated on: nah
[8] kissed someone and regretted it: never kissed LMFAO
[9] lost someone special: not yet :”)
[10] been depressed: not really so i try help others instead :””00
[11] gotten drunk and thrown up: im not much into alcohol l-lol... i havent been drunk before ^^;;
LIST 3 FAVOURITE COLORS:
[12] Black
[13] Red
[14] Blue (i swear this doesnt even have anything to do with klance LMFAO)
IN THE LAST YEAR HAVE YOU…
[15] made new friends: YES OMFG I LOVE EVERYONE SO MANY VOLTRON FRIENDS ILY <333
[16] fallen out of love: never really been in love so no :”)
[17] laughed until you cried: mORE TIMES THAN I SHOULDVE TBH
[18] found out someone was talking about you: the popular crowd didnt like me much in middle school so yeah lmfao but yeah didnt really care
[19] met someone who changed you: all my friends tbh goddang they all helped me be more confident <3
[20] found out who your true friends are: there are defs friends im closer with than others
[21] kissed someone on your facebook list: LOL
GENERAL…
[22] how many of your facebook friends do you know in real life: pretty much all maybe like 5 i dont
[23] do you have any pets: not anymore :”(
[24] do you want to change your name: not really lmfao i caNT IMAGINE HAVING A DIFFERENT NAME
[25] what did you do for your last birthday: i had a cake i think nothing elee really
[26] what time did you wake up: 8:29am this morning cuz i had free period >:)
[27] what were you doing at midnight last night: doodling
[28] name something you cannot wait for: VOLTRON S3 GOTDANG also grADUATION AND THE GRAD TRIP ME N MY FRIENDS HAVE PLANNED
[29] when was the last time you saw your mother: half an hour ago maybe lol
[30] what is one thing you wish you could change about your life: wish i knew what i wanted to do or had a really clear passion i guess?
[31] what are you listening to right now: nothing much
[32] have you ever talked to a person named tom: im friends with a tom we even have the same last name LMFAO and his name is similar to my actual bros LMFAAO
[33] something that is getting on your nerves: exams :/
[34] most visited website: Tumblr and twitter probs
[35] elementary: blockhouse bay
[36] high school: lynfield college for 1.5 years then auckland international college for 3
[37] college: havent graduated from hs yet but ive received some offers from some unis and im mainly leaning toward oxford i think? idk depends on whether or not i meet the requirements :”)
[38] hair color: brown lol
[39] long or short hair: Long
[40] do you have a crush on someone: never had one oops
[41] what do you like about yourself: i like to think im relatively easy going? idk
[42] piercings: dont have any myself but characters with piercings are just yAS
[43]blood type: blood type O lol im a universal donor though ive never donated blood before :”00
[44] nickname: Jelly/Po
[45] relationship status: in a fading relationship its LDR and we’re both just really busy :””)
[46] zodiac sign: taurus
[47] pronouns: she/her but feel free to use others if that makes you feel more comfy
[48] fav tv show: vOLTRON
[49] tattoos: none but i love the aesthetic of them
[50] right or left hand: Right
FIRST…
[51] surgery: none so far thankfully
[52] piercing: none
[53] best friend: a childhood friend we’re still friends but were not as close as before
[54] sport: swimming probs lol but first competitive sport was badminton
[55] vacation: China when i was 6 lol
[56] pair of trainers: some random brand idk lol
RIGHT NOW…
[57] eating: Nothing!
[58] drinking: Nothing!
[59] i’m about to: take a shower after this
[60] listening to: Nothing, rn
[61] waiting for: dinner LOL
[62] want: to graduate LMFAO
[63] get married: not nOW LMFAO
[64] career: student lol
WHICH IS BETTER…
[65] hugs or kisses: hugs for now ^_^
[66] lips or eyes: eyes fam
[67] shorter or taller: taller cuz please i need help reaching those shelves
[68] older or younger: older idk id like to learn things from older peeps
[70] nice arms or nice stomach: arms lol
[71] sensitive or loud: can i say both because my best friend is both
[72] hook up or relationship: relationship
[73] troublemaker or hesitant: hesitant i guess? dunno
HAVE YOU EVER…
[74] kissed a stranger? Nope!
[75] drank hard liquor? nah
[76] lost glasses/contact lenses? more times than i can count jesus
[77] turned someone down: yea
[78] sex on first date? i havent even kissed before so LMFAO
[79] broken someone’s heart? maybe..? i was never quite sure if they were being serious when they asked me out
[80] had your own heart broken? nah
[81] been arrested? nop
[82] cried when someone died? CHARACTER DEATHS MAKE ME CRY OK
[83] fallen for a friend? nop
DO YOU BELIEVE IN…
[84] yourself? somewhat? i guess? i like to be realistic
[85] miracles? why not fam
[86] love at first sight? in love with their looks yep but not with personality :0
[87] Santa Claus? nop
[88] kiss on the first date? LOL
[89] angels? nah
OTHER…
[90] current best friend’s name: Apple and Angela for irl and Yuka, Oshi and Nai for internet
[91] eye color: Brown
[92] favorite movie: Coherence ^_^
I TAG: @wolfpainters @wardenalistair @wittyy-name @shavothehusky @sir-klancelot @lostangelas @hongjiseus @kawovan @animatedpretzelle @reachforthesora @oshietee @palmtreehero @meerl @onelastklance @kageyama-tobiyo @eyebagsarebetterthanhandbags @spotthetitan @bokooh @gn002 @justklance @oll1vian
14 notes
·
View notes