#i will get hordes of gays on my ass but i do not care | Explore Tumblr Posts and Blogs

mizunetzu · 4 years

Note

YOURE DOPE ASS SHIT HOMIE <3333 can i get uuHHHhh mutha fuckin tanaka x femboy reader ?

HAHAHA SAY LESS I NEVER EXPECTED TO GET A TANAKA REQUEST IM-

——————

Tanaka x reader - one date wonder

⚠️ warnings - reader is referred to as a girl unintentionally, by Nishinoya in the beginning. Don’t worry, I assure you this is a Male Fic. Ta-ho.

Pronouns - male, he/him

——————

If there was one thing Tanaka hated, it was pretty boys.

They were so over hyped. Just because they have a handsome face, all of a sudden they’re the talk of the town. Especially if they had a skirt on and whatnot. What happened to personality?

“Oi oi Ryu!”

Tanaka didn’t notice Nishinoya shoving a phone towards his face. He continued skimming through the Miyagi volleyball weekly magazine. “If I see one more article about that prick Oikawa I’m gonna-“

“Ryu!” Nishinoya practically slapped Tanaka’s head with his phone. Tanaka yelped.

“Hell was that for?!”

Nishinoya wordlessly held up his phone uncomfortably close to Tanaka’s face.

A girl with (h/l), boyish hair and a pretty pink skirt stood tall on Nishinoya’s small phone screen. The girl had cute (h/c) hair, framing her face as she posed with her hand flexed into a peace sign.

She was totally his type.

“Apparently she goes to our school.” Noya giddily scrolled through the girls feed, careful not to accidentally like anything as to not be caught stalking her page. Tanaka exhaled.

“Dude...if I ever see her I think I’m boutta simp.”

“Riiiight?” Nishinoya held down his phone screen to let Tanaka in on the girls social media page.

———

Walking into class the next day, he ran into a horde of girls surrounding someone in the middle of the room. There seemed to be someone in the center, awkwardly chuckling and trying to say something, but it was drowned out but the vociferous squeals or questions thrown at them. Tanaka couldn’t quite make out the person’s face.

Stalking closer, trying to subtly peek from over the heads of the girls, the person’s eyes slowly panned over to him. They locked eyes. Something seemed oddly familiar about that person. He couldn’t quite place it, though.

The person’s eyes lit up and they wadded their way out of the horde and made their way to him. Upon closer inspection, the person was handsome, and wearing the boy’s gakuran. It made sense, he was being crowded around a bunch of girls gawking at his pretty face. He immediately puffed out his chest and scowled.

“Oi oi! Got a problem, pretty boy?”

“P-pre...” The person, who he now knew was a boy, flushed and shook his head. “A-anyways! Tanaka-kun, can...”

“C-Can you meet me in the school courtyard after class!”

The boy bowed suddenly, making Tanaka falter and step back. He awkwardly coughed. “Uh-sorry man, do I know you?”

Of course he knew him. He was that one popular second year in class 2-4 that every girl was throwing their panties at. He found it weird that he wanted to talk to him out of everyone.

“My name is (L/n) (Y/n)! I’m-im in class 4 but I...don’t think we‘ve ever spoken before...”

“Then why do you wanna meet up later? Do you needa tell me sumthin’? Can’t you just tell me now?”

“No!” (Y/n) puffed out his cheeks. For such a high strung popular pretty boy, he was acting pretty fumbly and flustered. “I can’t say it here-!”

“Uh...ok...see you there...?”

“Thank you!” (Y/n) smiled, walking through the eavesdropping girls and out the door.

Tanaka wondered why he looked so familiar. Oh well, it’s probably nothing.

———

Tanaka picked at his unbuttoned school uniform, standing under a cherry tree in the school courtyard. It took him every single ounce of his body not to just up and leave.

His ears perked up at the sound of rapid footsteps approaching him. There stood this boy from before, doubled over and heaving in front of him. Tanaka shoved his hands in his pockets.

“So-what’ja need, dude?” Tanaka tried to sound as nonchalant as possible. (Y/n’s) head snapped up, and he stiffly straightened upright.

“This is for you-!” He averted his gaze as he outstretched a pristine white envelope to Tanaka with both hands, a cute little heart sticker sealing the opening flap shut. Tanaka blinked once. Twice.

Did a girl ask him to give this to him? Wait, why would this pretty boy who probably thought he was some ruffian scum randomly be giving him this love letter? Was he trying to make fun of him? Did he think that he didn’t get love confessions because he wasn’t a popular pretty boy like him?

“Oi, you tryna mock me or something? Tryna make fun of me pretending a girl wanted you to give this to me?” Tanaka puffed out his chest, tilting his chin up. (Y/n) paled.

“No! No! This-“ (Y/n’s) grip on the letter tightened, crumpling the smooth paper ever so slightly at the corners. “This i-is a real letter...f-from me to you, Tanaka-kun...!”

Tanaka blinked again. Huh? Huh?!

“I like you, Tanaka-kun! I know it’s weird because you don’t know me and I’m really popular and ‘wow why is this popular dude talking to me haha and why is he so awkward’ but I really wanted to tell you and-“

(Y/n’s) phone buzzed. He stopped in his tracks, and fished his phone out of his black school pants. Tanaka, even though he knew he shouldn’t, peeked over his head a bit, trying to see what was on his phone.

Powering it on, a picture of a girl with boyish hair and pink overall-skirt popped up on screen, holding up a peace sign near her eyes. That girl looked familiar.

Oh! That was the girl that him and Noya were fawning over the other day! Now that he thought about it, the girl and (Y/n) looked very similar. Like, very, very, similar. Same hair, same eyes, same everything...

That’s when something clicked in Tanaka’s head.

(Y/n) clicked out of his Home Screen and shot a quick text to someone on his phone. He pocketed it once more.

“A-anyways, sorry Ta-“

“Are you a crossdresser?!”

“Cr...” (Y/n) sputtered. Tanaka pointed bluntly at (Y/n), eyes widened in disbelief.

“No! No I’m not! I...why can’t I wear feminine clothes without being called a crossdresser...”

(Y/n’s) shoulders slumped over. Stagnant air surrounded them as (Y/n’s) nimble fingers dropped the letter carelessly, letting it flutter towards the ground gracefully.

‘Fuck. Fuuuuck. Me and my big mouth...’

Tanaka awkwardly cleared his throat. “I-I didn’t mean it like that! I’m sorry, man! There’s no harm in um...wearing that-! Shit, uh. How can I make it up to you?”

(Y/n) smirked. He slowly raised his head up. He held out his pointer finger.

“You can make it up to me by going out on a date with me.”

Tanaka deadpanned. Treacherous pretty boy snake. “Wh-“

(Y/n) clasped his hands together. “Please! Just one! And we don’t even have to hold hands or anything! After that it’s done! It’s just-“

“F-fine.”

(Y/n) looked up. “Really...?”

“I mean, it wasn’t cool of me to call you a crossdresser, so if it’s just one...”

“All right!”

———

The date went by like a dream. Even if Tanaka didn’t harbor much feelings for (Y/n), he still enjoyed eating free food.

Though, he couldn’t help himself from occasionally staring at (Y/n). Not because he had something on his face of anything,

But because he was wearing a a high-waisted black plaid skirt with a belt secured snuggly on his waist, with a slightly baggy baby pink sweater that looked comfortable enough to sleep in. And to top it all off, a small kitty hair clip pinning some loose strands of hair behind his ear.

He looked exactly like he did on his social media. Tanaka gulped.

Even if he was a guy, he couldn’t help but notice how his skin seemed to glow off the fabric of his sweater, or how his skirt complimented his body perfectly.

“U-uh, (L/n)-san?” Tanaka was trying to be as respectable as he could. (Y/n) stopped eating mid bite and waiting for him to go on.

“Why do you uh, pose as a girl on social media if you don’t want people thinking your a girl..? No offense, I mean? Just wonderin’, y’know.” Tanaka took a huge bite out of his food to occupy his running mouth.

“Oh.” (Y/n) pulled up his phone and booted up his profile on social media. “It says in my bio that I’m a dude. So, it’s kind of the persons fault if they mistook me as a girl, but I don’t mind if they do...! I think I look pretty...”

Tanaka flushed. Yeah, he definitely wouldn’t deny it. He was kinda cute when he tried hiding his blushing face behind his chopsticks. But he wouldn’t say it out loud. It’s like he liked him or anything, no. Definitely not!

———

Next day at school, Tanaka felt a strange sort of emptiness in his chest. It felt hollow, like he was coming off a high and dealing with the consequences. And he had no fucking clue why.

“Dude...I feel so depressed...” Tanaka slumped over a box in the club room, sighing dramatically. Nishinoya hummed while scrolling through (Y/n’s) profile, once again.

There was a sour taste in his mouth. Tanaka glared holes into Noya’s side, until Noya finally looked up from his phone.

“Dude, why’re you glaring at me-“

“Help me with my baggage I’m feelin’ depressed and I don’t know why!” Nishinoya sighed, before smiling widely and standing up with his chest out.

“Ok. Doctor Nishinoya here. What seems to be the problem, good sir.”

Tanaka snickered. It was Nishinoya’s turn to glare at him.

“So, I went on a date with this gu-, um, girl, and I only went because I promised, so now I don’t know why I’m feeling so sad.”

“Liaaar. Siiiiimp.”

“Shut up!” Tanaka barked at Nishinoya. “I’m tellin’ the truth here!”

“Well,” Tanaka gave Nishinoya a look to go on. Noya clicked a pen he found on the club room floor and adjusted his non-existent glasses. “Sounds like you caught feelings, dude.”

Tanaka sputtered. “I-I couldn’t have!”

“You totally could.”

“Could not!”

“You could”

“Not!”

“Why not, then?” Nishinoya crossed his arms.

“Because the person I went on a date with is a dude!”

Nishinoya choked on air. Tanaka covered his mouth. Noya sighed.

“Well, maybe you’re just a lil’ gay then.”

“I’M NOT!”

——

Ok, maybe he was. Just a little bit. A teeny weeny bit.

Tanaka found himself standing outside the 2-4 classroom, and he frankly didn’t know why. He didn’t know why he was so nervous too. He was really, really scared to go inside. But he wouldn’t show it.

Which is why he was leaning on the wall across from the door, with a scowl on his face and a suffocating, intimidating aura around him. Ennoshita walked out of the 2-4 classroom, before immediately being drowned in Tanaka’s scary presence.

“Jesus Christ Tanaka-kun, you scared the hell out of me!” Ennoshita rubbed his eyes. “Anyways, did you need something? Were you waiting for me or something?”

Tanaka’s face relaxed. “Uh! Actually I-I don’t know what the fuck I’m doing here, so I’m just gonna-“

“Tanaka-kun?”

Shit.

Tanaka slowly turned around. Standing in the classroom door frame was (Y/n), holding a bento and looking directly at Tanaka.

“Oh-! Sorry, sorry, please give me a second-ah-!” (Y/n) excused himself from his growing horde of female classmates, worming his way out of the classroom.

“What are you doing here?”

Tanaka’s mouth ran dry. Nishinoya’s voice rang in his ear.

‘Well, maybe you’re just a lil’ gay then.’

Fuck! Maybe he was. But fuck.

“U-uh...” A million thought went through Tanaka’s head, and went blank at the same time. It was the same feeling he gets whenever he looked at Kiyoko. The same tingly, warm, simp-y feeling.

Ennoshita looked between the two, before gasping in realization. “Oh. Oh! So-uh, I’m gonna...head to practice-Daichi said he needed me for something bye-!”

Ennoshita whispered a “Tell him.” in Tanaka’s ear as he walked by, then promptly disappeared behind a wall. Tanaka looked back at (Y/n).

“Um...h-hi...”

‘Fuck! Stop stuttering!’

Tanaka leaned against the wall, trying to seem as cool and suave as he could. (Y/n) put his hands in his pockets.

“Did’ya need something from me?”

‘Tell him. Tell him. Tell him.’

Shut up, Ennoshita! Tell him what, exactly? He didn’t know if he was even sure about his feelings or not.

“So...about our um...date a few days ago..” Tanaka also shoved his hands in his pockets.

“Ah! You’re here to tell me it was weird going out with a guy! Or that it was weird going out with a guy in a skirt! I’m-“

“No! No! Not at all!” Tanaka blurted out. (Y/n) let his mouth fall shut.

“I just...” Tanaka pursed his lips. “...Maybe we could, I dunno, go out on...another date.”

“Really?!”

Tanaka flushed and furrowed his brows. “Y-Yeah! You got a problem with that-!”

“Yeah! I mean no! I mean I’d love to go!” (Y/n) grasped onto Tanaka’s hands, squeezing them tightly. “Are you free this Friday at around 8?”

“‘Course I am!”

“It’s a date, then, Tanaka-kun.”

——————

Epilogue:

“No way your going out with her.”

“Him.” Tanaka corrected, pointing at Nishinoya’s phone. An image of (Y/n) holding up a cat he found on the street in an oversized sweater was on screen. “It’s a dude. And he’s my boyfriend.”

Nishinoya stopped walking. Tanaka raised his eyebrows.

“You’re such a liar, dude-“

“Tanaka-kun!”

A voice rang out, with growing footsteps approaching behind them. Both Tanaka and Nishinoya turned around, though with the dark moonlight it was hard to see who it was.

Someone wearing a skirt, tucked in shirt, and Karasuno jacket stopped behind the two. Tanaka smirked triumphantly what Nishinoya gawked, looking between his phone and the person.

(Y/n) smiled. “Are we still on for our date today? I know it’s kinda late...”

“Course we are, babe.” Tanaka smugly wrapped his arm around (Y/n), making sure Nishinoya saw. Noya’s mouth fell open.

“HOLY-WHAT THE FUCK! RYU, HOW’D YOU-“

“To be honest I don’t really know either.”

——————

#haikyuu tanaka #tanaka ryuunosuke #hq tanaka #tanaka x reader #tanaka x male reader #haikyuu x reader #haikyuu headcanons #haikyuu x male reader #hq x male reader #haikyu x male reader #haikyuu boys

1K notes · View notes

stop-breaking-my-heart-telltale · 3 years

Text

hi they released four pages of the Clementine comic that’s coming out and they all make my brain mad.

I can’t be the only one who was pretending that the Clementine comic was just a massive shared hallucination, right? That it wasn’t real and everything is chill? That skybound weren’t just trying to cash in on Clementine thus ruining her story and what her journey represented and meant to the fans? Yeah well, back in reality I said I would go through each page and talk about them because they bad.... they bad.

Which it’s bizarre that we got the 12 page comic of Clementine abandoning everyone because she was just soooo unhappy, and it was terrible... but then we get a mere 4 more pages for the actual upcoming graphic novel and it just gets worse. How did they do that? How is it somehow worse? I dunno!

Alright let’s go, let’s talk about ‘em.

First up, Clementine getting a new foot. Not much is shown in the environment, since it’s all blacked out. If I had to guess, I’d say she’s inside somewhere. I dunno if this is Amos giving it to her or someone else, but apparently someone just happens to have a spare lying around to give to her, someone who has made several of them in the past. Super convenient.

Really wish I could feel something reading this. Clementine getting a new foot that she can better walk on? You mean like how AJ said he’d make her a new foot and he’d ask Willy about it? And it was super sweet and you could tell that meant a lot to Clementine?

Well whoever this dingus is, they’re not AJ soooo I should care why? Moving on.

Speaking of Amos, here he is in all of his amish glory. He and Clementine are in some town, a lot of buildings and plenty of walkers. Amos is telling Clementine to quit standing around staring at the walkers like a dingus and get in his carriage thing. Uhh can’t really tell, but I think there are more people in the carriage? I can see Clem and Amos, but it looks like another body is in there but I can’t tell nor do I really care.

All I gather here is that Amos knows Clementine’s name, so they’ve been introduced at this point, and she’s willing to escape with him. Cool. Neat.

Also love that all she has to say as they’re escaping this massive horde of death is just “Ohmygod.” like.... I don’t know why that’s funny to me, there isn’t even an exclamation point, it’s all one word, and her dumb face looks like she’s cringing at how weird the dialogue is in this comic.

Oh good, the page that pisses me off.

Now I’m not the first to say it as others have gotten the vibe too but uh.... Amos is coming off like a white, blond Louis in this page. What, did Tillie happen upon Lou’s concept art and was like “heeeeey I can do a thing with that” because.... that’s not great. At all.

Also, even though he’s attempting to give Louis vibes, I still don’t think Amos is gonna be a love interest at all. I was assuming he’d be younger but he’s about the same size as Clem? and that doesn’t really mean too much as Clem is small and he might just be a tall kid, but I still stand by Tillie forcing a new girlfriend onto Clementine. I’ve read a few of Tillie’s other graphic novels, and as far as I can tell she’s only written wlw couples. Also, she said she wanted to use Clementine to show what it’s like being queer in the apocalypse because apparently that’s the only thing she took from TFS and sorry, but pairing a canon bisexual with a dude wouldn’t be gay enough for Tilllie or the apocalypse soooo.... I wouldn’t worry too much about Amos.

So Clementine calls Amos the most ridiculous person she’s ever met which.... uh, Tillie, I’m once again questioning if you even bothered to play the games because I doubt this random amish kid is the most ridiculous person she’s encountered. Just sayin.’

So Amos lost all of his stuff but it’s fine, he’s got his shirts, Clementine glares him down and then he asks her to come with him.

And she calls him an idiot.

Ugh. It’s like.... why is she being an ass? Are we in ANF right now? Is she about to shoot someone for looking at her funny? Is she gonna go off about how everyone she loved is dead or has left her even though she’s the one who straight up abandoned AJ, Louis, and the rest of Ericson so she doesn’t get to talk shit?

Oh wait, you’re right, that was different because clearly all she was to them was a bodyguard, and Clementine isn’t interested in being anyone’s bodyguard anymore.

....How? May I ask that? Just... how?

Tillie, is that how you viewed Clementine and AJ’s relationship? What, did you play TFS? Or are you just one of those people who don’t like AJ because he takes too much away from Clementine and really, when you think about it, Clem should be super bitter toward AJ for forcing her to raise him when he was just a baby and had no one else. He took away so many years from her! She should want to get away from him since y’know, fun fact, he did cut off her leg and suuuure it saved her life or whatever but now she has no leg so really he did more harm than good, no? Really, WE missed the subtext of Clementine’s growing resentment of him and Ericson for forcing her to be their personal bodyguard.

You can’t tell right now, but I’m doing the laugh.

It’s so bad.

Also, didn’t Clementine leave because she wasn’t happy? Because she sure doesn’t seem happy wandering around here by herself, she doesn’t seem happy talking with Amos, she’s just coming off like a prick. You know it’s bad when I read this page and feel bad for Amos.

Oh good, you brought Lee into this bullshit, too. Nothing is sacred anymore smh

Alright, Clementine is having nightmares about Lee. He’s got a hold of her, and then he doesn’t, and she’s about to be grabbed by all those walkers when she jolts awake.

So... she’s having dreams about Lee abandoning her to the walkers?

That’s super funny.

Especially since he never did that and Clementine was always firm in her belief that he cared about her, that he died saving her life sooo what? You feelin’ a bit of your own guilt for abandoning AJ or something, Clem? You feelin’ any happier?

Ugh, I knew Lee was gonna be a part of this comic since Tillie mentioned he would be, so it’s not like I’m surprised to see this is what she’s doing with him. I mean, if she’s not gonna get anything else right, why expect her to get Lee right?

And that’s all the pages. Just reading them again makes me tired, they make me even less excited for the full thing. Uhh as for the art style, it’s whatever, it’s a little different to Tillie’s usual style but the more I look at it, the more I believe it doesn’t lend itself well to this universe or style of story, and Clementine just looks like a dull, lifeless version of herself which I suppose is fitting as this entire comic feels passionless but y’know..... cow, milk, yadda yadda.

Anyway, what do y’all think?

#twdg #twdg clementine #blehhhh #this comic makes me feel bleehhhhh #i need some tea #sorry this comic makes me so salty i can't #hahaha

55 notes · View notes

goji-pilled · 3 years

Text

Okay @princekirijo you want an essay? Well here it is now, or as I like to call it Felix's "Asumari is great and this fandom has no fucking taste" rambling and infodump. Congrats fellas, thanks to Prince you ALL get an asumari essay. But before that I'll try to give you a rundown of Mari and Asuka.

(I'm also so sorry for putting this long ass post on everyone's dashboard)

(Spoiler warning for Evangelion 3.0+1.0 Thrice Upon a Time!!)

Alright on one hand we have Mari Illustrious Makinami. Her whole deal? She's a walking ray of sunshine, literally lol. Unlike any other character in the Evangelion franchise she doesn't suffer from her trauma, she's quite literally the only healthy and functioning human being, she's just slightly leaning towards "batshit crazy" with the stunts she pulls 🤷‍♂️. Other than that she just loves living, she loves being with people, she keeps moving forward, stays positive and decides to live life to it's fullest even after she experiences loss and multiple apocalyptic events (Second Impact, Third Impact, etc.) and she really just embodies the joy of living. That's all there is to her, or at least all we know.

On the other hand, we have Asuka Langley Shikinami who is... well it's hard to explain what she is to be honest. She's part-German and part-Japanese and part of a line of clones specifically made with the purpose to pilot an Evangelion and later on be used as a sacrifice to trigger another Impact (ITS COMPLICATED I KNOW-) Asuka is, unlike Mari, very much suffering from her trauma. She doesn't have her parents and has a very deep seated belief that she's completely alone, which she says doesn't matter as long as she can pilot the Eva. She also very much wants to fight and kill angels all by herself, and it's seriously messing with her when she can't achieve that.

Now we get to the more interesting parts (hopefully this so far wasn't too confusing, then again it's Eva and even I can't fully wrap my head around it all LMAO)

In the second Rebuild movie (Evangelion 2.0 You can (not) advance) we get introduced to both of them, Mari's introduction scene (in the original English dub) has her pilot an Eva and singing about how she'll take the world on by herself, while in the third movie's (Evangelion 3.0 You can (not) redo) opening scene she's piloting the Eva again but this time it's together with Asuka (in her own Unit 02 though) and during that Mari sings about how wonderful it is not to be alone. It's nothing big yet, but it's a really cute detail me thinks,,, you know what else I love about them? They bicker and they banter and it's genuinely so fun to listen to shskdhsuwj

(For a quick catch up: During the end of 2.0 Shinji (the protagonist) triggers another apocalyptic event, the Near Third Impact, and was only stopped due to Kaworu (the guy in my pfp) stepping in. Also between 1.0/2.0 and 3.0/3.0+1.0 are about 14 years (without Shinji bc he's like comatose) where A LOT happens AND we learn in 3.0 that Eva pilots don't age physically bc of "The curse of the Eva"... honestly Eva is wild lmao)

Okay okay I'll get back to it!

So one thing that happens is that Asuka during 2.0 develops a crush on Shinji (girl why-), unfortunately things take a turn for the worse. Asuka had volunteered to be the testpilot for a new Eva (Unit 03), she seemed happy at the time and it was a really sweet build up with the "I can smile, I didn't know I could still do that."-line. And then? Then it turns out the Ninth Angel had infected Unit 03 (Angels are basically the Kaijus they fight using Evas btw). The thing goes on a loose and Shinji is forced to fight it (With Asuka inside mind you), he refuses and his father uses an autopilot to destroy Unit 03. And boy did it destroy the angel, well it and it crushed Asuka between its jaws (you can actually hear her scream btw haha pain :)).

Asuka survived though, but the whole incident cost her her humanity and she ended up becoming an angel herself/she took the place of the Ninth. But despite that, there's one person who keeps believing in Asuka's humanity, who fiercely believes Asuka is still a human and tells her as much.

Yep, that one person is Mari and she keeps holding onto that belief until the very end when Asuka uses her last resort, which is using the power of an angel (Doing so was a guaranteed death sentence btw). Mari's own words (in the German dub) were, "Princess, you're giving up being human…" AND IT MAKES ME SO EMO GOD FUCK

While I'm at it, Mari and Asuka are a fucking killer combo as a team. They rely on each other for support in combat, listen to the other's orders and advice. Especially in Asuka's case it's kind of a big deal that she so openly relies and counts on Mari's support. Like these two trust each other with their damn lifes!!! Holy shit!!

Guess what though, they also have nicknames for eachother. Mari always calls Asuka "Princess" or "(Your) Highness" while Asuka calles Mari "Four-eyes" / "Four-eyed chrony (idk how you spell that tbh RIP" Even better though, in the German dub Asuka calls Mari "Brillerella" as in a combination of "Brille" (German for glasses) and "Cinderella",,,,Cinderella and her Prince,,,Brillerella and her Princess,,, man, that was a gay fucking move of the translation team. Spoiler: I owe them my life.

Funfact: There's exactly two times throughout the Rebuild movies where Mari uses Asuka's actual name. These two times being when she watches Asuka "die" and be used as a sacrifice for Gendo's selfish plan and when later on she begs Shinji, "So please the Princess… Asuka needs your help!" And the best part? That wasn't even the first time she did that. The mentioned line came from 3.0+1.0, but she did that too in 3.0 with the, "At least save the Princess!" line (although her tone was much more...pissed, like she was really angry lol)

Remember the crush Asuka had on Shinji? Well due to the Unit 03 incident a whole lot of other shit got mixed into that and her feelings for him in general became really bitter (understandably so). Now Mari being who she is sometimes teases Asuka about said old crush but she really does want Asuka to get closure and sort that mess out.

As an example for the teasing, in 3.0 there's a scene that goes like this (please imagine Mari with a literal :3 face while saying that):

"Unit! Are you back in the game?"

"I'm on it, your Highness. But first things first, how was our little puppy (Shinji)? Did he sit like a good little boy?"

"He's exactly the same! Same stupid face talking mayhem!"

"That goofy face of his, that's what you wanted to see? Riiiiight?"

"Shut up! I went there to bat him one!... And I feel better!"

There's also a very short bonus manga that was released in Japan for Thrice Upon a Time's release that has Mari trying to convince Asuka to come with her on the mission to get Shinji, given everything that follows, it's just another thing to prove my point. And the final bit relating to that is this:

"Feeling better now?"

"Yeah, I do feel better."

That's the exchange Asuka and Mari have after they talked to Shinji, it's nothing special but I think it's really sweet and this time Asuka actually sounded like she was feeling better instead of when she was screaming after she nearly broke pretty thick glass with her fist (If she had hit someone with that much force she definitely would've broken something omggg #violentimpulsesgang)

To get back on track though: I already mentioned it but during the second half of 3.0+1.0 Asuka "dies" (and honestly that entire scene is worth its own in-depth post because its just one huge parallel to The End of Evangelion), the point is: You can tell that the loss of Asuka honestly hits Mari hard. Not only because of how Mari screams Asuka's name but also because of her expressions. They're pained, like really fucking pained and Mari even apologizes to her that she has to fall back due to the fact that she's injured AND because eveything is going wrong.

After the events of Evangelion 3.0 these two got seperated from eachother, Mari was with WILLE (the organization both of them are with) and on board of Wunder (the ship WILLE basically operates from) while Asuka was in a Village full of (Near) Third Impact Survivors. When they do meet again it went like this:

Asuka, barely back, comes to the door and calls, "I'm back." And within seconds of Asuka stepping into their room after the door opens Mari already runs towards her, arms wide open and she says, "Welcome back, your Highness! Good job. I missed you so much!" And she says that while she literally nuzzles into Asuka,,,like,,,what the fuck gay people real!!!

Best part? Asuka clearly has enough strength to push Mari completely away if she were uncomfortable, but she doesn't. Asuka merely wanted enough space to look at the room (because Mari managed to horde even more books lol) and play her game. During their entire renunion Mari keeps hugging her, and part of me thinks that perhaps deep down Asuka actually enjoys the feeling of physical affection.

Before we get to the last point though, let me say that Asuka and Mari have scenes in 3.0+1.0 that parallel Shinji and Kaworu's from 3.0. (Fyi Kaworu loves Shinji (yeah, like that, and 3.0 was basically them being gay as fuck for an hour) so like...do I even need to explain?

And then of course there's also this, the "Take care of yourself, Princess…" line. That is the last time Mari talks to Asuka and as much as that line alone already is so much, it's Mari's expression in particular that kills me. Because this? This soft, almost bittersweet expression she has, as she basically says goodbye? Because she knows Asuka will finally be happy and safe? It just makes me feel so much actually. Man.

In the end it's a fact that Mari loved Asuka, wether that is interpreted as platonic or romantic by someone is up to them. But it is a fact that Asuka was loved enough that someone wanted to hug her, was happy to see her, to praise her, was hurt by her loss, wanted her to be safe, that someone told her "Take care of yourself…" Asuka was really and honestly so loved that someone would tell her, "I missed you."

But Asuka? Asuka was too hurt, too wrapped up in her own head to actually see how loved she was by Mari (and other people) that she genuinely believed she's completely alone and always will be alone.

It makes the "Take care of yourself" line hit even harder to me, because it's not only Mari's goodbye, but it's a goodbye during the one time Asuka allowed herself to be vulnerable and admit what she really wanted.

And honestly? All of this? Its makes me feel so many things and I just love them so much man.

#the felix talk #IM SO SORRY THIS IS SO LONG #HDMSGDMDGSJSGEH #3.0+1.0 spoilers

41 notes · View notes

popculturebuffet · 3 years

Text

Arthur: Mr. Ratburn and the Special Someone Review: Arthur and Co Try to Ruin A Teacher’s Life (Comisison by Emma Fici)

Hello all you happy people! I”m Jake, I review comics and cartoons, and we are gathered here today for the first of three weddings this month for Valentine’s Day. Two are poll winners and this one was a comission by my good friend Emma. Why.. she just wanted this valentine’s day to have some gay in it and I agree. Everything can use gay in it. That’s a fact.. sadly not a Disney fact because Disney is still struggling to accept gay characters over profit but a fact nonetheless.

As such i’m doing my second ever review of a preschool show. I thought it was the first but I forgot I reviewed two episodes of mickey and the roadster racers for my three cabs retrospective. So it’s the first preschool show i’ve reviewed that dosen’t make he feel like this

Arthur is a long running kids show that’s only ending NOW after 23 seasons, going since 1996. You watched it as a kid, I watched it as a kid, it crosses generations and gets into the blood, going from a succesful book series to almost 30 years of cartooning, even getting a spinoff at one point. I may not watch the show anymore and only watched this for the review.. but I still respect it for being a decent children’s show that teaches kids good morals without talking down to them despite being for a younger audience. So I was happy to review this one both because I geninely respect the show for staying quality with only a few slipups over 20 some years, and because I love queer represntation in children’s media. For too long it was felt “oh well being gay is an adult topic for adults” but it isn’t and while Arthur took i’ts sweet time getting there, being this long a runner and making the queer character a long standing member of the main cast no less.. that takes some guts. People are scarily protective of fictional characters on a normal day, add in querrness and you’ve summoned a horde of orcs to your doorstep screaming “Kill wokeness!”. So it was a balsy move and I appricate them for making it.

So to start us off we have the opening which is just.... pure joy. It makes me happy, it’s beauitfully animated, has only been slightly changed in the shows LONNNNG run and the song itself is just so damn sweet and catchy you can’t help but love it or sing along. It’s currently living in my head rent free since watching this review and despite not having heard it in years, the second it hit again I remembered every lyric. A true national treasure that needs to be bronzed.. once we can bronze sound. Can you bronze sound? How have we not bronzed sound?

Anyways Mr. Ratburn comes in and grills the class on their assignment to read up on lycans and liverwurst. Damn I wish I had a teacher who cared about teaching me about allterations and obscure werewolf weaknesses in third grade instead of not teaching me cursive right because she thinks me being learning disabled was an “attitude problem”. Suddenly i’m depressed for some reason.

Anyways before he can “gotcha” them with a pop quiz, he gets an important call on his cell phone about flowers baffling everybody. Like a true gentleman he apologizes while Buster wonders if flowers are on the test.

As for why it was important Mr. Ratburn is getting married! Horay! So after school the kids head down to the old school diner that lets third graders all eat there alone for narritive convience and talk over their shock. Fracinine processes it as teachers having normal lives. Buster dosen’t think so as he thinks all teachers do is eat kale and think up new homework. Which let’s be fair here IT is mr. ratburn. He probably does do that. Dosen’t mean he can’t date guys while doing that buster or find a guy who supports him doing that.

Anyways Mr. Ratburn comes in with his sister, whose played by Jane Lynch

As you can probably guess I love her. As much of a talented actress as she is a gay icon and from what I can tell an extremley nice woman. She carried Glee a lot of the time as it slowly got more and more up it’s own ass, and in general is just a delight. And it’s really no suprise Arthur would want a promitnent gay actress to be in this episode.

Patty, said Jane Lynch character, turns out to be a bit demanding about the wedding she’s helping plan. I”m not hiding it because A) the person who requested this and likely every person reading this knows Mr. Ratburn’s marrying a dude so this is a fake out and B) Even if I didn’t know he was marrying a man, Patty is a very obvious red herring, as it’s clear to any adult ears their planning a wedding. But given the target audience for Arthur is children young an old most kids wouldn’t think that unless they happen to have a relative who is one or have been around a wedding planning recently. So it’s a well played misdirect. I can only sense it because i’m old and i’ve seen this kind of WACKY MISUNDERSTANDING PLOT before.

What I haven’t seen before is what comes next. Brace yoruself. okay so first off the kids worry about him marrying someone like this, as they worry she’ll make Mr. Ratburn even more strict. Arthur, being the only one in his friend group with an active braincell since Brain and Pinky are absent this week, probably snuck off to hold hands those scamps, points out they don’t KNOW this woman and seeing some bossy actions one time dosen’t mean she’s that bad. Francine gets him to stop thinking so hard by pointing out just how bad a stricter Mr. Ratburn could be. So we get an imagination sequence where Arthur accidently missed a Comma.. and that causes Mr. Ratburn.. to turn into this

Reviews I’ve Had This Year that Somehow Involve A Hulk Count: 1

Trust me.. i’m going to need this. I just didn’t think i’d need it for Hulk Ratburn but here we are and god bless the writers for this. Thank you. You had 20 some years to do this but i’m glad you choose the gay marriage episode everyone would be watching for it so I could see it. Thank you.

Anyways here’s where the episode gets kinda nuts... yes just after Mr. Ratburn became the Immortal Ratburn, it gets crazy. So the kids decide to derail the wedding. And not for the obvious reasons of “He’ll be unhappy”.. but because they fear he’ll give them more homework. Which is a very kid thing to do, and I can get behind that.. i’ts still kinda nuts there’s an episode where just to avoid getting more homework arthur and friends.. how do I put this best...

Oh yes that’ll do. Seriously that’s most of the episode. Wacky schemes to try and ruin their teachers life.. because they think it’ll make their lives better. It only works because being third graders and not having TJ or Stan to Cordinate their plans aren’t the best. Their first is to make Mr. Ratburn look like a hippie, a look Buster not only digs but wears later to the wedding. God bless this show. And then having him read an embarassing book and add audio to it. Pam gets this is a meme of some sort and laughs. Plan B is to set him up with someone else, and gets choclates from a bakery who seem oddly helpful. But it’s a set up with the librarian.. that dosen’t work because Mr. Ratburn ducks out of the attempted setup, likely because his fiance works at the bakery and tipped him off, hence how he knows any of this, if not Pam certainly did as she knows at the wedding, and cleverly the librarian spots the spelling errors and buster also mispelled ratburns name

So they get nowhere and decide to go with the classic I Object.. not knowing that’s been removed from most cermony’s to avoid obnoxious exes or general douchebaggery because most obnoxious exes and douchebags know of the tradition. So our heroes rehearse using it since they get invited because Mr. Ratburn is a damn good man. Like this episode goes out of the way to showcase it: He gives a pop quiz but rather than just to be cruel it’s because the kids clearly didn’t do the reading and lied about it, so he’s simply trying to teach a lesson, he falls into the first breakup attempt because Arthur claims he needs to read the book for his baby sister and dosen’t bust his kids or anything after learning their scam, likely getting the misunderstanding. He dosen’t explain that to them.. but given their trying to ruin his wedding via a complex scheme he really dosen’t owe them that and plus honestly.. he seems like kind of a troll anyway. Not enough to effect their grades or anything but enough to keep them form pulling this shit when they actually are old enough to possibly effect a wedding.

Pam also gets in on it guilttripping Francine by saying thier all his children, something she did to all of them getting them to realize “holy shit we’re trying to ruin a man’s life” and they stop.. and Pam loudly admits she’s ratburns teacher just for the kids benefit. So he and his husband to be george walk down, george winks and they knew the whole time. Again the man took time out of his day to fuck with some of his students head and did so effortlessly WHILE getting ready to be married, and did it all for good reason.. and his sister helped. It’s amazing it took several decades for him to find a partner, Mr. Ratburn is a bonfied stud.

Anyways there’s a joke about teacher dancing, the kids accept the marriage and one last things noteable: One is that.. the gender of the groom never comes up. THey just casually accept a gay wedding and their teacher being gay and I think that’s neat. I like when shows don’t call attention to characters being gay. They just.. are. Loud House and Craig of the Creek have also done that to great effect and the times they have dealt into diffuclty being queer, it’s been warranted; Fear or rejection or struggles coming to terms with your sexuality. It’s not done through some aseop about bigotry, though those are also necessary they don’t need to be the only stories. Sometimes the best way to have represntation.. is to just show queerness as the normal thing it is.

Final Thoughts: This is a decent episode. While again the kids TRYING TO RUIN MR RATBURNS ENGAGMENT stuck out a bit over time I realized it’s just a bit weird and in a fun enough and harmless enough way. THey don’t know i’ts a man, their just kids trying to do something stupid that has no chance of working, like when I greased myself up with pam to try and fit under a bed. It’s just goofy harmless fun with the lesson to both not try and intefere where you don’t know the situation and that it’s perfectly normal to be gay. It’s a solid episode and a solid welcome back.

If you enjoyed this review consider joining my patreon. Just a buck a month gets you access to exclusive reviews I do every so often, and to pick one of the choices for the polls I do each month. So hop on over

RIGHT HERE

As a bonus you get a review on signup and 5 buck a month patreons get one review a month guarnateed. So sign up today!

#arthur #pbs #Arthur Reed #Nigel Ratburn #lbgtq+#valentine's day #buster #francine #a wonderful kind of day #weddings

6 notes · View notes

adultswim2021 · 3 years

Text

Ephemera Week (2002)

Mission Hill (originally aired on WB, 1999-2000)

Mission Hill was a perfectly good animated series from former Simpsons show-runners Bill Oakley and Josh Weinstein. It was a sitcom about cool young people in a cool young people city. Andy French is an aspiring cartoonist, intended to be a Matt Groening type who would (over the course of many many seasons) eventually find success and get his own super-successful animated series called THE SIMPSONS: SEASONS 1-8.

The premise of the show was that Andy’s parents retire and sell the childhood home, displacing his nerdy high-school aged younger brother Kevin. Kevin moves in with Andy and learns how to be a cool city style guy, you know, the kind that’s always “walkin here!” and sucking off Bob Balaban in the men’s room and whatnot.

The show is at least better than the bad seasons of the Simpsons, and has a cool alt-comics style that suits the show really well. Not to damn it with faint praise, it’s a good show. There are a handful of GREAT episodes and plenty of strong jokes. There's news of a revival in the works focusing on Gus and Wally, the older gay couple in the show. It's supposed to take place in the same era the show originally aired in, which is just great.

Like Baby Blues and Home Movies before it, I did catch this show randomly on it's network of origin. I saw one or two of the final episodes to air on WB. I liked it! I was glad to see it get revived for a run on Adult Swim. I've wanted more episodes ever since.

I don't think the show is available for streaming anywhere, which is too bad. It came out on DVD with special features. That DVD set was reissued on DVD-R without special features, so... buyer? be wary. There's also a number of music replacements that ruin some of the scenes. At one point I had a bootleg set where somebody took the DVD video and replaced the audio with the as-broadcast version of of the show. Good luck finding it.

Here's an episode guide showing their debuts on Adult Swim. Bold episodes were originally unaired, making their debut on the channel. Also note: episodes had an innocuous title and a spicier in-house title in parentheses. It’s real Police Squad! shit.

12AM Monday Morning:

May 20: Pilot (or The Douchebag Aspect) May 27: Andy Joins the PTA (or Great Sexpectations) June 3: Kevin's Problem (or Porno for Pyro) June 10: Andy vs. The Real World (or The Big-Ass Viacom Lawsuit) June 17: Andy and Kevin Make a Friend (or One Bang for Two Brothers) June 24: Andy Gets a Promotion (or How to Get Head in Business Without Really Trying) July 1: Kevin vs. the SAT (or Nocturnal Admissions) July 8: Unemployment Part 1 (or Brother's Big Boner) July 15: Unemployment Part 2 (or Theory of the Leisure Ass) July 22: Kevin Finds Love (or Hot for Weirdie) July 29: Stories of Hope and Forgiveness (or Day of the Jackass)

11PM Sunday Night:

August 4: Happy Birthday, Kevin (or Happy Birthday, Douchebag) August 11: Plan 9 from Mission Hill (or I Married a Gay Man from Outer Space)

ALSO NOTE: There are about five episodes that were in early-stages of production and if you poke around you can find scripts for these episodes ( here as of this writing). A full animatic and table read for “Crap Gets In Your Eyes” exists if you search for it.

MAIL BAG

London Arbuckle ASKS! or, states! sorry I’m writing this lead-in without having read the whole message yet.

Another confusing Baffler Meal thing: the deleted cold open that's on the DVD. It gets called back to in the actual episode ("Between two steamed buns", "Nine dollars!? For what?") and provides crucial context, BUT it also gets contradicted in the actual episode (SG sells out for "one serious speaker" instead of owing a restaurant money). Also I remember all the ads for this episode used a clip from the cold open! It always kinda bothered me that they cut it but boys (matt & dave) will be boys!

I do think the cold open is nice and I always make a point to watch it with the episode. In my mind they are as essential as watching that boring Terry Gilliam short before Meaning of Life. The next step is pointlessly editing them together using Nero. Yeah, that’s the ticket

Here’s ANONYMOUS, baby!

It's summertime and we are talking about Adult Swim and I gotta ask when's the last time you've been to a pool. Have you ever in your adult life enjoyed the benefits of an adult swim. Tell us just how much you like splash around. Yes, that would be quite illuminating I'm sure (rolleyes).

Man, when was the last time I went into a pool? It’s been literally years. I think the last time I swam I did a bad job. I am definitely am getting “bad job” vibes off my hazy memories. Man, my memories used to be precious. Damn!

do you think theyll ever work with george lowe again in any major capacity or do you think he's just bad news.

I was about to say “isn’t he on American Dad” based on him name-checking American Dad as one of his many credits but I just looked it up and he was only in one episode. Damn. Somebody give George work he seems nice.

beakman's world, anyone? The wild and wacky world of Paul Zaloom? Hmm? Anyone?

lol you wish...

Baby Blues really was my everything back in the early 2000s, it may not have head the punk rock cred you clearly seem to crave it was a soothing balm for myself as a new father in a scary world (9/11 and all that, terrible stuff).

you raise a good point, that you’re a huge dork “with child” and I’m cool and laughed at 9/11 because it was funny to me, actually

Just read your Baby Blues "take down" and I gotta say: In the immortal words of Mike Francesca, "You're a fool. ho-kay? A total fool."

Uh huh. Yeah okay. Mike Francesca hordes pot bellied pigs in his apartment and lives in filth. He stinks, and so do youd

Baby Blue is like every animation nerd's wet dream. What if they made the rugrats with only the parents part. And here it is. Be careful what you wish for, chunky.

Yeah and it’s too bad because judging from the previous mail bags my audience is primarily made up of BABIES.

#adult swim #mission hill #adultswim2021 #ephemera

22 notes · View notes

literaphobe · 4 years

Text

season one of she-ra rated by catradora content

the sword part 1: right off the bat we find out just what adora’s all about. she’s a so called goody two shoes but she’ll lie to authority to protect catra.... ok lesbian lmao. but then we meet catra and she’s like “hey adora ;) how’s it hanging?” and we get it. we completely get it. oh my god. everything from the way catra talks to the way she laughs. adora never stood a chance :( we get a classic locker room flirting scene where catra teases adora and adora pretends she’s above all that only to be like hey cat gf is that a MOUSE which is very rude :( don’t scare ur cat gf or she will become evil :( oh wait. anyway.... their flirting gets cut short because homophobia walks in and separates them :/ before that tho she praises adora. adora who loves her gf so much ignores shadow weaver’s praise and says “catra did so good tho <3” and puts her arm around catra which pisses off the only homophobe in etheria. adora doesn’t really want to follow shadow weaver because she just wants to be with catra, and she even argues with shadow weaver about bringing catra onto the field with her. but she loses the argument because shadow weaver fucking sucks and has no idea how to be chill :/ catra finds adora after that and greets adora the way all gals greet their pals. by... pouncing on her waist. ok lol. catra is so proud of her gf getting promoted and says baby i love you <3 baby when are we leaving <3 except adora says catra’s not allowed to come :( so cat gf gets sad and runs to the roof. in response, adora gets a literal Grappling Hook to chase after her. adora doesn’t want her gf to be sad so she steals a skiff and they go on a date <3 but they’re so obsessed with control and play fighting with each other that adora falls off the skiff and finds out she’s like. god with a sword. i mean she-ra. uh, so adora fake wakes up in a dream and is like catra? :( because catra is the only thing she ever looks for when she wakes up (yes i am clowning. of course i know catra was the only person she was with but shhhh), and then she wakes up for real and catra is straddling her waist, which... ok. catra worries about her gf maybe being brain damaged so they cut their date short and go back to the fright zone. they go to sleep, and have their nightly sleepover, which means they sleep in the same bed :) even tho catra’s own bed is already on top of adora’s :) superb :) anyway adora dreams about her lesbian sword and wakes up scared. she smiles when she sees catra sleeping soundly in her bed however because uwu cat gf go zzzzz. adora gets out of bed which catra IMMEDIATELY senses because she opens her eyes right after and follows adora. because uh.... their friendship is just that lit and strong. catra is worried and wants to follow her gf to find this cool lesbian sword she keeps talking about, but adora makes perhaps one of the worst calls ever and tells catra to stay behind because she doesn’t want to get catra in trouble :( which is like, she has good intentions and all, but you should always bring your gymnast cat gf along when u look for sick ass gay swords. adora would know that if she wasn’t raised by the literal embodiment of gay oppression. oh well. guess they’re gonna have to fight each other for five seasons to figure it out. 9.5/10 because we got so much content all literally in the first ep. it’s like hey look they’re in love and they’re girlfriends who touch each other way too much. and we’re like noelle that’s really cool! will we get more gf content? and noelle said yes but also you’ve got a big storm coming! and it’s going to kill you!

the sword part 2: against adora’s wishes, catra gets in trouble for adora’s departure, and this makes catra sad bc where did her gf go? :( shadow weaver accuses catra of knowing where adora is because despite her raging homophobia she still knows that adora wouldn’t go anywhere without telling catra. and she’s right but just because she’s right doesn’t mean i have to like her. anyway... catra gets sent to bring adora back to the fright zone, and even tho shadow weaver threatens her in scary horrid ways catra is only happy to see adora again and once again pins her to the ground with her knees on adora’s.... yea........ and she’s happy bc she has a tank :) good for u catra we all love and cherish you <3333 anyway catra makes fun of adora because she thought adora got captured which... technically true but also not but also! catra sees a flower in adora’s hair which she takes to mean that adora cheated on her :( wtf :( and adora says no baby :( no i didn’t cheat on u :( and catra is like. ok fine. let’s go back to the horde. and adora says baby we can’t go back to the horde :( did u know that they were evil? im woke now. come be woke with me. and catra is like. wait. u just realized the horde sucks? did you not see shadow weaver electrocute me. did you think she did that for gay rights? and adora is like catra baby i didn’t mean it like that :( but it’s too late. it’s all very upsetting and i don’t wanna get into it. essentially catra thinks she can escape shadow weaver’s abuse by fighting the horde from within but adora thinks she can escape shadow weaver’s abuse and the horde’s evil by literally escaping the horde. u can see where both of them are coming from and that’s why it’s so sad :( it’s so fucking sad y’all :( they do their whole. come with me vs stay with me thing,,, and it doesn’t work out. duh it’s like ep 2 why would it work out. catra finds out that adora can use her lesbian sword to turn into a taller lesbian and instead of giving into her gayness and marrying adora right away her internalized homophobia makes her run away :( she thought adora doesn’t care about her anymore because she has new friends and can turn into a giant sword lady :( and it’s all very sad :( 8.5/10

razz: adora’s having trouble turning into she-ra. no one asked, but based on this whole show, it’s because she just broke up with catra and that hit hard :( it’s pretty hard to turn into ur superhero alter ego when you’re yearning. back at the horde, catra is also yearning. she is bitter because everyone is raving about how lit she-ra is and catra is like yeah she-ra is sexy but can we have a discussion about how she-ra breaks your heart. how she-ra makes you cry. how she-ra abandons you for new friends and doesn’t want to be your gf anymore? have we considered that? and everyone is confused because why does catra seem like she knows she-ra so well. didn’t you just meet her catra? and even tho catra is a bitter ex who’s angry and wants revenge she’s still like. in love with adora and wants to protect her. so she acts cool and doesn’t tell anyone that adora is she-ra. even tho lonnie tells catra not to be so feral because “adora’s not here to protect you anymore” catra still wants to protect adora. okay. yes the thought of that does make me wanna cry. what about it. catra goes and lies on their shared adora’s bed. and she sees the teeny drawing of catra and adora on the bed frame. it reminds catra of the break up and she scratches adora’s picture. she regrets it like instantly and starts destroying the bed. and she cries. she like cries real tears what the FUCK. and then SHADOW WEAVER WALKS IN?? rude much?? can’t a girl get some privacy as she mourns a break up with a girl she’s been in love with her whole life but technically never dated for real? 9/10

flowers for she-ra: adora realizes that it’s a pretty bad idea to break up with your girlfriend when you spent your whole life sleeping in the same room/same bed as her and she comes to the Very Shocking realization that she gasp! cannot sleep without catra! wow who would have thought! so she immediately goes on a search for a sleeping partner rebound... who is glimmer (sorry glimmer it’s her first time not having her gf) and she even sleeps at glimmer’s feet the way we saw catra sleep at adora’s feet. really makes you wonder if catra and adora take turns doing that? sleeping at each other’s feet because their internalized homophobia (thanks a lot shadow bitch) prevented them from going a step further and sleeping in each other’s arms... oh well. meanwhile, catra is gloating about being force captain, but she’s also Still protecting adora’s identity as she-ra. and apparently, drawing pictures of she-ra? that she hid from shadow weaver? is that what happened? i can’t tell if she drew that picture or not but the way it looks from the scene she Definitely drew that picture! hello????? anyway, catra’s still crying to anyone that has ears about how her gf dumped her, when really it was kind of a mutual break up that was entirely shadow weaver’s fault even tho she wasn’t there. sigh. i’m bringing this up to a 7/10 because of “it’s just a phase! she’s confused, i’ll bring her back, i swear :(“

the sea gate: “i’ve got something more important to do” and here we see the start of catra literally abandoning all other duties because she would rather go flirt with her enemy gf... she literally hopped onto she-ra’s sword.... she insult her gf....... she brag to her gf about achievement.... but she also want her gf back :( adora refuses to go back to the land of oppression tho so they get into a. really suggestive fight. and catra always makes adora leaving the horde out to be adora leaving her.... she’s like babe i am literally so sexy. why would you dump me :( i’m hot :( and she’s right but i hate them. can y’all just like. not be so gay? :/ it’s starting to make me a lil bit homophobic tbh! and catra whispers into adora’s ear but it’s kind of like an insult so she gets water slapped and is forced to stop flirting :( boooo 8.5/10

system failure: hm. catra wasn’t in this ep? damn :( it’s a great ep but it��s pretty hard to find any catradora if adora is delirious the whole time and catra isn’t there. but! drunk/high adora existing gives us an idea of what she would be like around catra. 1/10 for the potential

in the shadows of mystacor: catra’s face when she sees adora in shadow weaver’s spy cam thing... interesting. she also acts like she’s So Sick of the adora missions which is true but also she is lying. kind of annoying that shadow weaver would be like. homophobic. but when she’s messing with adora’s head in mystacor she uses catra’s voice and laugh to achieve maximum effect :/ which like. thanks? but catra wasn’t actually there so shadow weaver really full on gaybaited adora huh :/ adora eventually defeats shadow weaver and we finally see catra again uwu she ends up plotting to kidnap bow and glimmer but the line “if you want to take down adora, you have to go for the heart” is so interesting because we eventually find out just how much of adora’s heart is filled with catra... 4/10 on its own 6/10 if you let the heart comment ruin your life!

princess prom: ARE Y’ALL READY TO PARTY oh my god,,, this is it you guys. this is THE ep. so funny of adora to be like. i have so many plans for every single thing that might happen. i am GOING to spend the party getting princess frosta to join the rebellion. and then catra shows up and adora is like nvm. what if i followed catra wherever she went instead. which is very interesting! adora, sweet baby, why do you always assign yourself to fight/follow/chase catra? when according to her in future eps is actually a bad decision which we can infer from her saying stuff like catra knows my every move she will be able to take me down,, ok then stop hogging her all the time?? anyway. let’s get into things chronologically. “how dare those princesses pretend they’re better than you? just because you’re different? how dare they abandon people just because they don’t fit in with their perfect little lives? how DARE they take best friends and turn them into giant sword ladies who run off with people clearly inferior to you?!” catra.... u got sth to say there buddy? :/ u got something u wanna get off your chest? :/ u had us in the beginning but then you started to get really specific :/ what’s that about sweetie :/ catra’s coping mechanism for this is to put on a really hot suit and going to princess prom to seduce the shit outta adora? fucking genius. yes she also kidnapped two people but let’s focus on the ingenuity of catra’s plan to make adora hot and heavy and also somehow jealous the entire time. incredible. so, catra shows up at the prom with scorpia and adora immediately starts bickering with her about rules. she fails to get catra kicked out so she resolves to stalk her instead! and catra... oh catra... she puts on a whole show..... performing everything from popping a tiny cake into her mouth to circling around a pillar seductively and dropping a note into a bin that says hi adora >:3 with a drawing of catra’s face that she worked hard on!! and adora looks like a crazy stalker ex gf and everyone is like damn.... u ok? :/ but adora doesn’t have time to care too much aside from a little “haha i swear i’m not a weirdo!” look because her mind is just screaming CATRA CATRA CATRA and she finds catra creeping up to entrapta. but ofc catra’s not trying to push entrapta off the ledge! no! she’s using entrapta to make adora jealous :3 catra pulls entrapta close and says “she stole my food and then asked me to spy on people with her. is this what love feels like?” and it WORKS and adora has to pull entrapta aside and be all hey i know we’re not super close yet but the bro code kinda states that u don’t date ur friend’s ex :/ so could you please back off? and entrapta is like say what now? ur gf just ditched btw so adora goes running after catra again and surprise surprise! it’s time to dance! and there are romantic lights and music! and uh oh! everyone else has a partner except for catra! guess this means adora’s gotta dance with her ohhhhh noooooooo :/ “i don’t know about you.... but i am having a blast” i really don’t think catra was lying!! i am on the verge of passing out!! adora moving away from catra after saying “whatever it is you’re planning, it won’t work!” and catra, many dance partners later, slamming back into adora’s body to continue their conversation with “maybe my plan won’t work, but then again...” THE DIP!!!!!!! “maybe it already has...” oh my god you guys. what the fuck. like they get into an angry shove fight after this but the tension! the tension! and then adora LIFTS catra up in the air? real close? they get ice blocked by frosta after this, more specifically she traps adora because she shoved catra first djfjdjdjdjd,,, after telling glimmer to find bow catra grazes adora’s chin with her tail to remind her that she’s still here!! don’t neglect!! and catra says the iconic “it was fun distracting you though ;)” line that adora was clearly affected by because she memorizes it and says it back to catra..... years later. i CANNOT make any of this shit up. what the fuck y’all. the fact that these evaluations are so long bother me but i HAVE to call these hoes out!! moving on, adora runs after catra in a very dramatic chase/fight scene, and adora is very amped up on uh, hormones. she catches catra at a “dead end” and goes “hah! trapped >:)” which is such a stupid thing to say to ur cat gf who can jump very high, so catra says “you wish ;)” and it is just. everything they are saying sounds very suggestive okay why are they LIKE THIS anyway catra jumps up some floating ice and adora follows her up the floating ice because she’s gay and she will jump however much is required of her to chase her gf down ok!! and so adora and catra are now on some ice cliff where adora keeps lunging and they’re also kind of like dancing? and catra is being very ~smooth~ dodging all of adora’s strikes and hitting her in one move. that’s kind of cool but also don’t bully your gf :( come on catra :( not cool :( but adora doesn’t give up and they continue fighting, until one missed move from catra nearly sends her off the cliff. but adora thinks she’s hot and she’s in love with her so she’s like nooo catra don’t fall off this cliff ur so sexy aha and catches her by. the waist. not the hand! but by the waist. any normal person would’ve gone for the hand. factually speaking, catra’s hand is easier to reach than her waist. but adora’s a hoe. so, she grabs catra by the waist and pulls her in closer by grabbing! oh you guessed it! her chest! like she grabs her shirt but it’s the part of the shirt that was at the chest. what the fuck. they both get this look in their eye that makes it seem like they want to kiss each other???? hello????????? and like. very upsettingly we now know that they’ve always wanted to kiss each other so. that knowledge makes watching this scene even worse. they shouldn’t have become enemies if they were going to be this horny. they’re so distracted by each other’s lips that they forget they’re standing at the edge of a cliff and guess what! they fall off the cliff! what a twist! but adora is like i’m NOT going to die because i was distracted by catra’s lips, so she grabs her hair stick thing and stabs it into the ice cliff. she grabs catra by the hand to save her, not the waist this time, because holding catra’s hand is also gay so she might as well do it. too bad catra lets go of her hand and ditches her tho :( i would minus points for that except it wouldn’t make much of a difference. catra says “see you later, princess ;)” because she’s already expecting to see adora again.... good lord 4828473737373/10 thanks noelle! i died

no princess left behind: but i’m a buddhist so i’m back. we open with catra laughing so prettily looking at her gf’s lesbian sword. very cute. later on, when shadow weaver betrays catra and tells her to go pack her things because she’s not needed anymore... adora gives her this look? :( she looks like she feels bad because catra’s clearly still suffering under shadow weaver’s thumb. but let’s zero in on the most important part! catra dragging the sword and pointing it at adora, before turning it around and giving it to her. “this is NOT because i like you” ok catra i didn’t think that before but now i Absolutely believe that you did this because you like adora. and u can tell adora kind of is like. ready to start her whole “you can come with me! we can be together! :(“ thing but things are complicated and catra told her to Just Go so... it is a lot and we know things are deeper than just catra liking adora but we will get emo over that later. 9/10 that was a good fucking scene

the beacon: “she left me behind too, like i was nothing :(“ some people say this is catra manipulating entrapta, and they are correct, but also she’s like.. “oh adora left you too? mad kin :(“ she was deadass about to start a support group with entrapta and technically she kind of did! good for them <3 catra goes to look for first ones tech and adora goes to look for the beacon to learn how to heal and guess what happens! they’re looking for the same place! catra’s “on second thought... hey adora >;)” at the end pushes this up to an 8/10, but that’s just like the last five seconds of the ep so objectively the rest of the ep was like. 4/10 idk lmaoooo

promise: finally some good fucking food. catra follows adora into the beacon and has a little fun spying on her and enjoying her epic fails at getting information on she-ra. she also finds the first one tech she needs, because she’s a multitasker and she can spy on her gf while doing important missions <3 but also she gets caught and adora nearly kills her fksjdjd “hey watch it! >:(“ is so funny because catra??? u are trespassing???? but also uwu baby yeah don’t accidentally kill ur gf adora :( adora’s reaction is also very funny “catra? what are you doing here? :O” as if catra hasn’t shown up at 70% of the places adora has been, but the way she asks it’s like. adora is happy to see catra? pleasantly surprised? man she is whipped. anyway, adora tries to pull the Tough Girlfriend move and like, mildly scold catra for trespassing into a building where only one person (she-ra) is allowed to be in. but she still grabs catra’s hand and guides her to an escape path :’) she lifts up a giant door thing and waits until catra runs in to let go and run after her <3 chivalry isn’t dead after all <3 they get into a lover’s tiff as they run for their lives and essentially it’s like “babe wtf WHY are giant mutant spiders trying to kill us isn’t this ur house” “they’re trying to kill YOU this is why you ring the doorbell instead of running in secretly after i open the door!” “oh and how was i supposed to know that! why can’t you just tell your teenage mutant ninja spiders to chill out??” “they’re not house-trained babe :( i moved in two minutes ago they came with the apartment” anyway the angry spider monsters catch up to them so catra goes “adora? :(“ and that’s enough for adora to take Direct Action so she slashes the walls and ceiling of the room they’re in before grabbing catra to shield them both. she is NOT getting her deposit back but uwu anything to keep gf safe <3 adora transforms back to her usual body and she once again reminds catra that she’s Not Supposed To Be Here and she’s like “god now i have to like Protect You and it’s gonna put my life in danger :/ haha what are you gonna do for me in return tho ;)” and catra is like. “well good thing i didn’t ASK you to protect me” so adora is like :( —> >:( wait u know what??? ok u know what????? why are u here >:( how’d u find me?? >:( and do u mean any of this in a gay way?? >:( say it’s in a gay way right now >:( and catra is like. ur gay castle sent a gay beam of light into the sky. i saw it immediately bc im gay but i do NOT mean this in a gay way. and adora is like oh :( ok :’( and then asks about shadow weaver bc she saw what went down in the horde and she like. i think she can tell shadow weaver still exerts some form of control that catra hasn’t broken free from? :( and then catra is like haha shadow weaver is a LOSER and adora starts giving her Gay Looks and it makes catra scared because her gf now thinks she has a crush on her!!!!!!! how Embarrassing!! “ugh, i knew you’d be weird about me letting you escape” ok so why did you say that thing about not liking her? “i told you it’s not because i like you!” there it is! that’s EXACTLY what i thought you’d say you lesbian! and the way she says it??? she definitely likes adora???? she is so bad at lying?????? and adora is so smug about it like her Face plus her crossed arms and the whole “i mean, i didn’t ;) i didn’t say anything ;)” her eyes.... your honor she’s gay...... she’s like what if we were in my secret castle..... standing amongst the rubble because i destroyed the infrastructure to protect you..... and we were both girls....... adora was Ready to turn her sword into a Bed right then and there ok!!! it’s not me it’s Her Eyes,,, anyway catra starts being salty again and brings up bow and glimmer and is like hey where’s those idiots u dumped me for :/ thought you looooooved hanging out with them and doing everything with them :/ like we used to :/ are they not as fun to hang out with adora is that why you’re standing in this spider infested building with me instead :/ and adora suddenly remembers that she can’t just be horny and that she has to hold catra accountable for her actions so she’s like oh my friends? the ones who u kidnapped and held for ransom???? >:( and catra is like ya what other friends would i be talking about :/ like god i know she’s evil but she’s so funny take her back adora :( jk ik ur gonna start begging her to Come With You in like minutes u absolute simp. but before that happened catra was like fuck u lets Split Up >:( we already broke up why would we run away from spiders together huh? unless u still like me? but clearly there’s only one way for them to walk so they can’t split up just yet and adora gives catra this >:( look so catra is like FINE one last date and they walk away together. they go into this... dark room and catra wants to leave the dark room because she’s scared of ghosts :( jk but the door disappears and something scans catra and adora and light hope is like cool! time to show them memories that are specifically picked to make catra resent adora! which :( not cool light hope :( i get that ur a bot who’s programmed to serve the homophobic agenda but damn u were gay once too :( anyway they’re sent to a memory in the fright zone and adora gets Angry bc she thinks catra tricked her and catra is like i wouldn’t play u like that :( and she finds out it’s all fake so she’s like adora :D u don’t have to be scared or mad at me anymore! :D she goes to look for adora but adora’s watching a memory of them when they were six and being really cute. back when adora had the moral backbone of a chocolate eclair and only really cared about making catra happy and having her back. catra blinded octavia and insulted her and adora was still like: ur not bleeding ur bones aren’t broken and u picked a pointless fight with someone who did not provoke you in any way. where is she i will insult her some more. i love u. like damn adora really do be a ride or die girl huh!! she’s still like this but they both have too many issues to realize it :( anyway catra and adora slip into the catra and adora of their memories and begin running off together holding hands............ and then they Realize they’re running off together Holding Hands....... and catra pulls away because of her internalized homophobia :( devastating. they get into a tiny little fight over magic and kidnapping again and then adora’s face softens and she’s like catra :( why Did you let me escape :( i know i made fun of u for it before but i legit do not know if u meant it in a gay way. pls confirm? :( u could have gotten caught catra :( why did u risk it :( is it because you secretly want to run away with me and join the rebellion? :( and be my gf? :( she’s so caught up in her questions that she nearly falls off a cliff AGAIN and catra catches her by the hand because these girls are obsessed with almost falling off cliffs to their deaths and saving each other. don’t judge them their Intricate Rituals are THAT deep. and catra is like. did you really think. i would let shadow weaver erase your memory like that? and risk you forgetting our relationship? even towards the end when we were broken up and fighting each other it was kinda lit and i want u to remember it. and adora is an idiot so she’s like idk lmao probably aren’t u like evil now and catra is like well you have a point but also fuck u for thinking i don’t care about u,,, u never did have too much faith in me :( and adora is like can u blame me :( and catra is like ur hot so.... no. i will let my tail linger on your hand as a hint that i still love you. and then catra is like.... adora i know u said fuck horde rights but does that include our relationship :( u had good memories right :( of me? :( and adora is like um duh??? i miss you so goddamn much too oh my god and catra is like hey how dare you imply that i missed you even tho it’s true!!! get over urself! and adora is like not until you admit you like me ;) and they play fight again because the rituals are so intricate..... and catra lies and says she doesn’t like adora ok lmao... they enter the next memory and it’s catra and adora sparring and they’re competitive but it’s also flirty? catra pretends to be hurt to get adora to let her guard down but lonnie interferes and this causes adora to beat catra. which. yeah :( and after adora wins she does the good gf thing where she asks catra if she’s okay and catra’s not ok but she lies and hides away to cry :( and we get it babe we do!! it’s hard being in love with someone who you’re also resentful of because you’re raised in a competitive environment and always treated like you’re worthless in comparison :( but the simulation stops and catra is caught by one of the spiders and adora doesn’t manage to save her in time, grabbing her hand only to fail and have catra slip through her fingers :( they scream for each other but catra manages to get the upper hand on the spider monster, except adora charges in at the last second and delivers the final blow, further driving home the false point that light hope is trying to make :( adora just wants to protect catra but because of their upbringing catra sees it as adora always wanting to be the best and adora thinking she’s better than catra hence her telling catra what to do “all the time” which isn’t totally true but it’s what catra has been led to believe :( and also adora’s upbringing plays into it too because she thinks she has to save everyone and take responsibility for everything and it’s all just really sad bros :( what the fuck :( adora apologizes for leaving again and tries to convince catra she never meant to leave her and that she wants catra to come with her because she knows catra isn’t a bad person :( and you can see!! catra considering it!! but then precisely BECAUSE catra is considering it the memory simulation thing kicks in again and... hoo boy. we see catra and adora sneak into the black garnet chamber, after being cute and competitive and running around the horde swinging from wire to wire.... they get caught by shadow weaver and she specifically punishes only catra. and it’s so fucked because it puts adora in this position of guilt where she always feels like she has to protect adora whilst slowly brainwashing her over the years into believing that catra does do disobedient things and that adora can only escape that if she’s always perfect and taking charge of everything. and for catra.... it takes the mutually loving relationship they have and poisons it because shadow weaver makes it very clear that to her, catra’s only redeeming quality is that adora favors her? and if not for that she would be disposed of? and so it’s very hard for catra to find individuality and a healthy connection to adora which created unresolved resentment and issues and just... :( and the whole confrontation they have after the simulation ends... adora could never protect catra in the way she needed to be protected because adora was also a child, and receiving a different form of abuse, and it’s just. harder for catra to leave? especially because she didn’t receive a sudden destiny the way adora did and her issues with the horde were never limited to morality. and so catra is just. she has way too much to work through and she can’t see past her resentment for adora because the machine is making her remember all of it. and so she tells a half truth and half lie to adora about giving her the sword because she didn’t want adora to come back :( catra runs away from adora and is attacked by flashes of memory. and then she faces one last memory alone. and it’s the promise adora made to catra when they were kids, about always looking out for each other, and catra looks at kid!catra and thinks adora has broken that promise, still stinging from the hurt of adora leaving her behind after finding the sword and becoming she-ra. it was never meant to be like this but catra is hurting so she focuses only on her side of things and how she saw these events play out and she :( decides to kind of betray adora? it hurts So Much because adora looks so hopeful when she sees catra while hanging on for dear life, and she thinks catra will save her again but catra talks about how the sword won’t work for her because she’s never been the Special One like adora was always heralded to be in the horde. and having adora literally be she-ra just drives that point home for catra and she hates adora for it because this means all the other stuff she believes is true too. adora made her feel weak on purpose, adora made catra think she needed her on purpose. “every hero needs a sidekick, right?” and adora’s “catra, no, that’s not how it was!” hits even harder now because we know that adora just. loved catra. she was in love with her but adora was also like catra in that she’s a product of her circumstances and upbringing. she was the way she is as a means of survival. but the one thing there that was pure and true was that they loved each other.... upsettingly neither of them can see that. catra goes down even further into the path of evil and thinks that. being free of adora. is the thing that will liberate her and bring her happiness. which. she is wrong about. but she can’t exactly see all that clearly right now :( and adora begging catra not to “do this” which... means she’s begging her not to leave? “bye adora! i really am going to miss you” and adora’s desperation skyrockets but it’s too late :( catra doesn’t come back for her and adora cries.... and it’s just so insane that literally everyone who wants to control adora focuses on poisoning her bond with catra because that’s the relationship that... matters most to her in the world. when you’ve loved someone your whole life it hurts when they betray you and it hurts to betray them too, as we can see from catra when she arrives back at the horde. she essentially looks Wrecked and freezes up when scorpia calls her “the best friend ever!” but i want to make one quick note of her “personal space” talk with scorpia? like fjdjdjdjd you have never had personal space with adora not once in your life ok that’s reserved for the gf only i see. 10/10 i am so wrecked emotionally this is way too much but also because it makes me so emo i will give it a perfect score but nothing else. no bonus points because i do not want to reward putting me in pain!

light hope: light hope showing adora the memories that make her feel guilty and it’s the first scene where catra sees her as she-ra and walks away.... adora’s been feeling guilty over catra since the moment she failed at getting catra to leave the horde :( 3/10

the battle of bright moon: “catra will be leading the horde when they attack. i have to face her.” it’s so interesting how there’s so many pressing things at hand? the weather is screwy, the alliance is broken, no one’s coming to save them, the rebellion could be crushed, but the thing that is really bothering adora, the thing that she brings up first, is catra. “i saw catra in there. i thought i could get through to her, but all i did was push her farther to the side of evil” she sounds... so heartbroken about it all :( catra and adora meet on the battlefield and the first thing catra says is,,, u guessed it,,,, “hey adora.” and adora’s like “catra. surprised to see me?” and like damn they’re really so good at being enemies. the talent. the tension. impeccable. and then catra says nah i didn’t think u died and im glad u made it out alive. and adora, bless her soul, is like oh.... u mean in a gay way..... u didn’t want me to die..... for homosexual reasons?? and catra is like no! haha! i uh, i just wanted to kill u in a cooler much sexier way. and adora is like oh :( oh >:( oh >:’( and they get into a very heated sexy fight like catra wanted. and they taunt each other like. “i thOUgHt yOU weRe suPposED tO bE stRoNG” “aND i tHouGHt yOu wERe sUpPOsEd tO bE fAst” you know. very cool well crafted taunts. and like. they fight a lot which is kind of sad but also kind of sexy because their styles are like? similar and different? which is the dumbest way to compare any two things ever but like :( y’all get what i mean right :( we get one more Hanging Off A Cliff scene and this time adora grabs catra by the chest and shoves her against the wall, and catra is like cool! but u did this,, for what? and then adora realizes catra was just distracting her Again and bright moon is very badly under attack :( catra bids her adieu so adora can run back and fight. but she like. gets caught :( and catra walks up to her and gently caresses her cheek before adora passes out and it’s evil but it’s also tender? but it’s also evil i know i know :( all of the princesses come to help adora so she sends a beam of magic gay light and heals everything and then all the princesses send a gay tsunami washing over catra. the horde loses, and catra retreats in a skiff, but adora and catra exchange one more Look as she leaves... hm. 9/10

#text #she ra #catradora #spop #this post... is so stupidly long #its essentially like a recap shitpost #but i give it a score out of 10 #i considered redoing the whole post but :(#it is what it is:(#hope y'all like this #please at least find this mildly entertaining #i hope to god the read more thing doesn't break #because...... this is long apologies in advance #hope its not too hard to read

324 notes · View notes

daxieoclock · 3 years

Text

Okay let’s do this. TW for scientific dehumanization

This is Vee, my Final Fantasy 7 OC (primarily with the remake in mind, though the meta aspects of that story don’t play a part here). Formerly from a small village whose inhabitants were captured and experimented on by Shinra, she possesses minor draconic abilities and an affinity with fire Materia as a result of those experiments. She only escaped the labs at all by accidentally faking her death – going into cardiac shock during an experiment and then surviving their attempt to dispose of her body through incineration, due to her newfound immunity to flame. Vee was then nursed back to health in a small religious collective centered around worship of the Ancients, and spent a few years there until she had recovered enough to leave. While she isn’t quite an amnesiac, the trauma from those labs has fucked significantly with her memories and self of self.

Personality-wise, Vee is brash and self-assured, displaying both an abundance of confidence and a general sense of polite ease. She’s a hopeless flirt, but drops that behavior immediately around her elders and anyone who shows discomfort in being flirted with. While she jumps at the chance to make a show, she also shies away from attention outside of her control, hiding her fiend eyes behind sunglasses and keeping her wings dismissed. That overly casual persona also helps hide a deep insatiable fury towards Shinra, SOLDIERs and especially that snickering scientist bastard, whose throat she would personally like to tear out for everything he’s done to her and her family.

In combat, she keeps at least one hand in her pocket at all times, and fights with close-range fire magic and a flame sword she can summon and dismiss at will.

AU summary (including Gay Details) under cut.

EDIT: I’ve made a few minor edits and added events up until a little ways past the departure from Midgar.

EDIT 2: I made this into a fic.

Initial

A large aspect of the “Vee AU,” so to speak, is the change of timescale: stretching out the events of the plot over the span of a couple months rather than a couple weeks, with multiple periods of reprieve between urgent setpieces. Other than that, the first big change comes after Cloud’s meeting with Aerith, in that he makes it back to Seventh Heaven without being pulled into the Wall Market nonsense – Aerith tagging along the whole time. Aerith meets Tifa and decides to stick around for a bit, Cloud slips back into his friendly neighborhood merc gig, and Avalanche stresses in the background about their next move.

It’s during this point that Cloud investigates a commotion nearby Sector 7 only to find the cause to be a bloodied Vee standing amidst a bunch of ko’d Shinra soldiers. When she notices Cloud’s mako eyes, she attacks him – SOLDIERS were the people who took her to the labs – before half-collapsing from her injuries. Cloud heals her, and makes the ‘ex’ part of ex-SOLDIER very clear, as well as his open contempt for Shinra. Vee apologizes for losing control, thanks them, and decides to stick around to help out – since they have a common enemy, and she wants to pay back Cloud for saving her life after she almost murdered him. Vee Joins The Party.

A few days later, we enter the leadup to Wall Market. Desperate for details and noticing a surge of Shinra activity in and around Sector 7, the gang decides to try and get info from the one man who might know anything: Don Corneo. Unfortunately, he’s an asshole, so they’re going to have to threaten him for it. While Barret and the rest of Avalanche stay behind to keep Shinra from trying anything, Aerith, Tifa, Cloud and Vee head to Wall Market. On the way there, Tifa and Vee get separated from the others when part of the collapsed highway collapses further, and they spend some time getting to know each other while Aerith takes Cloud on a more direct route.

Tifa and Vee smooch after roughly a day of romantic tension. No further relationship is established at this time.

In Wall Market, the gang splits up into two teams to try and pincer Corneo’s security. Vee and Aerith hit up the tournament under Madame M’s supervision, passing themselves off as a Shinra rep and her Turk bodyguard to get an invite through the front door, while Cloud and Tifa go through Andrea Rhodea to try and weasel their way into Corneo’s audition for his next wife.

Aerith and Vee smooch after kicking ass in the tourney. No further relationship is established at this time.

Corneo’s security is dispatched from two angles, and the gang rushes back towards Sector 7 after hearing the info about Shinra’s now ongoing plan to collapse the plate. They get there, and fight their way up to Barret and the other Avalanche crew, managing to minimize the damage from the plate’s fall by locking the center supports in place, but they cannot fully prevent the collapse. While the majority of Sector 7 remains livable, the outskirts are devastated. (Aerith is not approached by Tseng at this point. Jessie, Biggs and Wedge survive.)

There’s a terse, tense celebration in Seventh Heaven. A lot of lives were saved, but not all of them, and there’s still the financial cost to the already destitute slums – not to mention that Shinra will likely try to take credit for the collapse’s partial prevention, and pin the collapse itself on Avalanche. This isn’t even close to the end of hardship. Regardless, it is a victory.

Over the next few days, the gang recovers and focuses on helping Sector 7 rebuild. Tifa tries to push Aerith and Vee together, seeing herself as an obstacle between them. Aerith confronts Tifa about this, they discuss their feelings and reservations.

Aerith and Tifa smooch. At this time, we establish a relationship between Aerith, Tifa and Vee. Many more smoochings occur.

Saving Aerith

One morning, the gang wake up to find Aerith missing. Tifa, Vee, Cloud and Barret go to her house to look for her, and Elmyra tells them she visited late last night to say she wouldn’t be coming back home for a while. Elmyra realizes something is wrong, and tells the gang that Aerith is a descendant of the Ancients, and her birth mother was captured by Shinra. Vee and Cloud are especially tense when she says she suspects Shinra’s head scientist of being involved in Aerith’s disappearance. When the party returns to Sector 7, Wedge shares a message from Avalanche HQ: the Turks brought someone matching Aerith’s description into Shinra headquarters last night.

After tangoing with Corneo and Leslie in the sewers, the gang fights their way to the Shinra Building. On the elevator up, Vee and Barret have a bit of an ideological clash. Vee makes it clear she doesn’t care about the suffering of Shinra Employees, their paychecks are soaked through with the blood of Shinra’s victims, and their complicity is guilt enough. Barret fires back that while they’re taking the easy road out, there are fewer and fewer non-Shinra jobs out there every day, and some employees have more than their own mouth to feed. Not everyone can afford to make the sacrifices he did, and while they don’t have to be buddy-buddy with Shinra’s suckers, the company would fall apart without them. Draw them over to Avalanche’s side, and Shinra wouldn’t last a day.

Mayor Domino helps the gang get into Shinra R&D, and they’re forced to fight a whole floor full of mutant experiments to get to where Aerith is kept. When they reach her, she’s contained in a glass cylinder, overlooked by Hojo in an isolated observation room. Vee immediately lunges at the reinforced glass between her and the scientist. She asks if Hojo recognizes her, and he expresses delight that she managed to survive. Vee tries to break the glass but hesitates when more experiments attack Tifa, Barret and Cloud. She does issue one last threat to Hojo: she’s going to walk out of here with Aerith, and then she’s going to track him down, so he’d better start running. Next time they meet, she’ll make him hurt in every way he hurt her, and she’ll enjoy it. Vee punches the glass hard enough to crack it, and she gets one good look at Hojo’s surprised – maybe frightened – face before metal shutters close off the observation room completely.

After being freed and embracing both of her girlfriends, Aerith explains that she was captured voluntarily – half to keep Avalanche from being targeted by Shinra, and half to find out the truth. She takes them down a floor to a place she identifies as her mother’s room, and her own. Aerith spent most of her childhood here, and her mother managed to escape with her just long enough to hide her with Elmyra before being captured again. Aerith returned because she thought her mother might still be alive, but apparently the woman didn’t survive more than a year after being recaptured. Vee reminds Aerith that she’s still alive, and she has a life outside these walls now, with people who love her. Tifa simply asks her to promise not to leave like that again, and Aerith gladly does so. She doesn’t plan on chasing ghosts, not anymore. She knows where her home is.

The reforged quintet meets with Red XIII, who Vee immediately takes a one-sided liking to, trying to befriend the more tempermental catdog. They head farther into the labs to both chase Hojo and make it to the roof for extraction, and find Jenova. Sephiroth appears, sending Tifa into shock and Cloud into blind fury, and the latter charges at the specter – who severs the bridge and sends them plummenting into the depths of the labs. Cloud is seperated from the others for a time, and fights alone and half-berserk through a small horde of experiments, nearly attacking Barret when he runs into him. Barret and Red manage to calm him down, and they fight up the Drum to Tifa, Vee and Aerith, then back up to the elevator.

The gang follows Jenova-infected footsteps to President Shinra’s office to find the bigwig himself danging off the side of his big fancy tower. Vee immediately hops over the railing and extends a hand to pull him up, but digs her nails into his arm and keeps on holding him over the edge. It’s his fault. Everything that happened to Aerith, to Vee herself. Guilt travels upwards, and there’s no one higher than Shinra. Killing him won’t bring back Aerith’s mother, or the people killed by the plate, or Vee’s family. It won’t take away what happened to her. But it’ll make her feel a whole lot better. Vee is ready to drop him, but Barret talks her down, convinces her that Shinra is more use clearing their names and owning up to dropping the plate. With him as a hostage, they can bring the company to its knees. Vee relents, and pulls Shinra to safety, only for Sephiroth to stab him through the chest.

Cloud barely holds it together, and Sephiroth taunts him, trying to egg him on. Doesn’t Cloud want to hurt him? Doesn’t he want to take revenge, for his family, for his home? For his companion? Cloud is a breath away from trying to take his head off, but it’s Tifa who strikes first, forcing Sephiroth back with a roundhouse kick. She tells him to leave her friend alone, and the rest of the gang backs her up. That manages to shake Cloud out of his fury, and he stands by his friends as they take on the legendary SOLDIER hero.

And lose. They’re barely a match for him, their attacks don’t phase him in the slightest, and he seems impossibly fast. With one final mockery, Sephiroth takes Jenova’s body and dives off the side of the Shinra building, leaving Cloud almost numb, hollow. Tifa manages to pull him out of it, and he doesn’t understand how she’s still herself aftering seeing him. She shows that her hands are still shaking, and admits she’s not letting it catch up with her. Right now, she’s focused on trying to stay alive, and keep the people she cares about alive. Our six rebels fight their way back through Shinra security and, with one look back at the home they’re leaving behind, they steal a ride out of Midgar.

Once they make it to the inn in Kalm, Cloud finally fills everyone in on what he hasn’t told them. He’d only meant to tell Tifa, originally, but the others deserve the truth as well. With her permission, he recalls the Nibelheim Incident. After Sephiroth killed his hometown and injured Tifa, Cloud attacked the man, overpowering him and throwing him to his death – or he assumed, at least. Another Nibelhiem resident, Zangan, took Tifa to safety, promising to come back for Cloud. He didn’t make it, and Cloud was captured and experimented on by Hojo; toughing through thanks to the mako infusions he got as a SOLDIER. After five years, he managed to escape, and make it to Midgar. The others are horrified, but Cloud almost no-sells it. It’s in the past. It’s fine. He’s fine. And with that, and without taking any questions, he goes to his room and sleeps.

Tifa admits once he’s gone that there’s something odd about the story, about the way he told it. She can’t quite pick out what, but it feels as if he’s leaving out something big from the parts that she can’t corraberate. Barret and Red agree, they felt similarly, but Vee reminds them that traumatic events like that can fuck with a person’s head, muddle their memories. And she knows firsthand how traumatic Shinra’s labs can get. The five agree not to push him on it, and follow suit to get some sleep.

When she’s finally alone with Aerith and Vee, Tifa breaks down completely as the events of the day wash over her. The man who scarred her, who slaughtered her family, who burnt down her home, is alive. Her best friend has years of trauma he’s never told her about. And she almost lost her girlfriend. Vee and Aerith hold her, and the three fall asleep together. For now, they’re safe.

#ask to tag #red gaia au #vee #okay to reblog????#im very nervous haha #i want to share vee but also Aww Jeez What If My Oc Is Bad Actually

17 notes · View notes

catra-goddess-of-lesbians · 4 years

Text

(SPOILERS) Out of context She-Ra season 5 reactions

I wrote as I was watching, it helps me cope 😂

• CATRA HISSES WHEN SHE'S STARTLED I LOVE IT SM

• "We'd stay up all night whispering about... y'know, whatever." SHE BLUSHED, WAS CATRADORA A THING IN THE PAST

• REDEMPTION ARC YEEEEEEEEEESSSSSSSSSSSSHDKAKVKSKGKSKGKEJDKXDKJDDKJDJD

• "I'll never say sorry to anyone!"

"Adora! I'm sorry!"

CATCH ME SOBBING

• CATRA DOES THIS BEAUTIFUL THING WHERE SHE DOESN'T DIE AND IM LOVING IT

• KYLE HAS A CRUSH ON ROGELIO SJKCKWKCKDKDKVKFKDKGKEKFKVKMEKDKKFJKF AAAAAAAAAHHHHH BBYS

• Glimmer has PTS from being held captive and I'm honestly glad because a lot of shows and stuff usually just have the character brush it off and I like that it showed her distress about it.

• CATRA NOOOOO

• WHEN I SAID I WANTED SHORT HAIR CATRA THIS ISN'T WHAT I MEANT

• I feel like Catra touching the back of Adora's neck was her crying for help and giving Adora a hint on how to free her.

• DID CATRA JUST BREAK HER FUJUCKING BONES

• ADORA CATCHING HER AND HUGGING HER

THAT IS ALL

• ADORA PLEASE NOTICE THE FUCKING CHIP ON THE BACK OF HER NECK P L E A S E

• "Kisskisskisskisskisskiss-- fUCK"

- me for the 184828184th time this season

• "Promise?"

wHY

• DID SHE JUST

CATRA PLEASE DO THAT BEAUTIFUL THING AGAIN

PLEASE

I BEG OF YOU

• SHE-RAAAAAAAAAAAAAAAAAAAAAAAAAAAA--

• SHE FUCLING RAPUNZELED CATRA AND I LOVE IT

NOW KISS

• "Hey, Adora."

MY GAY ASS IS SOBBING

• That Catradora hug is what's gonna get me through quarantine.

• Remember what I said about giving characters realistic PTS. That.

• CATRA PLEASE STOP ACTING TOUGH FOR ONE SECOND

• WOW ADORA, JUST FLIP HER LIKE THAT

IM NOT SAYING SHE DIDN'T DESERVE IT

BUT W O W 😂

• Catra has the lil stripes on her back and it's so cute--

• Catra is more self-deprecating than me and my friends combined oop--

• Frosta, give Micah a break, he misses Glimmer and wants to feel like a dad again--

• Okay, Catra and Adora definitely in a relationship in the past. Like, the way Catra held her hand, and how Adora blushed, you can't tell me they weren't canon while Adora was still in the Horde.

• Catra blushing when she sees She-Ra 2.0 is a big mood

• THEY ACCEPTED CATRA WITH OPEN ARMS I'M SO HAPPY

• sPINNERELLA N O

• CATRA LOOKS HOT WITH A PIXIE CUT AND HER NORMAL CLOTHES WTF

ALSO HER JUMPING INTO ADORA'S LAP IS A MOOD

• THE NEW INTRO IS SO SWEET OMFG

WITH THEM SMILING INSTEAD OF FIGHTING

• IM GETTING DOUBLE TROUBLE VIBES NOOOOO

• Anyone else think Peekablue is Double Trouble? No? Just me? Okay--

• MERMISTA AND SEAHAWK

THAT IS ALL

• HOW CAN CATRA SAY SCORPIA IS BAD AT SINGING THIS IS BADASS

• SCORPIA X PERFUMA? IS THIS SMTH WE'RE LOOKING AT?? BECAUSE I'M FINE WITH THAT

• Okay Peekablue is DEFINITELY Double Trouble--

WHO WAS RIGHT? HAHAAAAA

• NETOSSA NOOOOOOOO

• MERMISTA NOOOOOOOOOOO

THIS HURTS

• IM NOT EVEN GONNA MENTION NAMES SPECIFICALLY ANYMORE JUST KNOW EVERY TIME A NEW PERSON GETS CHIPPED IM CRYING INSIDE

• DT is so overdramatic and honestly I'm living for it

THEY CALLED SEAHAWK "HOT STUFF" IM DEAD

• Scorpia I love you and you deserve better

• So did Netossa

• THEY UPDATE THE INTRO TO SHOW EVERYONE THAT'S BEEN CHIPPED

THANKS I HATE IT

• CATRA'S SPACE SUIT HAS COMPARTMENTS FOR HER EARS

THAT IS ALL

bOW AGREES

• BOW AND GLIMMER KNOW WHAT'S UP WITH CATRADORA

OR AT LEAST THEY'RE STARTING TO

• THEY WARMED UP TO CATRA AND ARE JOKING WITH HER AND AKJCNWKCKEKSF THIS IS WHAT I WANTED SINCE SEASON ONEEEEEEEE

• BOW COOING OVER CATRA IS MY MOOD 24/7

• YOU MEAN TO TELL ME CATRA'S CUTE ASS SNEEZE HELPED HER WTF

• I WANT A MELOG PLUSHIE

• NE TOS SAAAAA

• tHEY'RE MARRIED AWWWWW

WAIT NO THAT MEANS IT HURTS NETOSSA MORE NO

THIS IS NOT HOW I WANTED TO LEARN THEY WERE MARRIED

• Glimmer picking up Frosta and spinning her gives me life.

• FROSTA PUNCHED CATRA INTO THE NEXT MILLENNIA

• NETOSSA REALLY PULLED THE SPRAY BOTTLE ON CATRA IM DEAD

• SCORPIA REALLY YEETED CATRA

• But wouldn't Scorpia and Mermista be a bad combination? Like, electricity and water? Scorpia would use her power and electrocute Mermista's chip off.

• "WE DON'T THROW TANKS AT OUR FRIENDS."

• Perfuma really called Catra out on her abandonment issues like that 😂

I'm not saying she's wrong but w o w

• WHY DO THEY HAVE AN EPISODE CALLED FAILSAFE, MY YOUNG JUSTICE HEART IS SCARED

• Why would Shadow Weaver try touching Catra knowing how she emotionally manipulated her her wHOLE FUCKING LIFE?

• Catra jumping into a ring of fire to save Adora is what is keeping me from passing out after pulling an all-nighter to watch this.

"Did you just jump into fire for me? 😏"

• "Catra confuses you." AND YOU DON'T?

• Oop Catra heard--

• "What do you want Adora?" SHE WANTS YOU FOR CRYING OUT LOUD

• BOW X GLIMMER BOW X GLIMMER BOW X GLIMMER

• SPINNERELLA AND NETOSSA ARE KISSING IN THE THEME PICTURE IN THE HEART PART 1 AND IM LIVING FOR IT

• Melog do be calling Catra out on her bullshit tho

• "Adora doesn't want me! Not like I want her." CATRADORAAAAAAAAAAAAAA

AT LEAST ONE-SIDED

BUT ADORA IS DUMB OF ASS SO IT'LL PROLLY STAY THAT WAY TBH

• KISSKISSKISSKISSKISSKISSKISS-- FUCK

• CATRA AND GLIMMER? SORRY, I ONLY KNOW HORDE SCUM AND SPARKLES

• "Bow... I love you."

THE NOISE I MADE WAS NOT HUMAN

• THAT FOREHEAD KISS WAS E V E R Y T H I N G

• Mara said Adora is so close to love. C A T R A?

• GLIMMER COMIN IN HOT AND KICKING ASS AS PER USUAL

• Seahawk and Mermista's relationship is so cute and so dumb and so underrated

• Adora gives me Shiro vibes when she's sitting against the stone with a hand on her wound. Then again, this whole season has been giving me Voltron vibes so 🤷‍♂️

• CATRA I ADORE YOU

• Wha?? There's really??? A part in Shadow Weaver?? That?? Cares about Catra??

• I honestly think the only people that are sad she died are Adora and Catra 🤷‍♂️

• dOUBLE TROUBLE

• If Adora dies I swear--

• Omfg I don't know what that outfit is but it's pretty--

WAIT

IS THIS HER AND CATRA'S WEDDING???

Okay it's Scorpia's ball but it's definitely Catradora and their outfits are pretty

Also I didn't know I needed ponytail Catra until now

• "I LOVE YOU" KEKGKDKGKELFKFMFMRKSKFJGJWGJDKDCKFKF

THAT IS ALL

• "You love me?"

KFKALXKFKAKVKWKVKSKCKAMBKAKVKDKFK THAT'S THE CUTEST THING EVER OMFG

• KISSKISSKISSKISSKISSKISSKISS--

YEEEEEEEEEEEEEEEESKGJSJVKDKFKESKKFFKKVKRFKGKEKF

• Best true love's kiss? Snow White? No. Princess and the Frog? No. Catradora.

• In this house, we stan big ass space tree.

• "Hello. I'm your dad."

That is all. 😂

• BOW AND GLIMMER ARE THE CAPTAINS OF CATRADORA CHANGE MY MIND

#she ra catra #she ra mermista #shera #she ra netflix #shera spoilers #she ra spoilers #spop spoilers #catradora #reaction #out of context #she ra season 5 #she ra season five #shera season 5 #shera season five #she ra season 5 spoilers #shera season 5 spoilers #she ra season five spoilers #shera season five spoilers

151 notes · View notes

docholligay · 4 years

Text

She-Ra Thoughts

I hate that I always have to have these fucking monologues before every thought I give on anything ever, but here we go: I am allowed to have my own thoughts and feelings, and you are allowed to disagree with them or feel differently. This is totally fine! Does not bother me! So really there’s no need to hound me and try to get me to come around to your side because A) I don’t care and B) This is a children’s cartoon about a magic space princess, and let’s all live in that space honestly, okay?

I HAVE ONLY SEEN UP TO S5 E10. PLEASE DO NOT SPOIL ME FOR THE LAST THREE EPISODES WE’RE WATCHING THEM NEXT SUNDAY

If you click below the cut you agree to these terms and conditions

I utterly loathe brainwashing as a trope, so this storyline was never going to work for me. I’m not sure I think a children’s program HAS a way of making it work for me, because while anything is possible with writing, the nuance that would be needed to make it work is unlikely to come up in something written for 8010 year olds. So yeah, I hate the brainwashing thing, and it comes off as as such a cheap ~we’re fighting our friends~ thing for me.

I do appreciate they have Catra say that bit about “it never bothered you before” to Adora about fighting her friends, because she’s right! If anything, this should be LESS of a conflict for her because she’s not even fighting her friends,really, she’s fighting the horde in her friends bodies.

The Catra thing is SO RUSHED. I could get down with a redemption arc, and literally always expected it, but we’re being expected in VERY quick order to be like “Catra’s part of the best friends sqiad!” and the way they’re forcing it is making me buck up against it and refuse Catra’s whole thing in a way I don’t think i would if we were given some good time where she’s mistrusted and disliked. I feel like Glimmer was punished FAR MORE for far less by the show, and it really frustrates me.

Wrong Hordak is amazing.

I could REALLY love the Spinerella/Netossa thing if they had spent any time at all in the show letting us get to know them and their relationship, but I feel they were thrown in often as “the canon gay couple” and i don’t...know anything about them? it has the bones of being great but lacked setup in a way that made it emotionally resonant.

I think the most fucking interesting character for me in this whole thing is Shadow Weaver. The way you’re never quite sure which side she’s on or if she even knows herself, the way she longs for power above all else but knows this, and sees herself as both assistance and threat? She’s fucking fascinating to me, far more nuanced than I would have expected at the beginning of the show.

I knew they would never kill Scorpia despite the whole noble sacrifice bit they had in the last episodes, but I still was a little bit disappointed.

The idea that you’ll have to destroy the magic of Etheria to save it is really really tempting to me, and I’m wondering/hoping how far they’ll go with that.

In my COPIOUS ASS FREE TIME I may rewatch the whole 5th season sometimes, to see if I was disappointed because it wasn’t what I wanted or if it really is as rough and patchy as it feels.

#Because I know some of you are curious on me going through this

23 notes · View notes

jadedragoness · 4 years

Text

Review: Peace Talks

First Read Through Reaction

Now staring off, knowing that the book was essentially part one of two did mean that I went in expecting that there would be plot lines that wouldn’t be resolved. I did NOT expect that nearly zero of the plot lines would be resolved, at all. Yikes. Now, I’m not saying I didn’t enjoy it. I did. But it felt like there were 50 to 60 pages missing that should have been in the story to at least wrap up minor plot lines before heading into ‘Battle Ground’.

Warning: Full of Spoilers

Such the arrival of the Outsiders those Cornerhounds. Um… Outsiders and at no point that Harry wonder why in the hell they were called to Chicago? Or why they were targeting him and Ebenezer. Seriously, unless the author totally forgot we know that Outsiders can only be called by mortals. So human wizards brought them. So was it someone in the ‘Black Council’ or was it the Formor, since we know from previous stories that they grab humans and mind-whammy them and also modify them. And we know that they’ve been pretty focused on grabbing minor practioners for a couple of years now.

Hell, even just knowing why Thomas attacked the svartalf King would have been good to know in the book even if we don’t find out who it was yet.

That being said lets start of with things I didn’t like.

Thing Which I Wasn’t All that Pleased About:

1. Butters in that threesome relationship.

Now, let me explain, it’s not because its a poly relationship. I don’t even twitch over how Justine and Thomas include others in the sexual part of their relationship. It’s because I kept wondering if Marci was even into dudes. As far as I knew she was only into girls. And now she’s suddenly bi?

What the hell?

I think my reaction has a lot to do with how skewed the sexual orientation gradient in shown among Named characters. You have straight men. Straight women. Bi women who are shown to be blatantly into men and women…and that’s it, now.

No lesbian women with zero interest in men. No bi men. No gay men. No asexual characters. No trans characters. No gender fluid people.

I know that this due to the author’s eye and while it hasn’t irritated me much in the past as we keep getting more and more books with more newly introduced characters the lack is becoming more and more glaring to me. Especially, as I have drifted into reading other series that manage to be way more inclusive about this sort of thing in great and amazing ways *sighs happily over Rivers of London series*. And I don’t just mean in passing with random nameless scenery people that never talk which have popped up in the Dresden Files but with actual characters that have names, dialogue and contribute to the series.

So it really, really annoys me that Marci went from being the only lesbian who is a named character to joining the horde of bi women in the DF verse.

Okay, so its not really a Butters issue to much as a grumble about the spectrum of gender and sexually needing better representation.

*grumbles* Step up your game, Butcher.

I will add that I’m head-canoning that actually the relationship here is Butters with Andi, Andi with Butter and Marci, and Marci with Andi. That pretty much with Butters running around being the new Knight Andi didn’t like how her boyfriend wasn’t paying attention and gave Butters the ultimatum of letting Marci in as Andi’s girlfriend or they broke up.

… yeah, I’m totally liking that spin way, way better.

2. That Marcone took forever to show up! ARGH! I love him ok.

Considering how early he was name dropped in the story the amount of time it took him to show up… Jim Butcher is a damn Marcone-tease. *glares hotly in author’s direction*

3. I don’t like it that Murphy is so hurt. I don’t hate it. I think I’m just uneasy about the future implications.

Having reread the entire series before reading ‘Peace Talks’ I fully expected some lingering injury but not to that level. I’m actually worried about her chances of surviving any upcoming battle, and not just in Battle Ground. There’s even more danger coming down the pipeline in future books and she won’t let herself stay ‘safe’ when she could be watching Harry’s back… so its a worrying problem.

Now if she died I have no doubt that her being recruited to be a Valkerie is an option. But then I remembered how those warrior women go out into the world with ‘clients’ and of the two we’ve seen they’ve been attached to ‘monsters’ aka Lara and Marcone.

Unless, the payment isn’t cash and she can be attached to Harry. *hums in thought*

But then I have to wonder how much Murphy would accept that role. She’s also a pretty devout Catholic as this book reminded us so that is also something that would make her say no to the offer.

4. That the younger Wardens who had so looked up to Harry being so damned suspicious… ow. That hurt. I may have teared up and sniffled into a tissue thinking about it. And then sobbed because so much of it came from Carlos… Carlos! The man went into the Deeps with Harry! Ouch.

5. Rudolph… that roach.

Ugh, I’ve had the disturbing thought that now that magic and the supernatural on the path to being exposed to all of humanity, scared humanity too, that will end up with a resurgence of a new Inquisition and the killing of anything eldritch. And you know that Rudolph would definitely be in it. *shudders in disgust* Creep.

BTW I totally don’t believe that Rudolph answers to Marcone. It doesn’t make sense as to why he was so pushy go get Harry during ‘Changes’. I had thought he was answering to the Red Court but with them being taken out of the picture… now I wonder if he isn’t answerable to the Black Council.

Things I Did Not Expect:

1. Damn… when Ebenezer sent that spell through Harry and ‘killing’ I was so shocked even though I was pretty sure there was a twist coming. Mostly because of what it says about Ebenezer.

Ebenezer actions killed Harry.

Sure it was a fake body that brought no harm to the real Harry. But if Harry hadn’t thought ahead? If he hadn’t used his brain to ask Molly to create a fake? Eb would have killed his own grandson.

Sure it was an accident but it could so easy have resulted in a dead Harry. I was crying so hard I wondered if my eyeballs were loosening in their sockets. Argh.

2. Bonea…. Harry your naming skills are simply weird. I’m so glad that Susan named Maggie.

Although Bonnie is a pretty great nickname.

Thinks I Found Utterly Hilarious

1. The line about the best offense being a T-Rex? Gold. Pure gold.

2. When Harry figured out there are angels in the hilt of the Swords of the Cross and Butter’s immediate reaction of horror because he’d accidentally laundered the hilt, giving it a ride in a washing machine.

OMG! I had the instant image of a miniature angel screaming and growing dizzy when going through the spin cycle.

I know that makes no sense but that’s where my mind went, okay.

3. The conjuritis. Omg, it’s so gross with all the ectoplasm leaking from Harry’s nose but it’s sooooo funny. Also the way he kept getting the ‘aren’t you too old for this’ from Ebenezer and then Lara made me giggle even harder.

Then I thought: dude, it’s like chicken pox, something you got as a kid but if you never had it you get it when exposed later in life. So one of his kids has it. Probably Maggie too.

4. When Sanya pretended to have his hand lopped off. I straightened up and was so worried Sanya had lost a hand. Then when I realized he was pretending to freak out Butters and Harry I admit to laughing way too hard. Got me too.’

Also there’s no way that Sanya was actually defeated there. He’s younger and better trained then Butters, I don’t care how light (Heh) the new sword is. He definitely threw that fight to test his hunch.

5. Murphy’s inability to handle being flirted on with a red-headed warrior woman. Sooooo funny. I mean, Murphy could have said a number of things such as ‘I’m exclusive.’ or ‘I’m not interested in women.’ But she just floundered. Heh heh.

6. I continue to find it completely hilarious that Lara, a couple of centuries old vampire, seems to keep learning a lot of power moves from Marcone.

Such as: having trained fighters that are NOT food, well… mostly. Having those mines installed in the walls. And now hiring a Valkerie of her very own.

I keep thinking, yeah, there’s no way she’d win in a fight against Marcone because there’ s no way that Marcone has let slip all of his tricks.

Things I Really, Really Liked:

1. Marcone. Everything Marcone. *heart-eyes*

And then he proves why he’s so damned scary by standing up to the Titan. Then to the ghouls. Then after proving his bad-ass quotient if off the charts he gets everyone organized to fight.

Yeeessss… It proves to me that when it comes to protecting Chicago he is actually the best person after Harry. Hell, in some ways he’s better than Harry. Now, I’m not saying he’s a white knight or anything like that. Just that he has the intelligence, the ruthlessness, the will, the power and the men to provide the most protection to the city’s mortal denizens. At least when there’s a war raging with multiple enemies who will be attacking at various points.

And oh, I can’t wait to see how he’s going to get revenge for the death of his people. Omg, he’s going to kill the Formor so hard. *goes starry eyed thinking about more Marcone*

But why did he have to appear so late in the book?! *wails in a heart-rending fashion*

There better be a ton more Marcone in the next book! *makes desperate gimme gimme hands*

No, I don’t have a Marcone addiction… I can stop anytime I want to. *sneaks off to mainline some “Even Hand” straight into the brain*

2. The return of Goodman Grey! Oh, I hope he’s around a lot! I’ve really grown to like him.

<b>Things Which Blew My Mind or Were Just Freaking Awesome: </b>

1. Dad!Harry is actually the most amazing Harry. Forget the magic flinging and the fire storms… this is the best Harry.

Just the way he takes care of his kids…. *turns to mush like ectoplasm*

2. Murphy and Harry are finally together! Yay! Yay! Hip hip hooray!

Now, I’m a rather shameless Marcone/Dresden fic writer, but as I never ever expect this to be canon I’m content to write it as fanfic for my own sense of delight. However when it comes to canon I’m full on board with the Karrin and Harry relationship. Be it friendship or romantic, I think its great.

3. Marcone… that is all.

Random Speculation

1. I find myself wondering about Ebenezer’s rage against vampires. And my brain muttered this theory: Maybe Harry’s grandmother was killed by White Court vampires.

Whoa.

It would explain the vitrolic rage.

And if Lara was involved it would also explain her flash of shame.

We don’t know anything about Harry’s grandmother, not even her name. So… that’s a thought.

2. River Shoulders teaching Harry.

Oh man, oh man, I hope Harry learns shape-shifting.

And thinking about it I had to wonder if the animal-shifting had anything to do with knowing the animal in question which of course made me think…

Harry should learn to shape-shift into a T-Rex.

He already knows how one is put together and the mind of one. And he knows that it’s possible to add extra mass to a shift from the Nevernever in the form of ectoplasm… so

Harrysarous Rex, baby…. I may have to write a fic with this premise.

3. Oh, if it’s possible to make a ectoplasmic body can Harry learn to make one for Bonea? After all Maggie would probably really enjoy getting to play with her little sister that way. Even if Harry can’t do it all the time and it wouldn’t last longer than a day. That would be delightful.

4. Okay, not this is more head-canon than speculation but… considering how hard Harry has been made to be analogous to Merlin I can’t help but wonder if Marcone is suppose to be Arthur’s analogue. So wielding Amorrachius *coughs*Excalibur*coughs* would make sense.

…it’s not just my Marcone-love talking dammit.

Speaking of Merlin, I’m convinced that he’s behind this whole ‘starborn’ thing. Seriously, otherwise its way too convenient that a wizard with that power is born every 666 years. It smacks of a spell.

And if that’s the case it also feeds into my pet theory that the whole reason we have Outsides at the Gates is because Merlin was the schmuck who drew them to our reality in the first place. And everything surrounding the war with the Outsiders are his attempts to try to fix what he broke.

*lost in pondering thoughts*

Things I Have Questions About

1. Did Harry forget he has The Ways Map from his mother? I would have thought he would have figured out a way (heh) to get to the island somehow. He was on it for so long I thought for sure he’d spend time exploring it. Also we knew from ‘Skin Game’ that even tiny factors can change where the Way goes in the Nevernever. I doubt the ENTIRE island has Ways that lead to a bad place. Especially for Harry now that he’s the Warden.

2. Also why didn’t Harry get Lea to help him? After all unless she’s moved it since ‘Changes’ her garden is still on the other side of the sub-basement.

3. What did Lara use that first favor from Mab on? *eyes her suspiciously*

4. Where are the Za Lord’s Guard? *wondering about what been happening with Lacuna and Toot-toot*

5. If Harry gets kicked out of the White Council (good riddance, since they haven’t exactly been all that helpful lately) can he get enough signatures to be added as a member of the Accords in his own right? After all being Warden of Demonreach has got to mean a lot to the older members.

Then he wouldn’t be reliant on Mab’s protection.

I can’t help but hope this proves to be the case, especially if in ‘Battle Ground’ Harry ends up taking down that Titan. Because he needs as much protection and influence he can gather if he’s no longer White Council to protect himself, his people and his kids. Especially if he eventually gets rid of that Winter Knight mantle like I hope he does.

6. How in the hell (pardon the pun) did evil demon Sasquatch survive being turned to mush by Hade’s Ice Gate? Or the shades that were part of the security system that almost got Harry?

*frowns* The only reason I can think of would be the coin of Ursiel being the factor. I doubt a Fallen Angel is allowed to stick around in the Greek realm of the afterlife.

7. WHERE IS BOB?! Seriously, if Butters doesn’t give him back...

#peace talk spoilers #the dresden files #john marcone #full of speculation #can't wait for more #harry blackstone copperfield dresden #karrin murphy #spoilers #the dresden files spoilers

27 notes · View notes

butididnottried · 5 years

Text

I’m late to the party, but whatever. After a (ehehe he) few months of thinking about it, i finally watched netflixs “She-Ra and Princesses of Power”.

- Oh. Oh... Oh wow. Just wow. All these jokes and memes about Catra and therapy makes so much sense now. Like, even TOO much. This show have no business in showing all these issues so good, and yet, there they are.

- Scorpia is such a cinnamon roll. But she’s so stressed. She tries to play it cool, but man, her stress level is on some cosmic level. I have no idea how she do not lost it and not murdered anyone. Come on big girl, i’m going to be your best friend and you can hug me as much as you want. <3

- Hey Adora.

- I hope that Shadow Weaver will not pull some betrayal shit right now and will stick with the rebellion against Horde Prime. I don’t need her to be redeemed, she don’t really deserve that and probably don’t even want that. Also, she’s on the good side out of bad motives, so that’s that. But her changing sides again would be just stupid and too predictable. It’s obvious that she will again try some shady magic to “save” the planet, while also at this same time gain more power, but i hope that will blow up in her face. Badly. Buuut. Since king Maika is alive and back at Bright Moon maybe he will have some good influence on her. Strongly doubt that, but its always a possibility.

- Bows voice acting is probably my favorite in the whole show. The comedy timing with his voice, when it’s going a little to high and cracks up? That’s The Good Stuff.

- And i don’t really like Entraptas (not Entrapa, what) voice timbre. This voice actress is very good - like every other on this show tbh - but something about her voice alone annoys me. She also often sound like her nose is stuck? Which is a nope for me.

- Hey Adora.

- Ah, Entrapta, my adorable science baby. How someone so smart can be so dumb at this same time. I know that she’s autism coded, but im not talking about that. She figured out this whole The First Ones tech, this whole connection of magic, princesses and rune stones to the WHOLE planet, but didn’t thought even for a second that maybe activating this machinery could most probably blown everything up. Really? ReaLLY? But maybe that’s just a science people thing, being sooo much into it, that nothing else matters? Idk, i’m a dumbass, i do not get science very much. But when she was like “we need to turn this portal thing off, Hordak will understand” i was like “oh no, oh honey, no, he DEFINITELY will not” and this moment was kinda hilarious. Oh well.

- And they we’re lab partners. _^_

- I don’t really know why, but i like Hordak. He’s that good kind of dumb, angry and nor very well socialized villain. Well, he lived in a place not very well suited for proper socializing. Yeah, that - he got a nice, kinda different backstory. Usually when a character is a clone their big and dark torment is the fact that they’re a clone. But he’s even proud of that? Because the original one is powerful and magnificent Horde Prime, so it’s an honor to be his clone. His problem is that he is a defective clone, unworthy, when he was made for such grande purpose like conquering the galaxy. I can’t even very much blame him for his bending for murder and destroy. Not because he’s sad, but because he was made in a lab to be like that, more or less programmed - murderous, angry and destructive. In cases of characters like that it’s not very much like an explanation, but almost an justification (but hey, that’s me, about fictional people, so chill please (: ). It’s like blaming a not self-consciousness machine for going rouge. Well, Hordak is not a stupid, unaware robot, but idk, there’s no real analogue in real world for a beings like this, so i “choose” to feel like that about fictional characters being made to be put-there-whatever. Also, he’s physically so fragile? It’s hysterical. It feels like the faintest wind would blow at him, and every bone in his body would broke.

- And what i wrote about Hordak i think also about Light Hope. Shes and AI, probably almost at point where she could obtain self-consciousness, but not quite yet there. And she did what she did because she stick to her main program, she really didn’t have a choice. But she had! This one time. Because she is capable of learning and grow beyond her program. I don’t now if younger audience is going to catch that, but i’m happy that AI was showed as it is - just an very advanced AI, and not a mean, bad person. Or maybe she is self-aware and i just didn’t noticed that. Also, her design. <3

- hEy AdOrA.

- I was so ready to like Double Trouble, and eeeh. The only magic here is acting. I do not copy, i perform. I put everYTHING into ROLE! I’m an Artist! ArTiSt! IT’S ART! asdfghjkl just go away with that you pompous prick. Uuuugh, this is just the worst kind of artists. But, i still appreciate how they do not have any sad backstory (yet?), and are there only for money, drama and spreading chaos. At least someone is having fun in all this mess.

- Adora is so gay for big ladies. When all this mess is going to end, she deserve some romantic plot with gentle butch. Give Adora some big woman to love, you cowards!

- One of Bows dad is wearing socks and sandals. That’s it.

- Swift Wind was visiting madame Razz all this time, because shes and old lady living alone in the woods. My heart just melted. <3 Also, i really want to know whats going on with her. Like, no one cares that’s shes probably more than a one whole thousands years old? But it look more like she has some time bending powers, that she do not control? And it messes with her memory and mind? Poor lady. ):

- I had this feeling deep in my guts that The First Ones are going to be revealed as stupid bitches. And hey, they turn a magical planet into a super weapon. Why these ancient civilizations are such ignorant morons?

- I know that relationships between characters are the most important thing in this show, but man, i was so much there for the worldbuilding. The more information they were giving, the more i was like “just tell me what’s going on!!!”. And wow, i’m not disappointed. A++. But tbh, if we put aside all this cute stuff like magic, princesses and shiny, magical stones, this whole shit is pretty terrifying.

- When during daring rescue of Glimmer and Bow in Fright Zone Perfuma admitted that working with Entrapta can be... kinda difficult, and Entrapta - with a smile! - just nodded in agreement. This. This is probably my favorite joke in this whole series.

- h e y a d o r a

- Seahawk. Much love. Much joy. Gold of heart, dumb of ass. Yes.

- Also Huntara. Damn, woman, can you maybe tune down your attractiveness? I’m trying to keep myself together here.

- Designs in this show are just top notch. Bon Appetit.

- I love how this world is inhabited by so many various creatures, not only humans. NICE.

90 notes · View notes

terezis · 4 years

Text

okay she-ra thoughts under the cut (spoilers)

it was all so very good that i don’t even know what to gush about (yes i do) (that kiss???) it is just so fucking wild and marvelous to me that noelle stevenson took such a huge ip and revamped it into such a great fuckin, gay ass love story. bc that’s what it is, huh. is a fuckin GAY ASS LOVE STORY AND IT MADE ME CRY WITH HOW GREAT IT WAS

the second thing i want to gush about is LMAO I STILL REALLY FUCKING LOVE ENTRAPTA/HORDAK... THAT MOMENT AT THE VERY END WAS SO CUTE I WISH THERE’D BEEN MORE...

between him and wrong hordak i hope entrapta gets an entire harem of clone-based “””lab assistants””” because l m a o... I REALLY LOVED WRONG HORDAK TOO HE WAS SO CUTE...

also that moment in episode 3 where catra saves glimmer is GOD. GOD!!! i’m going to be rewatching that every day for like a fucking month it was the shit i am all about.

also LMAO I REALLY WASN’T SERIOUSLY EXPECTING GLIMMER/BEAU TO BE FOR REAL END GAME THOUGH??? i really thought it was going to be catra and adora and that’s it, but nah they fuckin went there huh. i do not see the appeal but u know what man it’s fine yall do you.

my only complaint is that i can’t believe shadoweaver sacrificed herself for catra??? because i personally had been hoping either she or adora would get to do a murder, but i get why they wouldn’t swing that LOL... at the very least i wasn’t expecting the sacrifice to be so overt.

i’m not UPSET about it but it did make me a little uncomfortable in the moment, like i don’t think catra really needed her "caring” in the end and tbh if an abusive parental figure sacrificed themselves to save me like that... i’d just be kind of mad. i’d feel gross about it. LMAO. this isn’t a redemption for me imo. oh well

anyways.

THAT KISS THOUGH

i’m just gonna keep adding to this post as i think of things:

edit 1: also i do kind of wish we’d found out just a LITTLE bit more about where adora came from, like i don’t need a backstory for her bio family or whatever but horde prime did kind of say all first ones were extinct? clearly not though because ADORA HAD TO COME FROM SOMEWHERE

like narratively ig it doesn’t matter much especially since it’s stressed so hard that her origins weren’t as important as her Found Family...

IT’S JUST GONNA BOTHER ME THOUGH... IT SEEMS LIKE SOMETHING YOU DON’T BRING UP UNLESS IT’S GOING TO COME BACK AGAIN LATER...

edit 4: ok i went back and rewatched part of episode 5 and he does say “some faction must remain” so I GUESS IT’S FINE............ LOL

edit 2: also guys... short haired catra... is so fucking cute

edit 3: i keep coming back with complaints but i promise i really liked it LOL... BUT DAMN I GUESS ANGELLA’S REALLY GONE, HUH??? I REALLY THOUGHT THEY WERE GOING TO BRING HER BACK SINCE SHE’S JUST “TRAPPED IN THE IN-BETWEEN OF A PORTAL” AND NOT “OUTRIGHT DEAD”

BUT THEY REALLY FRIDGED THAT MOM HUH... LMAO...

edit 5: i just keep thinkin bout how this whole show was definied by catra and adora’s relationship... their SO VERY QUEER RELATIONSHIP... THAT THIS SERIES CULMINATED IN THEM KISSING AND EXCHANGING I LOVE YOUS.......... IT’S SO FUCKIN......... DANG

like we have garnet and we have, like, korrasami... but this feels... More i guess? this time the show was ABOUT them. it was ABOUT this relationship. korrasami always felt rly shoved in at the end, i love it but this feels LOL IDK JUST... MORE! IT’S A LOT!!! IT’S REALLY GOOD AND IMPORTANT TO ME

#spop spoilers #she-ra spoilers #spoilers

36 notes · View notes

spiderdreamer-blog · 4 years

Text

Assorted/Jumbled Thoughts on She-Ra: The Final Season (MASSIVE SPOILERS WITHIN)

Well.

I think I can safely say I was not expecting much of that to occur. So in lieu of either incoherent screaming or a larger analysis post (though I might do that upon a full series rewatch), I’ll instead offer miscellaneous thoughts on the final season of Noelle Stevenson and DreamWorks Animation’s Netflix Original Series, She-Ra and the Princesses of Power, below in bullet point format.

-So I was admittedly a hard sell on canon Catradora endgame leading up to this. I thought the relationship itself was great: complicated, messy, and full of both positive and negatives that they had to work through while still caring so, so much about each other. But a lot of the fandom was, well, let’s be real, pretty obnoxious about it and the usual kinds of infighting occurred that I think are really petty and stupid (call it Klance Syndrome). Surprise surprise, when you actually involve good writing and acting instead of weird fan projections, I’m way more invested! In particular, Aimee Carrero and AJ Michalka do their series-best work by a longshot in a number of scenes here, particularly The Big Gay Moment. Well done.

-Tying into the above, I thought Catra’s “redemption arc” (as noted, I’m on record as hating that phrase/it should be called “self-improvement arc”) was extremely well handled, probably on the level of Zuko’s if in some notably different directions. The key, as with our favorite fire prince, is that she makes a dramatic, notable change in behavior and has advocates to back her up. Glimmer spurs her into action and is the first to sell others on the idea that she’s changing, and it’s enough to convince Adora to keep reaching out. What I also appreciate is that the frustrations and hangups still play a role: Adora gets aggravated by Catra’s continued reluctance to open up to people, while Catra finally articulates her big problem with Adora’s self-sacrificial tendencies in a way that leads to real emotional breakthroughs. Even things like Bow teasing her about her cuteness or Perfuma making a connection with her through their shared bond with Scorpia make a real difference in how she is seen and perceived (also, Perfuma offering to help her with meditation techniques to start unpacking “your abandonment issues and negativity” is Genesis Rodriguez’s funniest line delivery in the whole series).

-Micah being afraid of not being seen as a Cool Dad thanks to interactions with Frosta is deeply fucking hilarious. I love that Daniel Dae Kim gets to offer a quirky performance here that is reminiscent of Reshma Shetty’s work as Angella, Sandra Oh’s Castaspella, and Karen Fukuhara’s Glimmer, thus showing how he fits of a piece in their family. And the big mind-controlled fight with him and Glimmer in the climax is one more great emotional beat to add to the whole pile of their reunion.

-Melog is a good space kitty and I’m glad Catra gets to have them. That is all.

-ENTRAPDAK FUCKING RIGHTS.

-Okay but seriously no, Hordak asserting himself and tossing Horde Prime’s ass off a ledge Palpatine-style is one of THE most triumphant moments in the series. I’m intensely glad my dumb bat-eared son got to be with his autistic science girlfriend.

-On that note, were it not for the rest of the cast, especially MIchalka and Carrero, doing the aforementioned series-best work (Lauren Ash and Krystal Joy Brown also really shine as Scorpia and Netossa in their respective focus episodes, and I have to give Noelle props as well for getting to give Spinnerella some varied emotions, esp. since she’s not a “traditional” VA), Keston John would easily be the season’s voice acting MVP. As Horde Prime alone, he gets to do so much in building a proper endgame villain, by turns cool and collected cult leader (seriously, that backup group of chanting clones is massively fucking creepy), then slowly trying to wrest control of the situation, and finally a gleefully ranting extremist brought down by his own hubris. But THEN, he not only does “our” Hordak in a new and intriguing “lost” way, he does all the other clones in their clipped-but-pleasant manner AND the delightfully unexpected creation that is Wrong Hordak, who you just want to give a hug within about five seconds and is also the provider of much of the best dark comedy in the season.

-It was also really good to see Entrapta come into her own and genuinely focus on doing the right thing while still getting to be her glorious nerd self. I like how her hair began to act a a visual conscience/reminder of the important things she NEEDED to do in particular.

-The more I think about Shadow Weaver’s final moments, the more I like them? She’s always been a character defined by believing in her own bullshit, but this season starts to show some real glimmers of self-awareness (asking Castaspella to stop her if she tries to take the Heart for herself) even as she continues being awful (gestures at everything else). Yet I don’t think it’s as simple as “she Finally Realized She Cared”; even as she tells Catra she’s proud, there’s something else going on there and how she takes off her mask for the “You’re welcome” callback, appearing truly vulnerable before us for the first and last time (her flashbacks as Light Spinner still had the partial face veil, after all). I’m not sure what it is, and I think that’s the point? Catra and Adora were both hurt and abused by her, but they also did look up to her as a genuine figure of authority and trust. They’re going to have to live with their complicated feelings about that and not ever knowing who she TRULY was as a person for the rest of their lives even with the happy ending they’ve been granted.

-I think this season finally had what I could call some really great action scenes and fight choreography, and a big part of that is the immediately raised stakes via Prime and his clones/drones. The generic Horde soldiers were always pretty pathetic/easily swatted aside cannon fodder, but these guys don’t mess around. The use of the chip zombies also adds a lot of great tension to power brawls like Netossa and Spinnerella, or Mermista and Scorpia showing off their powers in truly dangerous-to-others ways. It’s still not up to the level of, say, a Studio Mir-animated series or something like DuckTales with its variety of chases and fights, but I welcomed the smoothing out of the series’ key weakness visually.

-I suppose one could say there are “flaws”: some worldbuilding that could’ve been fleshed out more (we mainly get it explained to us how Horde Prime and the First Ones brawled for control; a flashback might’ve been cool), some arguable conveniences that crop up (they JUST SO HAPPEN to be by a planet that holds Prime’s weakness, guys!), and characters I would’ve liked to see more of (Double Trouble, though their big cameo is awesome, Huntara, and the newly introduced Star siblings). But they’re ultimately small things/probably a Pressed For Time issue.

-Though I will say the one reinvented character who’s never really worked for me is Swift Wind. Which is frustrating because it’s not like he’s awful/a drag/I want to get out the shotgun every time he was onscreen. I think it’s because he’s always felt jarring as a screen presence with his comedy stylings and that I’ve never really been sold on him as this boon companion for Adora, especially since her relationships with everyone else are so compelling. He gets some okay moments here, but it’s the only real misfire in the series in terms of updating characters for me. Ah well.

-Bow got to step up in major ways this season as a leader, getting a big heroic rallying speech and everything. It’s what he deserves/I’m proud of the guy. I also appreciated things like Glimmer telling him he could still be mad at her as long as he needed, but that she wasn’t going to give up or leave him. And while I’ve never been a shipper for them, the moment where they admit their feelings before running off to battle IS genuinely sweet. It was also fun to see his dorky dads again and get a truly awful/wonderful dad joke in the process.

-I enjoy how the series doesn’t give us a “where are they now” epilogue like many other recent series, but leaves things off on a note where the future’s just ahead and able to be defined by our Best Friend Squad, now with a fully enveloped Catra. That feels right.

That’s it for the moment, though as said, there might be more posts, even longer ones, in the future. For now, I wanna say thank you to Noelle Stevenson, Josie Campbell, Katherine Nolfi, Shane Lynch, Jen Bennett, Adam Henry, Chuck Austen, Sunna Wehrmeijer, Mary Elizabeth McGlynn, the aforementioned terrific voice cast, animation studio NE4U, and everyone responsible at DreamWorks and Netflix for making this wonderful, queer-as-fuck show. I wish them all the best in their future creative endeavors and look forward, like Adora, to what’s over the horizon.

#she-ra #spop #spop spoilers #she-ra spoilers #analysis

17 notes · View notes