#d: this tiny space
Text
My Xeno-reaching brain when I see any concept anytime.
It always comes back to Xeno. (Whether I mean it to or not.)
#that castle was forged from his mind: wow... that's like a subconscious domain :D#they can appear from a normally-invisible plane and fuse with things/people: wow... that's like a gnosis :D#that's called the variable weapons system?: wow... that's like the m.w.s. :D#an elysium in space: wow........that's not saga but it's xeno so I'm still gonna say it :D#this happens more often than you think so I wanted to make an accurate image of that portion of my brain#Mew's Art#xenosaga#shion uzuki#and of course there is specifically a tiny shion in the brain
101 notes
·
View notes
Photo
Flowey has become my on-theme spacefiller and he’s so happy about it (Patreon)
#Doodles#UT#Flowey#Lol#He's a perfect spacefiller! He's tiny so he can fit anywhere but his text can also be as big or small as needed#He ends up reacting to nearby doodles in inappropriate ways which is fitting lol#Like the UGHHH one was in reaction to babybones lol ♪ They're so cute! And he is tired#Mostly he's just being silly and grumpy normal-style tho haha#He is also a great expression of my frustration with hell boxes ughhh (lol)#It's nice though since lately I've been less bothered with leaving some extra space on the page :)#He can still pop up! But just as an invitation not as a necessity#It's nicer to have a fully filled page of course haha but it's not so bad to have a little extra space here and there#And mostly to not have Worry about it to not be stressed about Having to fill a page#Still - having a little extra with a funny face hehe that I got toss into the mix and make my brain happy - it's nice! :D#Options ♪
68 notes
·
View notes
Text
traditional art from the past few weeks! ✏️
#signalis#signalis falke#signalis adler#a fancy little adler and falke#<- theyre gonna go on a fancy date :D#that one twt meme but w falkler#adlr daydreaming#bounny falklers#a very low quality concept comic on a pirate falke x mermaid adler au#(falke gets thrown overboard but shes saved from drowning by adler! yay!!!)#reactivated my goache set and colored a falkler as practice#a tiny bunny falkler to fill the space#1 more practice falkeler drawn w colored pencils and alcahol markers#<- i really wanna get into it better but idkdkkkkdkkk its hawrd……….#i still had fun tho :)#myth.sketches
29 notes
·
View notes
Text
alex doodles for a totally not two day late happy birthday to @thedeafprophet 😌
#i'm so sorry for the tiny cape catboy there was an awkward space up there FGHJFKFG#i don't know a whole lot about alex yet but i love what i've seen so far!! happy late birthday :D#technically by my timezone. i am now 3 days late bc it's past midnight. but that doesn't count#fred draws#thedeafprophet
53 notes
·
View notes
Text
🎵🎶HAAPPY BIIRTHDAY TO YOUUU!! HAAPPY BIIIRTHDAY TO YOUUUU!!! HAAPPY BIRTHDAY,, DEAR STEEEREEEENNNN!!!! HAAPPY BIIRTHDAY TO YOUUUUU!!!🎶🎵 YAAAAYYYYYAYYAYAYAYSGSISGSIFSWKVEPWGEOEVEOVDOEVEORVKRVRKWVOSG🔥🔥💥💥💥💥‼️‼️‼️‼️ /POSPOSPOS
@starsinthenigth HAPPY BIRTHDAYYY!!! 🎊🎊🎉🎉🎉 ヽ(>∀<☆)ノヽ(>∀<☆)ノhave your cowboy silly riding on a cosmo kitty out in space for their intergalactical adventures!!!
i haven't known you for long,, but in the month i've had you as a moot,,, i've come to know you as an awesome and interesting person!! you're absolutely delightful to be around and i always find myself enjoying interactions with you (≧▽≦) (≧▽≦) !! being both astronomically cool and incredibly creative,, you always have the best ideas around!!!
i hope you have the YUMMIEST of cakes and the COMFORTABLEST of blankets and many, many more awesome birthdays to come!!! HAPPY 🐝-DAY ASTRO ヽ(>∀<☆)ノヽ(>∀<☆)ノヽ(>∀<☆)ノ!!!
#i wish i put a bit of shine on the tippy tip of the cat's tail like a little angler-cat but i already finished arting for today ☆⌒(>。<)#i know you can't see the colors of the galaxy if you went out into space irl but SHHH WE CAN PRETEND FOR NOW!! /silly#happy birthday!!!#kittykitty art#feat: tiny's wagging tail :D#starry night sky!!!
14 notes
·
View notes
Text
🌸｡*ﾟ+. Life update under the cut! But in summary I've been busy but haven't forgotten the blog and will hopefully be in a better spot to focus on tumblr this next coming month! Have a lovely day everyone~!
Been working on my carrd teeny tiny bit by bit, but boy howdy does moving and all that comes with it take it out of me (preparing to move, the act of moving, and settling in) !! Good news though, I'll finally get my own room on the 31st, so I'll finally have space to set up my PC this coming September and get back to working on blog stuff! c: I've just been drained and busy and pulled so many different directions in such a small amount of time, that I'm just kinda not focused whenever I do have time to sit down and type stuff. I usually just wanna turn my brain off and games or nap.
Still gotta keep job hunting, repaint the room (it's my old room actually! And my cousin left it a downright mess... the walls are so scuffed ;; ;;), move everything in, and set everything up... and then I'll finally be able to start recouping properly! Came back from a trip to Disney with my sisters (that was fun!) and then I get to see The Fluffy on stage this coming Saturday, so the excitement is far from over for me-- not that it's a bad thing! I'm just... really eager to have a moment of... peace after all this pffft~ still looking forward to it, of course! I'm SO excited !!
I've also been sick with the plague (hurray) so I must have caught it whilst on the plane or during my time at Disney :c so my brain has been so scrambled and fried (just ask anyone who's been playing Overwatch with me this passed week LOL) Tina and Snow know firsthand.
All in all, I'm just really eager to do more than just play xbox and stare blankly at a wall all day, and instead, finally feel like myself again where I can reply to Guilded & Discord rp's, type more carrd bios, and then to also have my PC where I can make pretty graphics and get things flowing again!
Hope y'all have a lovely day! Hope to finally-- finally-- be back on here full swing soon enough!
#MUN SPEAKING 🌸 ᴬ ʷᵉᵃᵛᵉʳ ᵒᶠ ᵗᵃˡᵉˢ; ᴾᵃⁱⁿᵗᵉʳ ᵒᶠ ˢᵗᵃʳˢ#I said I would be back like. YEARS ago LMAO but damn I just. Can't get back into rp-ing without finishing my carrd.#I just can't man. I wanna get these bios done first before I do anything because the one thing I hate the most??#Is when I try to write with people and see no info whatsoever about their muse. It drives me BONKERS man!!#And I refuse to be THAT PERSON who doesn't have any info LOL it's stressful#“I'll write you a starter!” -goes to look up muse info and finds nothing- “.... -PANIC SWEATS- how do I do this--”#Me every time x'D ANYWAYS Adriel back at it again rambling in the tags lemme go hop off and#furniture hunt for my TEENY TINY room to try and min-max my space in there#for when I finally get to move into it and have some personal space to my own again :'D#Link (my cat) is also doing fine btw!! He's adjusting slowly and he's a REAL CHONKER now#I'll have to update y'all with a picture of him soon!
10 notes
·
View notes
Text
candy vision!
#art#my art#artists on tumblr#digital art#oc#pink space#this was a dooble but i went too hard on the shading so here we are lmaoo#/Herrrrr ~+~+~+~+~+~+~ <333#//color setting on layers is actually so so sick i never knew that !!#the most of the colours are just normal set on 100 tho hfbsh#/also i'm refurbishing my style Lollll#saw a sketch from like may of last year and went 'what the that looks so much better what !!!' hfhsh#/also i have GOT to use references regularly. or at least attempt to l--#//anyway gonna go listen to 'robot sounds' as my brother called them lmaooo#my mall music has three reviews so far :D#1 positive 1 hm yea okay and 1 'what are you listening to ?????' hfhs#//okay i'm being beat up by a tiny kitten i gtg hbvhsvfh#ciaaaao ov< ~+
15 notes
·
View notes
Text
🐝🐝🐝
#i feel like the all caps no spaces is necessary so you can see what my coworkers will see when i am handing them files#m#polls#bees#bugs#job hell#before you ask my personal lacie is HONEYBEE (D:) and my work one is BUMBLEBEE (D:)#and yes they both have bees painted on them#ill try and paint one on the flash drive but it is teeny tiny
6 notes
·
View notes
Note
Wait what happened on tik tok? /gen
nsfjshf it’s nothing serious it’s just some drama going around that everyone’s talking about and i luv drama so i wanted to ask ppl on here if they seen it so we could all gossip ab it
anywayyyy the gist is that there’s this rly big makeup content creator who has her own brand and everything and she stitched this smaller poc’s video of how she does her makeup and was rly condescending about how she “used too much product” even tho she dm’d the girl and was like “i love ur video and was hoping i could repost it” and the creator said yes thinking it would be a positive review from the way she worded it. ANYWAY it’s just a bit wild bc the big creator literally did this challenge where she tried this white blonde creator’s makeup technique where she like uses deadass half the bottle of foundation and she was complimenting the technique and how it was flawless on the girl etc and yea the double standard has everyone mad rightfully
#and before anyone starts#‘it’s not that deep not everything is about race’#it is tho.#poc content creators get a fraction of the opportunities and support and overall space in social media#but on top of that#they always get criticized for things white people are able to turn into their brands#that white girl’s entire brand on her page is being known as the girl that wears half a bottle of foundation and makes it work#she grew millions of followers like that#and then a lil tiny page of a poc minding her business and putting on some color corrector that’s ‘too much’ is the one she decides#needs to be criticized#W I L D#anywayssss rant over LMAO i just hate bitches that mess w sweet poc that mind their business#i will pound u
34 notes
·
View notes
Text
thought about Guz holding a baby and just about passed away. we would never have kids for a few different reasons but he WOULD be really good with babies and kids in general. and also thinking about him holding a baby makes me kind of explode into a billion shards bc that's way too cute to think about HFSDHGJKL
#is this a safe space. can i admit smth ''cringe''.#i was watching D&P's sims series and seeing Dil hold tiny baby Dab made me think about Guz holding a tiny baby SDJKL#im trying to catch up on their sims series bc i didn't watch it as a teen fdsjkl and now theyre making videos again AUGH#sometimes i feel almost guilty that i don't want kids irl or fictionally but sdfskl it simply... would not be good#i loooove kids and i love interacting w them. however i would not make a good parent and would be unable to parent well#i am good with kids! i've worked with children under 6! but i would not make a good parent for several different reasons dsjfkl#and i think maybe Guz would be a little sad about it but with t.eam skull i think he'd have plenty of kids running around the community#the grunts would grow up and have kids and i'm sure everyone would hang out together and he could experience a bit of parenting in that way#💜so good at being in trouble#dandy.cmd
4 notes
·
View notes
Text
Got distracted and I ended up working on my drawing But then I realized a major mistake on it when I thought I was done with the star veil (yes, again. I changed up the stars at the tips of it, this veil is kicking my ass) and I was erasing stuff already so when I realized I'm like: FUCK-- undo undo undo undo und o un do u n d o. And now I gotta... move All those new lil designs at the tip, Again, so I'm like: Okay... alright... I'll do that Later. I'll write now cuz god Forbid I do anything in that design, it's all mistakes!
#aria rants#that star veil has trapped ME in a time loop of perpetually fixing the thing cuz im never done with it like#this is the messiest drawing ive ever done simply by the Amount of mistakes i have on it and the entire process of it like#past aria wasnt lying about the notes she put for me when i was lazy to do the star veil DAYS AGO but she was only thinking#that: haha future me is gonna bead All those lines >:D well lil did she know is that future her aint gonna bead those lines#anymore but the veil is STILL KICKING MY ASS HARDER THAN WHEN I TRIED TO BEAD IT ALL#also the designs at the tip were supposed to just be stars. but then sirius' heart happened and i was like: i need to put morse code on it#and normally id rely on the circle ruler but i alrdy used circles for the Inner beads. i needed a different kind of circle for the tips#and then i managed to somehow??? freehand a perfectly shaped egg so ive just been duplicating layer and moving#that egg cuz aint no way i can redraw that again. the first was a fluke i didnt know was possible. and i also didnt wanna#redraw the lil dash beads i made via the ruler so ive just been keeping two layers with just one tiny drawing each#of an egg and a slanted rectangle and ngl duplicating and moving those things take up way More of my concentration#than when im just doing the lines over and over again cuz i had to keep track of which layer has which and minimize it#by merging the morse code line ive finished (like once im done for the morse code ''you'' id merge that all tgt)#so i can keep myself from exploding out of incredible confusion on which layer is which but Now i gotta redo ALL THAT#i gotta redo the other ''i love you'' morse code at the right end cuz i Forgot. to leave. a space. at the end.#like the left end has a space (star) before the egg for the first dot of ''i'' but i forgot to do that for the right end.......#theres no space (star) after the rectangle for the last part of ''u''....... i need to move All that-- maaaaaaaaaaannnn#writing it is. ill do writing for now. writing is the best. at least then i dont gotta MOVE EVERYTHING once i made a mistake--
2 notes
·
View notes
Text
man.
something midosena never prepared me for was just how comfortable the train seats are
#like. no joke. most (if not all) of them are soft!!!! carpeted!!!!! and comfy!!!!!!!!#and that’s just the regular seats!!!!! the special reserved seats are forward facing and!!!! they even have those little seat tray tables!!!#[insert home country]’s train seats are ruined for me now wtf i used to think that the wide new plastic seats were the best seats ever and—#and the structure of the train is p. great too ngl~~~~ like the seats are positioned a little ways back from the side divider thing#so there’s tons of standing space if you’re unlucky enough to not get a seat#but maybe that’s just my perspective bc the train cabins seem wider than [insert country]’s so maybe i’m too used to the cramped cabins idk#but g o d yes i understand you now midori the seat at the extreme end is the best most comfy seat ever fr#though!!!! another thing that made me 👁️👄👁️ about these trains is that!!!! eating and drinking (on trains) is not prohibited?????#like man. you’d get fined and get photographed + tabloidified in [insert country] if you did that here..#(if you get caught by some weird nitpicker who can’t mind their own business that is.)#but train exchanges are kinda complicated. ye a h. ig that’s one thing i miss about [insert country]’s trains. aside from the train fares.#m a n. train fares are so high here. bus fares too tbh. 170 yen for just two stops and all that..#but!!!! the seats are comfy so they get a pass from me~~~~~~~~~#the buses are tiny and cute thoughhhhh. but the boarding/alighting/fare system caught me off guard. ig i’m too spoiled by [insert country]#all things considered…. it was a really fun trip~~~~~ would’ve been better if i didn’t fall sick right off the bat though lmao#anyways!!!!!! happy kinyoubi my dudes~~~~~~~#inedible blubbering
8 notes
·
View notes
Text
...
#it is truly so wild to go from feeling miserable and hopeless all the time for... lets look at my excel sheet#the last 23 days. then to suddenly rocket up to smiling to myself all day. the world is so fucking beautiful#for no rational reason aside from what i have to assume is a chemical shift in my body#like is this what happy ppl feel like all the time? its truely so crazy. have i always been like this?#did i not notice this was a thing? like ive definitely noticed it in the last year but like ???#my suspicion is that it doesnt actually last long enough to b considered hypomania but like idk i should see a doctor probably lol#u would think being happy would make it easier to do things but i just keep forgetting to do them and just like spacing out lol bc rn i#feel chill. even tho i need to make a list of the shit i gotta do by Friday. bleh. but idk it makes being in thr lab so much nicer bc i#mean. i still dont give a fuck abt what im doing but im like fuck it this isnt gonna b my problem in like 2-3 months. even tho im sure ill#still have to write up everything. but idk. it also makes it easier to b like. ok so i kno what my problems r lets plan yo make things not#so horrible so u dont just live a miserable life and then like die having lived a life of fear. like its so crazy how much easier thst is#to do rn??? well see how long it lasts but yea v strange. wish i could control my fucking focus tho. like that would b great#its like the fucking painting of hypnose. my focus is like a lighthouse wildly swinging its light around until it sometimes blasts me in#the face. like not helpful. i need to b able to do things.#i guess the weird thing rn is thst while i feel happy. i also have this like simmering fear of irrational things. like when i used to live#in my parents basement and i was terrified of the dark rooms down there at night. like that kind of childish baseless fear#but like im in i tiny tiny apartment lol like bro what r u scared of??? silly silly silly#idk hopefully it holds out the whole rest of the week and then i can travel and see my parents like !!! yo !!! happy vibes :-D#that would b kinda unhinged lmao. i doubt itll last thst long. its already slipped from this morning so we shall see#unrelated
7 notes
·
View notes
Text
taking a lot of fights and winning all of them <3
#d#s#splatoon#splatoon 3#need to use my big annoying hitbox to push for space#on these tiny hallway ass maps
2 notes
·
View notes
Text
[I THINK THOSE PEOPLE BACK THERE ARE GONNA BE EXPECTING SOME PORK CHOP AND PANCAKES. HE'S GONNA DISH UP THE PORK CHOPS AND PANCAKE. AND SURE, I'D GOTTEN TIRED OF THIS TINY SPACE, BUT I'D HAD A GOOD HOME HERE AND SEE IF ANYBODY CAN STAND UP TO THAT CHOP. GREAT JOB BROTHER. THANKS, GUY.]
#s08e04 triple d goes tailgatin'#guy fieri#guyfieri#diners drive-ins and dives#some pork chop#pork chops#those people#tiny space#good home#job brother#gonna#pancakes#sure#anybody#thanks#guy.
7 notes
·
View notes
Text
ALSO:
Jeno was TINIE in Glitch Mode era :D
this 🤏 big
#jaijai squeaks#we do not talk bout tinie Jeno enough :D#he is LIL#agere#safe space#age regression#agere little#sfw agere
12 notes
·
View notes
Last Seen Blogs
petitepearl
you're my sweetheart
mbti-socrates
ENTP Enterprise
goddamnsteamboat-blog
ALKOHOL, FERNSEHEN, & NAGELLACK
thepotatofic-blog
Rian was angry
goddessfab-blog
The Goddess Fab Jewelry Design Studio